RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy6355
         (83 letters)



>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor.  This
           model describes the ELAV/HuD subfamily of splicing
           factors found in metazoa. HuD stands for the human
           paraneoplastic encephalomyelitis antigen D of which
           there are 4 variants in human. ELAV stnds for the
           Drosophila Embryonic lethal abnormal visual protein.
           ELAV-like splicing factors are also known in human as
           HuB (ELAV-like protein 2), HuC (ELAV-like protein 3,
           Paraneoplastic cerebellar degeneration-associated
           antigen) and HuR (ELAV-like protein 1). These genes are
           most closely related to the sex-lethal subfamily of
           splicing factors found in Dipteran insects (TIGR01659).
           These proteins contain 3 RNA-recognition motifs (rrm:
           pfam00076).
          Length = 352

 Score = 91.9 bits (228), Expect = 6e-24
 Identities = 42/85 (49%), Positives = 52/85 (61%), Gaps = 9/85 (10%)

Query: 5   TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANSPSSSNK--VIAPLAAY 62
           T   + +GFIRFD+R EA+RAI+ LNGT P G  EPITVKFAN+PSSSN   +++ L A 
Sbjct: 127 TGLSKGVGFIRFDKRDEADRAIKTLNGTTPSGCTEPITVKFANNPSSSNSKGLLSQLEAV 186

Query: 63  LTPQ-------AAAARRFGGPIHHA 80
             PQ               GP+HHA
Sbjct: 187 QNPQTTRVPLSTILTAAGIGPMHHA 211



 Score = 26.4 bits (58), Expect = 1.8
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANSPSSSNK 54
          GF+ + +  +AE+A+  LNG   +  N+ I V +A   S S K
Sbjct: 48 GFVNYVRPEDAEKAVNSLNGL--RLQNKTIKVSYARPSSDSIK 88



 Score = 24.5 bits (53), Expect = 7.0
 Identities = 11/28 (39%), Positives = 14/28 (50%)

Query: 5   TDFCRYLGFIRFDQRIEAERAIQELNGT 32
           T+ C+  GF+      EA  AI  LNG 
Sbjct: 307 TNQCKGYGFVSMTNYDEAAMAILSLNGY 334


>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins
          family.  This subfamily corresponds to the RRM2 of Hu
          proteins family which represents a group of RNA-binding
          proteins involved in diverse biological processes.
          Since the Hu proteins share high homology with the
          Drosophila embryonic lethal abnormal vision (ELAV)
          protein, the Hu family is sometimes referred to as the
          ELAV family. Drosophila ELAV is exclusively expressed
          in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress.
          Moreover, HuR has an anti-apoptotic function during
          early cell stress response. It binds to mRNAs and
          enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          HuR also has pro-apoptotic function by promoting
          apoptosis when cell death is unavoidable. Furthermore,
          HuR may be important in muscle differentiation,
          adipogenesis, suppression of inflammatory response and
          modulation of gene expression in response to chronic
          ethanol exposure and amino acid starvation. Hu proteins
          perform their cytoplasmic and nuclear molecular
          functions by coordinately regulating functionally
          related mRNAs. In the cytoplasm, Hu proteins recognize
          and bind to AU-rich RNA elements (AREs) in the 3'
          untranslated regions (UTRs) of certain target mRNAs,
          such as GAP-43, vascular epithelial growth factor
          (VEGF), the glucose transporter GLUT1, eotaxin and
          c-fos, and stabilize those ARE-containing mRNAs. They
          also bind and regulate the translation of some target
          mRNAs, such as neurofilament M, GLUT1, and p27. In the
          nucleus, Hu proteins function as regulators of
          polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 79

 Score = 74.6 bits (184), Expect = 1e-19
 Identities = 30/38 (78%), Positives = 34/38 (89%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          R +GFIRFD+RIEAERAI+ LNGTIP G+ EPITVKFA
Sbjct: 42 RGVGFIRFDKRIEAERAIKALNGTIPPGATEPITVKFA 79


>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate
          Hu-antigen B (HuB).  This subgroup corresponds to the
          RRM2 of HuB, also termed ELAV-like protein 2 (ELAV-2),
          or ELAV-like neuronal protein 1, or nervous
          system-specific RNA-binding protein Hel-N1 (Hel-N1),
          one of the neuronal members of the Hu family. The
          neuronal Hu proteins play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. It is up-regulated during neuronal
          differentiation of embryonic carcinoma P19 cells. Like
          other Hu proteins, HuB contains three RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 90

