BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6291
(79 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2FTC|H Chain H, Structural Model For The Large Subunit Of The Mammalian
Mitochondrial Ribosome
Length = 148
Score = 43.9 bits (102), Expect = 2e-05, Method: Compositional matrix adjust.
Identities = 19/45 (42%), Positives = 33/45 (73%)
Query: 3 VMKKAVRWELPRSLIKFRLMARLHIFPDQEVPEDLLKNVSSQIRQ 47
++K A+ LP++L + +M RLH+FPD+ +PED+LKN+ ++ Q
Sbjct: 103 IVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQ 147
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.140 0.408
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,263,068
Number of Sequences: 62578
Number of extensions: 73177
Number of successful extensions: 214
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 212
Number of HSP's gapped (non-prelim): 5
length of query: 79
length of database: 14,973,337
effective HSP length: 48
effective length of query: 31
effective length of database: 11,969,593
effective search space: 371057383
effective search space used: 371057383
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)