Query         psy6352
Match_columns 136
No_of_seqs    261 out of 1250
Neff          8.7 
Searched_HMMs 46136
Date          Sat Aug 17 00:13:29 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6352.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6352hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01607 CBM_14:  Chitin bindin  99.5 1.4E-14 3.1E-19   82.3   2.0   48   88-135     6-53  (53)
  2 PF01607 CBM_14:  Chitin bindin  99.5 5.2E-14 1.1E-18   80.0   3.7   48    8-56      1-49  (53)
  3 smart00494 ChtBD2 Chitin-bindi  99.4 1.1E-12 2.4E-17   75.0   5.2   50    7-57      2-52  (56)
  4 smart00494 ChtBD2 Chitin-bindi  99.3 4.6E-12   1E-16   72.4   4.3   46   88-133     8-53  (56)
  5 PF03427 CBM_19:  Carbohydrate   92.2    0.16 3.5E-06   29.5   2.4   21   98-118    35-55  (61)
  6 PF03427 CBM_19:  Carbohydrate   91.9    0.21 4.5E-06   29.0   2.7   21   23-43     35-55  (61)
  7 PF08475 Baculo_VP91_N:  Viral   68.4     5.6 0.00012   28.3   2.7   38   90-129   106-143 (183)
  8 PF08475 Baculo_VP91_N:  Viral   67.6     8.6 0.00019   27.3   3.5   38   14-54    106-143 (183)
  9 PF12662 cEGF:  Complement Clr-  64.3     4.7  0.0001   18.8   1.1   16   37-52      5-20  (24)
 10 cd00064 FU Furin-like repeats.  58.5     8.7 0.00019   20.6   1.8   18  109-126    31-48  (49)
 11 PF01826 TIL:  Trypsin Inhibito  53.7     2.4 5.2E-05   23.6  -1.1   19  111-130    35-53  (55)
 12 PF00220 Hormone_4:  Neurohypop  45.7      11 0.00023   13.4   0.5    6   36-41      4-9   (9)
 13 PF09064 Tme5_EGF_like:  Thromb  39.7      25 0.00054   17.9   1.5   21   28-48     12-32  (34)
 14 PF07645 EGF_CA:  Calcium-bindi  38.8      13 0.00027   19.4   0.4   32   19-51     10-42  (42)
 15 PF03128 CXCXC:  CXCXC repeat;   30.4      40 0.00088   13.4   1.2   12  116-127     1-12  (14)
 16 PF04833 COBRA:  COBRA-like pro  30.4      55  0.0012   23.0   2.5   34   93-126    43-82  (169)
 17 PHA02714 CD-30-like protein; P  23.5      43 0.00094   21.3   0.9   20  108-127    19-38  (110)
 18 PF14670 FXa_inhibition:  Coagu  20.9      57  0.0012   16.6   0.9   29   20-51      7-36  (36)
 19 PF00396 Granulin:  Granulin;    20.6      66  0.0014   17.2   1.2   17   36-52     26-42  (43)

No 1  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.48  E-value=1.4e-14  Score=82.31  Aligned_cols=48  Identities=27%  Similarity=0.573  Sum_probs=36.8

Q ss_pred             CCCCCCCcCCCccEEcCCCceeeeeCCCCCceeccCCCCCCCCCCCCC
Q psy6352          88 YPRFPVPGDRERLITCVDGHPRLISCGDGKLFDEASLTCLGPEDYTDK  135 (136)
Q Consensus        88 ~~~~~~~~~C~~y~~C~~g~~~~~~Cp~g~~F~~~~~~C~~~~~V~~c  135 (136)
                      .|+++++.+|++||+|.+|.++++.||.|++||+.+++|+++++|..|
T Consensus         6 ~~~~~~~~~C~~Y~~C~~g~~~~~~C~~g~~fd~~~~~C~~~~~~~~C   53 (53)
T PF01607_consen    6 DGFYPHPDDCRKYYQCVNGQAVEQRCPEGLYFDPSSQRCVPPSNVVQC   53 (53)
T ss_dssp             SEEE--SS-SSEEEEEETTEEEEEE-TTS-EE-TTTSSEE-TTT-TT-
T ss_pred             CeeEeCCCCCCEEEEeeCCcEECCCCcCCCEECcCcCEEcCCccCCCC
Confidence            457899999999999999999999999999999999999999997766


