Diaphorina citri psyllid: psy6333


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MSMYSHIDIRTFAATLSNVSTTSVSLLPLFQIIAIISIMFIVLSTVALTLNTIPSLQHKDKAGNPIDNPKLAIVEAVCITWFSVEYLLRLGASPEKWKFFKGGLNVIDLLAIMPYYISLFLLESNSTSNEQEVQTRTDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEHDTKFVSIPETFWWAGITMTTVGYGDICPTTPLGKMIGSNQMRREKALKRREAMERAKREGSIVSFHHVNLRDAFAKSMDLIDVIVDTEILIREKRERKRRKKKKKRKRKRKKRKEKEKKKKKRKKKKRKKKRKKKKRKKKKRKKEEKKKKKKKKKKKEKRKKR
ccccccccHHHHHHHHHccccccccccccccEEEEHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
****SHIDIRTFAATLSNVSTTSVSLLPLFQIIAIISIMFIVLSTVALTLNTIPSLQHKDKAGNPIDNPKLAIVEAVCITWFSVEYLLRLGASPEKWKFFKGGLNVIDLLAIMPYYISLFLLESNS***********DQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEHDTKFVSIPETFWWAGITMTTVGYGDICPTTPLGKMIGSNQMRREKALKRREAMERAKREGSIVSFHHVNLRDAFAKSMDLIDVIVDTEI**************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMYSHIDIRTFAATLSNVSTTSVSLLPLFQIIAIISIMFIVLSTVALTLNTIPSLQHKDKAGNPIDNPKLAIVEAVCITWFSVEYLLRLGASPEKWKFFKGGLNVIDLLAIMPYYISLFLLESNSTSNEQEVQTRTDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEHDTKFVSIPETFWWAGITMTTVGYGDICPTTPLGKMIGSNQMRREKALKRREAMERAKREGSIVSFHHVNLRDAFAKSMDLIDVIVDTEILIREKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium voltage-gated channel protein Shab Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.confidentP17970
Potassium voltage-gated channel subfamily B member 2 Mediates the voltage-dependent potassium ion permeability of excitable membranes. Channels open or close in response to the voltage difference across the membrane, letting potassium ions pass in accordance with their electrochemical gradient.confidentQ63099
Potassium voltage-gated channel subfamily B member 1 Mediates the voltage-dependent potassium ion permeability of excitable membranes. Channels open or close in response to the voltage difference across the membrane, letting potassium ions pass in accordance with their electrochemical gradient.confidentQ14721

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051049 [BP]regulation of transportprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0001508 [BP]regulation of action potentialprobableGO:0019725, GO:0042391, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0060025 [BP]regulation of synaptic activityprobableGO:0019226, GO:0035637, GO:0050803, GO:0050804, GO:0023052, GO:0023051, GO:0010646, GO:0050789, GO:0044699, GO:0044057, GO:0065007, GO:0065008, GO:0032501, GO:0050877, GO:0009987, GO:0050794, GO:0044763, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0031644, GO:0008150, GO:0051969
GO:0008076 [CC]voltage-gated potassium channel complexprobableGO:0043234, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034702, GO:0034705, GO:0071944, GO:0034703, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044304 [CC]main axonprobableGO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0008345 [BP]larval locomotory behaviorprobableGO:0007626, GO:0030537, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006813 [BP]potassium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0032809 [CC]neuronal cell body membraneprobableGO:0044298, GO:0043025, GO:0016020, GO:0044297, GO:0005623, GO:0044464, GO:0005575, GO:0097458, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0015271 [MF]outward rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0005249, GO:0022839, GO:0022838, GO:0015079
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0032590 [CC]dendrite membraneprobableGO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0044464, GO:0005575, GO:0097458, GO:0032589, GO:0071944, GO:0043005, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008016 [BP]regulation of heart contractionprobableGO:0008150, GO:0065007, GO:0051239, GO:0044057, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R9R, chain B
Confidence level:very confident
Coverage over the Query: 5-259
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 299-355
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 248-310,333-370
View the alignment between query and template
View the model in PyMOL