 Score = 63.3 bits (153), Expect = 6e-15
 Identities = 31/46 (67%), Positives = 36/46 (78%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANSPS 50
          T   R +GFIRFD+RIEAE AI+ LNG  P G+ EPITVKFAN+PS
Sbjct: 43 TGVSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPS 88


>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate
          Hu-antigen C (HuC).  This subgroup corresponds to the
          RRM2 of HuC, also termed ELAV-like protein 3 (ELAV-3),
          or paraneoplastic cerebellar degeneration-associated
          antigen, or paraneoplastic limbic encephalitis antigen
          21 (PLE21), one of the neuronal members of the Hu
          family. The neuronal Hu proteins play important roles
          in neuronal differentiation, plasticity and memory.
          Like other Hu proteins, HuC contains three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an AU-rich
          RNA element (ARE). The AU-rich element binding of HuC
          can be inhibited by flavonoids. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 81

 Score = 60.0 bits (145), Expect = 9e-14
 Identities = 29/43 (67%), Positives = 33/43 (76%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFAN 47
          T   R +GFIRFD+RIEAE AI+ LNG  P G+ EPITVKFAN
Sbjct: 39 TGISRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFAN 81


>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins
          family, Drosophila sex-lethal (SXL), and similar
          proteins.  This subfamily corresponds to the RRM2 of Hu
          proteins and SXL. The Hu proteins family represents a
          group of RNA-binding proteins involved in diverse
          biological processes. Since the Hu proteins share high
          homology with the Drosophila embryonic lethal abnormal
          vision (ELAV) protein, the Hu family is sometimes
          referred to as the ELAV family. Drosophila ELAV is
          exclusively expressed in neurons and is required for
          the correct differentiation and survival of neurons in
          flies. The neuronal members of the Hu family include
          Hu-antigen B (HuB or ELAV-2 or Hel-N1), Hu-antigen C
          (HuC or ELAV-3 or PLE21), and Hu-antigen D (HuD or
          ELAV-4), which play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. Hu-antigen R (HuR or ELAV-1 or
          HuA) is the ubiquitously expressed Hu family member. It
          has a variety of biological functions mostly related to
          the regulation of cellular response to DNA damage and
          other types of stress. Hu proteins perform their
          cytoplasmic and nuclear molecular functions by
          coordinately regulating functionally related mRNAs. In
          the cytoplasm, Hu proteins recognize and bind to
          AU-rich RNA elements (AREs) in the 3' untranslated
          regions (UTRs) of certain target mRNAs, such as GAP-43,
          vascular epithelial growth factor (VEGF), the glucose
          transporter GLUT1, eotaxin and c-fos, and stabilize
          those ARE-containing mRNAs. They also bind and regulate
          the translation of some target mRNAs, such as
          neurofilament M, GLUT1, and p27. In the nucleus, Hu
          proteins function as regulators of polyadenylation and
          alternative splicing. Each Hu protein contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. Also included
          in this subfamily is the sex-lethal protein (SXL) from
          Drosophila melanogaster. SXL governs sexual
          differentiation and X chromosome dosage compensation in
          flies. It induces female-specific alternative splicing
          of the transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RRMs that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 79

 Score = 58.4 bits (141), Expect = 4e-13
 Identities = 27/38 (71%), Positives = 33/38 (86%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          R +GFIRFD+RIEAE AI+ LNG  P+G++EPITVKFA
Sbjct: 42 RGVGFIRFDKRIEAEEAIKGLNGQKPEGASEPITVKFA 79


>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate
          Hu-antigen D (HuD).  This subgroup corresponds to the
          RRM2 of HuD, also termed ELAV-like protein 4 (ELAV-4),
          or paraneoplastic encephalomyelitis antigen HuD, one of
          the neuronal members of the Hu family. The neuronal Hu
          proteins play important roles in neuronal
          differentiation, plasticity and memory. HuD has been
          implicated in various aspects of neuronal function,
          such as the commitment and differentiation of neuronal
          precursors as well as synaptic remodeling in mature
          neurons. HuD also functions as an important regulator
          of mRNA expression in neurons by interacting with
          AU-rich RNA element (ARE) and stabilizing multiple
          transcripts. Moreover, HuD regulates the nuclear
          processing/stability of N-myc pre-mRNA in neuroblastoma
          cells and also regulates the neurite elongation and
          morphological differentiation. HuD specifically binds
          poly(A) RNA. Like other Hu proteins, HuD contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. .
          Length = 81

 Score = 57.4 bits (138), Expect = 8e-13
 Identities = 28/42 (66%), Positives = 32/42 (76%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          T   R +GFIRFD+RIEAE AI+ LNG  P G+ EPITVKFA
Sbjct: 40 TGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFA 81