No 2  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.47  E-value=5.2e-14  Score=79.97  Aligned_cols=48  Identities=29%  Similarity=0.673  Sum_probs=36.4

Q ss_pred             CCC-CCccccCCCCCCcceEEcCCCceeEecCCCCCeeecCCCccCCCCC
Q psy6352           8 CEF-KYGIYAESSACSTNYIKCEEGYPYLQPCEPGLAYDDRVHKCNWPDE   56 (136)
Q Consensus         8 C~~-~~g~~~~p~~C~~~y~~C~~g~~~~~~Cp~gl~Fd~~~~~C~~~~~   56 (136)
                      |+. .+|+++++.+|+ +||+|.+|.+++++||.|++||+.+++|+++..
T Consensus         1 C~~~~~~~~~~~~~C~-~Y~~C~~g~~~~~~C~~g~~fd~~~~~C~~~~~   49 (53)
T PF01607_consen    1 CPGRGDGFYPHPDDCR-KYYQCVNGQAVEQRCPEGLYFDPSSQRCVPPSN   49 (53)
T ss_dssp             ----SSEEE--SS-SS-EEEEEETTEEEEEE-TTS-EE-TTTSSEE-TTT
T ss_pred             CCccCCeeEeCCCCCC-EEEEeeCCcEECCCCcCCCEECcCcCEEcCCcc
Confidence            453 578999999999 999999999999999999999999999999987


No 3  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.37  E-value=1.1e-12  Score=75.00  Aligned_cols=50  Identities=34%  Similarity=0.961  Sum_probs=46.0

Q ss_pred             CCCC-CCccccCCCCCCcceEEcCCCceeEecCCCCCeeecCCCccCCCCCC
Q psy6352           7 PCEF-KYGIYAESSACSTNYIKCEEGYPYLQPCEPGLAYDDRVHKCNWPDEL   57 (136)
Q Consensus         7 ~C~~-~~g~~~~p~~C~~~y~~C~~g~~~~~~Cp~gl~Fd~~~~~C~~~~~~   57 (136)
                      .|.. ..|+++++.+|+ +||+|.+|.+..+.||.|++||..++.|+++..+
T Consensus         2 ~C~~~~~g~~~~~~~C~-~y~~C~~~~~~~~~C~~g~~f~~~~~~C~~~~~~   52 (56)
T smart00494        2 ECPGRGDGLYPHPTDCS-KYYQCSNGRPIVGSCPAGLVFDPATQTCDWPDNV   52 (56)
T ss_pred             cCCCCCCccccCcccCC-eeEEcCCCcEEeccCcCCCeECCCCCCcCCcccC
Confidence            4665 478999999999 8999999999999999999999999999999876


No 4  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.29  E-value=4.6e-12  Score=72.38  Aligned_cols=46  Identities=33%  Similarity=0.621  Sum_probs=42.9

Q ss_pred             CCCCCCCcCCCccEEcCCCceeeeeCCCCCceeccCCCCCCCCCCC
Q psy6352          88 YPRFPVPGDRERLITCVDGHPRLISCGDGKLFDEASLTCLGPEDYT  133 (136)
Q Consensus        88 ~~~~~~~~~C~~y~~C~~g~~~~~~Cp~g~~F~~~~~~C~~~~~V~  133 (136)
                      .++++|+.+|++||+|.+|.++.+.||.|++||..++.|++++++.
T Consensus         8 ~g~~~~~~~C~~y~~C~~~~~~~~~C~~g~~f~~~~~~C~~~~~~~   53 (56)
T smart00494        8 DGLYPHPTDCSKYYQCSNGRPIVGSCPAGLVFDPATQTCDWPDNVG   53 (56)
T ss_pred             CccccCcccCCeeEEcCCCcEEeccCcCCCeECCCCCCcCCcccCC
Confidence            4689999999999999999999999999999999999999998753


No 5  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=92.21  E-value=0.16  Score=29.49  Aligned_cols=21  Identities=19%  Similarity=0.406  Sum_probs=19.4

