Diaphorina citri psyllid: psy6316

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26

MQAVFNKRREKIEENPEDENFMRAAIVCVLGHVDTGKTKILDKLRRTNVQDGEAGGITQQIGATNVPADAIRENTKHVRGPGGEVGGPGPLEIPGLLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINILKSKKTPFVVALNKIDRLYNWNTMNRRDVRDIIKSQESSVQTHKTVESARKGQEICIKIEPIPGEAPKMFGRHFDENDFLVSKISRQSIDACKDYFRDDLQKTDWQLMVDLKKVFQIL

cHHHHHHHHHHHHccccccccccccEEEEEcccccccccHHHHHHHcccccccccccHHccccEEEcccHHHHccccccccccccccccccccccEEEEccccHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHcccccccEEEEHHHHHHHHHHHHHcccccccccHccccccccccEEEccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcccc

********************FMRAAIVCVLGHVDTGKTKILDKLRRTNVQDGEAGGITQQIGATNVPADAIRENTKHVRGPGGEVGGPGPLEIPGLLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINILKSKKTPFVVALNKIDRLYNWNTMNRRDVRDIIK**ESSVQTHKTVESARKGQEICIKIEPIPGEAPKMFGRHFDENDFLVSKISRQSIDACKDYFRDDLQKTDWQLMVDLKKVFQIL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Eukaryotic translation initiation factor 5B	Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.	confident	O60841
Eukaryotic translation initiation factor 5B	Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.	confident	Q05D44
Eukaryotic translation initiation factor 5B	Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.	confident	B2GUV7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022627 [CC]	cytosolic small ribosomal subunit	probable	GO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0015935, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0044424, GO:0032991, GO:0043228, GO:0030529, GO:0043226, GO:0044422, GO:0005840
GO:0043022 [MF]	ribosome binding	probable	GO:0043021, GO:0003674, GO:0005488
GO:0006413 [BP]	translational initiation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699
GO:0003743 [MF]	translation initiation factor activity	probable	GO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G7S, chain A
Confidence level:very confident
Coverage over the Query: 21-161
View the alignment between query and template
View the model in PyMOL

Template: 3IZY, chain P
Confidence level:very confident
Coverage over the Query: 23-70,93-203
View the alignment between query and template
View the model in PyMOL

Template: 1ZUN, chain B
Confidence level:very confident
Coverage over the Query: 95-214,229-257
View the alignment between query and template
View the model in PyMOL