>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate
          Hu-antigen R (HuR).  This subgroup corresponds to the
          RRM2 of HuR, also termed ELAV-like protein 1 (ELAV-1),
          the ubiquitously expressed Hu family member. It has a
          variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. HuR has an anti-apoptotic function
          during early cell stress response. It binds to mRNAs
          and enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          HuR also has pro-apoptotic function by promoting
          apoptosis when cell death is unavoidable. Furthermore,
          HuR may be important in muscle differentiation,
          adipogenesis, suppression of inflammatory response and
          modulation of gene expression in response to chronic
          ethanol exposure and amino acid starvation. Like other
          Hu proteins, HuR contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 84

 Score = 56.2 bits (135), Expect = 3e-12
 Identities = 27/46 (58%), Positives = 32/46 (69%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANSPS 50
          T   R + FIRFD+R EAE AI   NG  P GS+EPITVKFA +P+
Sbjct: 38 TGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPN 83


>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila
          sex-lethal (SXL) and similar proteins.  This subfamily
          corresponds to the RRM2 of the sex-lethal protein (SXL)
          which governs sexual differentiation and X chromosome
          dosage compensation in Drosophila melanogaster. It
          induces female-specific alternative splicing of the
          transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 79

 Score = 48.0 bits (114), Expect = 4e-09
 Identities = 20/38 (52%), Positives = 29/38 (76%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          R + F+R+D+R EA+ AI  LNGTIP GS  P++V++A
Sbjct: 42 RGVAFVRYDKREEAQAAISSLNGTIPPGSTMPLSVRYA 79


>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor.  This
           model describes the sex-lethal family of splicing
           factors found in Dipteran insects. The sex-lethal
           phenotype, however, may be limited to the Melanogasters
           and closely related species. In Drosophila the protein
           acts as an inhibitor of splicing. This subfamily is most
           closely related to the ELAV/HUD subfamily of splicing
           factors (TIGR01661).
          Length = 346

 Score = 43.9 bits (103), Expect = 1e-06
 Identities = 18/38 (47%), Positives = 28/38 (73%)

Query: 9   RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
           R + F+RF++R EA+ AI  LN  IP+G ++P+TV+ A
Sbjct: 235 RGVAFVRFNKREEAQEAISALNNVIPEGGSQPLTVRLA 272



 Score = 25.0 bits (54), Expect = 4.8
 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 12  GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
            F+ F    +++RAI+ LNG   +  N+ + V +A
Sbjct: 152 AFVDFGSEADSQRAIKNLNGITVR--NKRLKVSYA 184


>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering
          time control protein FCA and similar proteins.  This
          subgroup corresponds to the RRM2 of FCA, a gene
          controlling flowering time in Arabidopsis, which
          encodes a flowering time control protein that functions
          in the posttranscriptional regulation of transcripts
          involved in the flowering process. The flowering time
          control protein FCA contains two RNA recognition motifs
          (RRMs), also known as RBDs (RNA binding domains) or RNP
          (ribonucleoprotein domains), and a WW protein
          interaction domain. .
          Length = 80

 Score = 39.4 bits (92), Expect = 1e-05
 Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 8  CRYLGFIRFDQRIEAERAIQELNGT-IPKGSNEPITVKFAN 47
           R   F+++  +  A+ AI+ LNG    +G ++P+ V+FA+
Sbjct: 39 SRGCAFVKYSSKEMAQAAIKALNGVYTMRGCDQPLIVRFAD 79


>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene
          single-strand binding proteins (MSSP) family.  This
          subfamily corresponds to the RRM2 of c-myc gene
          single-strand binding proteins (MSSP) family, including
          single-stranded DNA-binding protein MSSP-1 (also termed
          RBMS1 or SCR2) and MSSP-2 (also termed RBMS2 or SCR3).
          All MSSP family members contain two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), both of which are
          responsible for the specific DNA binding activity.
          Both, MSSP-1 and -2, have been identified as protein
          factors binding to a putative DNA replication
          origin/transcriptional enhancer sequence present
          upstream from the human c-myc gene in both single- and
          double-stranded forms. Thus they have been implied in
          regulating DNA replication, transcription, apoptosis
          induction, and cell-cycle movement, via the interaction
          with C-MYC, the product of protooncogene c-myc.
          Moreover, they family includes a new member termed
          RNA-binding motif, single-stranded-interacting protein
          3 (RBMS3), which is not a transcriptional regulator.
          RBMS3 binds with high affinity to A/U-rich stretches of
          RNA, and to A/T-rich DNA sequences, and functions as a
          regulator of cytoplasmic activity. In addition, a
          putative meiosis-specific RNA-binding protein termed
          sporulation-specific protein 5 (SPO5, or meiotic
          RNA-binding protein 1, or meiotically up-regulated gene
          12 protein), encoded by Schizosaccharomyces pombe
          Spo5/Mug12 gene, is also included in this family. SPO5
          is a novel meiosis I regulator that may function in the
          vicinity of the Mei2 dot. .
          Length = 79