Q ss_pred             CccEEcCCCceeeeeCCCCCc
Q psy6352          98 ERLITCVDGHPRLISCGDGKL  118 (136)
Q Consensus        98 ~~y~~C~~g~~~~~~Cp~g~~  118 (136)
                      .+|-+|.+|+.+.+.||+|++
T Consensus        35 G~faiC~~G~Wv~~~C~~Gt~   55 (61)
T PF03427_consen   35 GSFAICDHGTWVITPCPAGTT   55 (61)
T ss_pred             CCEEEcCCCcEEEeeCCCCCE
Confidence            489999999999999999986


No 6  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=91.90  E-value=0.21  Score=29.02  Aligned_cols=21  Identities=24%  Similarity=0.679  Sum_probs=19.4

Q ss_pred             cceEEcCCCceeEecCCCCCe
Q psy6352          23 TNYIKCEEGYPYLQPCEPGLA   43 (136)
Q Consensus        23 ~~y~~C~~g~~~~~~Cp~gl~   43 (136)
                      ++|-+|.+|.+....||+|++
T Consensus        35 G~faiC~~G~Wv~~~C~~Gt~   55 (61)
T PF03427_consen   35 GSFAICDHGTWVITPCPAGTT   55 (61)
T ss_pred             CCEEEcCCCcEEEeeCCCCCE
Confidence            379999999999999999986


No 7  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=68.37  E-value=5.6  Score=28.28  Aligned_cols=38  Identities=24%  Similarity=0.379  Sum_probs=31.9

Q ss_pred             CCCCCcCCCccEEcCCCceeeeeCCCCCceeccCCCCCCC
Q psy6352          90 RFPVPGDRERLITCVDGHPRLISCGDGKLFDEASLTCLGP  129 (136)
Q Consensus        90 ~~~~~~~C~~y~~C~~g~~~~~~Cp~g~~F~~~~~~C~~~  129 (136)
                      .-+|+.|=+||..=.+.-...++||.+..||..  +|+..
T Consensus       106 V~~~~~d~~kF~~~~DDGwv~~~CP~~~~FD~~--~Cvp~  143 (183)
T PF08475_consen  106 VRPHPNDPTKFIARGDDGWVDMDCPENERFDGN--KCVPI  143 (183)
T ss_pred             eecCCCCCceEEEEecCCcEEEeCCCccccccc--ceeec
Confidence            346788889999877766899999999999998  88754


No 8  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=67.65  E-value=8.6  Score=27.34  Aligned_cols=38  Identities=13%  Similarity=0.155  Sum_probs=32.2

Q ss_pred             cccCCCCCCcceEEcCCCceeEecCCCCCeeecCCCccCCC
Q psy6352          14 IYAESSACSTNYIKCEEGYPYLQPCEPGLAYDDRVHKCNWP   54 (136)
Q Consensus        14 ~~~~p~~C~~~y~~C~~g~~~~~~Cp~gl~Fd~~~~~C~~~   54 (136)
                      +-+++.+=+ +|..=.+-....++||.+..||..  +|+..
T Consensus       106 V~~~~~d~~-kF~~~~DDGwv~~~CP~~~~FD~~--~Cvp~  143 (183)
T PF08475_consen  106 VRPHPNDPT-KFIARGDDGWVDMDCPENERFDGN--KCVPI  143 (183)
T ss_pred             eecCCCCCc-eEEEEecCCcEEEeCCCccccccc--ceeec
Confidence            457888888 898877767999999999999998  99843


No 9  
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=64.26  E-value=4.7  Score=18.82  Aligned_cols=16  Identities=25%  Similarity=0.723  Sum_probs=13.4

Q ss_pred             cCCCCCeeecCCCccC
Q psy6352          37 PCEPGLAYDDRVHKCN   52 (136)
Q Consensus        37 ~Cp~gl~Fd~~~~~C~   52 (136)
                      +|+.|+..++..+.|.
T Consensus         5 ~C~~Gy~l~~d~~~C~   20 (24)
T PF12662_consen    5 SCPPGYQLSPDGRSCE   20 (24)
T ss_pred             eCCCCCcCCCCCCccc
Confidence            6899999888888776


