Diaphorina citri psyllid: psy6334


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60---
MQALLELHNLASNHKDANFTDFLESEFLQEQVDSIKSLADLLTNVRRVGEGLGIFVFDKELKS
cHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccc
MQALLELHNLASNHKDANFTDFLESEFLQEQVDSIKSLADLLTNVRRVGEGLGIFVFDKELK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQALLELHNLASNHKDANFTDFLESEFLQEQVDSIKSLADLLTNVRRVGEGLGIFVFDKELKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006879 [BP]cellular iron ion homeostasisprobableGO:0019725, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0055072, GO:0044763, GO:0008150, GO:0030003, GO:0055065, GO:0055080, GO:0065007, GO:0055082, GO:0065008, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KXU, chain A
Confidence level:very confident
Coverage over the Query: 2-50
View the alignment between query and template
View the model in PyMOL