No 10 
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=58.48  E-value=8.7  Score=20.64  Aligned_cols=18  Identities=22%  Similarity=0.503  Sum_probs=14.1

Q ss_pred             eeeeCCCCCceeccCCCC
Q psy6352         109 RLISCGDGKLFDEASLTC  126 (136)
Q Consensus       109 ~~~~Cp~g~~F~~~~~~C  126 (136)
                      =+..||.+++++.....|
T Consensus        31 Cv~~C~~~~~~~~~~~~C   48 (49)
T cd00064          31 CVSECPEGTYADTEGGVC   48 (49)
T ss_pred             ccccCCCCceecCcCCcC
Confidence            344899999999777766


No 11 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=53.71  E-value=2.4  Score=23.58  Aligned_cols=19  Identities=21%  Similarity=0.490  Sum_probs=14.8

Q ss_pred             eeCCCCCceeccCCCCCCCC
Q psy6352         111 ISCGDGKLFDEASLTCLGPE  130 (136)
Q Consensus       111 ~~Cp~g~~F~~~~~~C~~~~  130 (136)
                      =.|+.|++++.. +.|+.++
T Consensus        35 C~C~~G~v~~~~-~~CV~~~   53 (55)
T PF01826_consen   35 CFCPPGYVRNDN-GRCVPPS   53 (55)
T ss_dssp             EEETTTEEEETT-SEEEEGG
T ss_pred             CCCCCCeeEcCC-CCEEcHH
Confidence            358999999888 8887654


No 12 
>PF00220 Hormone_4:  Neurohypophysial hormones, N-terminal Domain;  InterPro: IPR022423 Oxytocin (or ocytocin) and vasopressin [] are small (nine amino acid residues), structurally and functionally related neurohypophysial peptide hormones. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland while vasopressin has a direct antidiuretic action on the kidney and also causes vasoconstriction of the peripheral vessels. Like the majority of active peptides, both hormones are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Peptides belonging to this family are also found in birds, fish, reptiles and amphibians (mesotocin, isotocin, valitocin, glumitocin, aspargtocin, vasotocin, seritocin, asvatocin, phasvatocin), in worms (annetocin), octopi (cephalotocin), locust (locupressin or neuropeptide F1/F2) and in molluscs (conopressins G and S) [].  The pattern developed to detect this category of peptides spans their entire sequence and includes four invariant amino acid residues.  .; GO: 0005185 neurohypophyseal hormone activity, 0005576 extracellular region
Probab=45.71  E-value=11  Score=13.39  Aligned_cols=6  Identities=33%  Similarity=0.866  Sum_probs=2.8

Q ss_pred             ecCCCC
Q psy6352          36 QPCEPG   41 (136)
Q Consensus        36 ~~Cp~g   41 (136)
                      +.||.|
T Consensus         4 ~nCP~G    9 (9)
T PF00220_consen    4 RNCPIG    9 (9)
T ss_pred             ccCCCC
Confidence            445543


No 13 
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=39.73  E-value=25  Score=17.88  Aligned_cols=21  Identities=24%  Similarity=0.472  Sum_probs=13.7

Q ss_pred             cCCCceeEecCCCCCeeecCC
Q psy6352          28 CEEGYPYLQPCEPGLAYDDRV   48 (136)
Q Consensus        28 C~~g~~~~~~Cp~gl~Fd~~~   48 (136)
                      |.......=.||+|++.|...
T Consensus        12 CDpn~~~~C~CPeGyIlde~~   32 (34)
T PF09064_consen   12 CDPNSPGQCFCPEGYILDEGS   32 (34)
T ss_pred             cCCCCCCceeCCCceEecCCc
Confidence            333333455799999998754


No 14 
>PF07645 EGF_CA:  Calcium-binding EGF domain;  InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins. Many of these proteins require calcium for their biological function and a calcium-binding site has been found at the N terminus of some EGF-like domains []. Calcium-binding may be crucial for numerous protein-protein interactions. For human coagulation factor IX it has been shown [] that the calcium-ligands form a pentagonal bipyramid. The first, third and fourth conserved negatively charged or polar residues are side chain ligands. The latter is possibly hydroxylated (see aspartic acid and asparagine hydroxylation site) []. A conserved aromatic residue, as well as the second conserved negative residue, are thought to be involved in stabilising the calcium-binding site. As in non-calcium binding EGF-like domains, there are six conserved cysteines and the structure of both types is very similar as calcium-binding induces only strictly local structural changes [].  +------------------+ +---------+ | | | | nxnnC-x(3,14)-C-x(3,7)-CxxbxxxxaxC-x(1,6)-C-x(8,13)-Cx | | +------------------+ 'n': negatively charged or polar residue [DEQN] 'b': possibly beta-hydroxylated residue [DN] 'a': aromatic amino acid 'C': cysteine, involved in disulphide bond 'x': any amino acid. ; GO: 0005509 calcium ion binding; PDB: 2VJ3_A 1TOZ_A 1LMJ_A 1UZQ_A 1UZK_A 1UZJ_B 1UZP_A 1EMO_A 1EMN_A 2RR0_A ....
Probab=38.77  E-value=13  Score=19.42  Aligned_cols=32  Identities=25%  Similarity=0.595  Sum_probs=22.5

Q ss_pred             CCCCcceEEcCCCc-eeEecCCCCCeeecCCCcc
Q psy6352          19 SACSTNYIKCEEGY-PYLQPCEPGLAYDDRVHKC   51 (136)
Q Consensus        19 ~~C~~~y~~C~~g~-~~~~~Cp~gl~Fd~~~~~C   51 (136)
                      ..|. ..-.|+|.. .+.=.|+.|+..+.....|
T Consensus        10 ~~C~-~~~~C~N~~Gsy~C~C~~Gy~~~~~~~~C   42 (42)
T PF07645_consen   10 HNCP-ENGTCVNTEGSYSCSCPPGYELNDDGTTC   42 (42)
T ss_dssp             SSSS-TTSEEEEETTEEEEEESTTEEECTTSSEE
T ss_pred             CcCC-CCCEEEcCCCCEEeeCCCCcEECCCCCcC
Confidence            3576 677788755 3445799999987776655


No 15 
>PF03128 CXCXC:  CXCXC repeat;  InterPro: IPR004153 This repeat contains the conserved pattern CXCXC where X can be any amino acid. The repeat is found in up to five copies in Vascular endothelial growth factor C []. In the salivary glands of the dipteran Chironomus tentans, a specific messenger ribonucleoprotein (mRNP) particle, the Balbiani ring (BR) granule, can be visualized during its assembly on the gene and during its nucleocytoplasmic transport. This repeat is found over 70 copies in the balbiani ring protein 3 (Q03376 from SWISSPROT). It is also found in some silk proteins [].
Probab=30.42  E-value=40  Score=13.40  Aligned_cols=12  Identities=8%  Similarity=0.517  Sum_probs=8.1

Q ss_pred             CCceeccCCCCC
Q psy6352         116 GKLFDEASLTCL  127 (136)
Q Consensus       116 g~~F~~~~~~C~  127 (136)
                      +++||..+=.|.
T Consensus         1 ~q~wn~~tC~C~   12 (14)
T PF03128_consen    1 PQVWNDDTCQCE   12 (14)
T ss_pred             CceecCCCcCcc
Confidence            457777776665


No 16 
>PF04833 COBRA:  COBRA-like protein;  InterPro: IPR006918 In Arabidopsis thaliana (Mouse-ear cress) members of the family are all extracellular glycosyl-phosphatidyl inositol-anchored proteins (GPI-linked) []. The type example of the family is COBRA (Q94KT8 from SWISSPROT) and the family is generally annotated as COBRA-like (COBL). COBRA is involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. It may act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface. Some members of this family are annotated as phytochelatin synthase, but these annotations are incorrect [].
Probab=30.38  E-value=55  Score=23.03  Aligned_cols=34  Identities=18%  Similarity=0.495  Sum_probs=27.8

Q ss_pred             CCcCCCccE------EcCCCceeeeeCCCCCceeccCCCC
Q psy6352          93 VPGDRERLI------TCVDGHPRLISCGDGKLFDEASLTC  126 (136)
Q Consensus        93 ~~~~C~~y~------~C~~g~~~~~~Cp~g~~F~~~~~~C  126 (136)
                      +.+||++|+      .|=.-.+.+.+=|+|.-+|.....|
T Consensus        43 dqgdCs~~~~~~~~ph~C~k~P~IvDLpp~~~~n~qi~nC   82 (169)
T PF04833_consen   43 DQGDCSKFYKDGDFPHCCKKRPTIVDLPPGTPYNQQIGNC   82 (169)
T ss_pred             cCCcccccccCCCCCcccCCCCEEEeCCCCCCCccccccc
Confidence            567888888      6666678888889999999888777


No 17 
>PHA02714 CD-30-like protein; Provisional
Probab=23.50  E-value=43  Score=21.34  Aligned_cols=20  Identities=10%  Similarity=0.165  Sum_probs=16.8

Q ss_pred             eeeeeCCCCCceeccCCCCC
Q psy6352         108 PRLISCGDGKLFDEASLTCL  127 (136)
Q Consensus       108 ~~~~~Cp~g~~F~~~~~~C~  127 (136)
                      ....+|+.++++|++.++|.
T Consensus        19 sf~kqC~~dYY~Dpe~g~Ct   38 (110)
T PHA02714         19 SFGKTCPKDYYLEPEDGLCT   38 (110)
T ss_pred             hhhccCCCcccccCCCCcee
Confidence            45678999999999988884


No 18 
>PF14670 FXa_inhibition:  Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A ....
Probab=20.91  E-value=57  Score=16.60  Aligned_cols=29  Identities=28%  Similarity=0.699  Sum_probs=17.3

Q ss_pred             CCCcceEEcCCCc-eeEecCCCCCeeecCCCcc
Q psy6352          20 ACSTNYIKCEEGY-PYLQPCEPGLAYDDRVHKC   51 (136)
Q Consensus        20 ~C~~~y~~C~~g~-~~~~~Cp~gl~Fd~~~~~C   51 (136)
                      .|+ .+  |++.. .+.=+||.|+.-++..+.|
T Consensus         7 gC~-h~--C~~~~g~~~C~C~~Gy~L~~D~~tC   36 (36)
T PF14670_consen    7 GCS-HI--CVNTPGSYRCSCPPGYKLAEDGRTC   36 (36)
T ss_dssp             GSS-SE--EEEETTSEEEE-STTEEE-TTSSSE
T ss_pred             CcC-CC--CccCCCceEeECCCCCEECcCCCCC
Confidence            365 33  66432 3556899999888876665


No 19 
>PF00396 Granulin:  Granulin;  InterPro: IPR000118 Metazoan granulins [] are a family of cysteine-rich peptides of about 6 Kd which may have multiple biological activity. A precursor protein (known as acrogranin) potentially encodes seven different forms of granulin (grnA to grnG) which are probably released by post-translational proteolytic processing. Granulins are evolutionary related to a PMP-D1, a peptide extracted from the pars intercerebralis of migratory locusts []. A schematic representation of the structure of a granulin is shown below:  xxxCxxxxxCxxxxxCCxxxxxxxxCCxxxxxxCCxxxxxCCxxxxxCxxxxxxCx 'C': conserved cysteine probably involved in a disulphide bond.   In plants a granulin domain is often associated with the C terminus of cysteine proteases belong to the MEROPS peptidase family C1, subfamily C1A (papain).; PDB: 1I8Y_A 1QGM_A 1I8X_A 2JYT_A 2JYU_A 1FWO_A 2JYV_A 2JYE_A 1G26_A.
Probab=20.56  E-value=66  Score=17.17  Aligned_cols=17  Identities=24%  Similarity=0.442  Sum_probs=13.2

Q ss_pred             ecCCCCCeeecCCCccC
Q psy6352          36 QPCEPGLAYDDRVHKCN   52 (136)
Q Consensus        36 ~~Cp~gl~Fd~~~~~C~   52 (136)
                      .=||.|+.=|.+.+.|.
T Consensus        26 hCCP~G~~C~~~~~~C~   42 (43)
T PF00396_consen   26 HCCPHGYTCDPDGGSCI   42 (43)
T ss_dssp             TSSSTTSEEECTTTEEE
T ss_pred             ccCCCcCEECCCCCEEc
Confidence            45788988888877774


Done!