 Score = 38.5 bits (90), Expect = 2e-05
 Identities = 17/38 (44%), Positives = 22/38 (57%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          R +GF R + R + E  I + NG   KG  EP+ VKFA
Sbjct: 41 RGVGFARMESREKCEDIISKFNGKYLKGEGEPLLVKFA 78


>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the
          p54nrb/PSF/PSP1 family.  This subfamily corresponds to
          the RRM1 of the p54nrb/PSF/PSP1 family, including 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb or
          NonO or NMT55), polypyrimidine tract-binding protein
          (PTB)-associated-splicing factor (PSF or POMp100),
          paraspeckle protein 1 (PSP1 or PSPC1), which are
          ubiquitously expressed and are conserved in
          vertebrates. p54nrb is a multi-functional protein
          involved in numerous nuclear processes including
          transcriptional regulation, splicing, DNA unwinding,
          nuclear retention of hyperedited double-stranded RNA,
          viral RNA processing, control of cell proliferation,
          and circadian rhythm maintenance. PSF is also a
          multi-functional protein that binds RNA,
          single-stranded DNA (ssDNA), double-stranded DNA
          (dsDNA) and many factors, and mediates diverse
          activities in the cell. PSP1 is a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. The cellular function
          of PSP1 remains unknown currently. This subfamily also
          includes some p54nrb/PSF/PSP1 homologs from
          invertebrate species, such as the Drosophila
          melanogaster gene no-ontransient A (nonA) encoding
          puff-specific protein Bj6 (also termed NONA) and
          Chironomus tentans hrp65 gene encoding protein Hrp65.
          D. melanogaster NONA is involved in eye development and
          behavior, and may play a role in circadian rhythm
          maintenance, similar to vertebrate p54nrb. C. tentans
          Hrp65 is a component of nuclear fibers associated with
          ribonucleoprotein particles in transit from the gene to
          the nuclear pore. All family members contain a DBHS
          domain (for Drosophila behavior, human splicing), which
          comprises two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a charged
          protein-protein interaction module. PSF has an
          additional large N-terminal domain that differentiates
          it from other family members. .
          Length = 71

 Score = 37.3 bits (87), Expect = 5e-05
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 9/44 (20%)

Query: 2  KGFTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKF 45
          KGF       GFIR D R  AE+A  EL+G + KG    + V+F
Sbjct: 37 KGF-------GFIRLDTRTNAEKAKAELDGIMRKG--RQLRVRF 71


>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast
          negative growth regulatory protein NGR1 (RBP1), yeast
          protein NAM8 and similar proteins.  This subfamily
          corresponds to the RRM3 of NGR1 and NAM8. NGR1, also
          termed RNA-binding protein RBP1, is a putative
          glucose-repressible protein that binds both RNA and
          single-stranded DNA (ssDNA) in yeast. It may function
          in regulating cell growth in early log phase, possibly
          through its participation in RNA metabolism. NGR1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a glutamine-rich stretch that may
          be involved in transcriptional activity. In addition,
          NGR1 has an asparagine-rich region near the carboxyl
          terminus which also harbors a methionine-rich region.
          The family also includes protein NAM8, which is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. Like
          NGR1, NAM8 contains two RRMs. .
          Length = 72

 Score = 35.4 bits (82), Expect = 3e-04
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGS 37
          GF++F  R  AE AIQ+L GTI  GS
Sbjct: 40 GFVQFVHRAAAEAAIQQLQGTIIGGS 65


>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
          domain).  The RRM motif is probably diagnostic of an
          RNA binding protein. RRMs are found in a variety of RNA
          binding proteins, including various hnRNP proteins,
          proteins implicated in regulation of alternative
          splicing, and protein components of snRNPs. The motif
          also appears in a few single stranded DNA binding
          proteins. The RRM structure consists of four strands
          and two helices arranged in an alpha/beta sandwich,
          with a third helix present during RNA binding in some
          cases The C-terminal beta strand (4th strand) and final
          helix are hard to align and have been omitted in the
          SEED alignment The LA proteins have an N terminal rrm
          which is included in the seed. There is a second region
          towards the C terminus that has some features
          characteristic of a rrm but does not appear to have the
          important structural core of a rrm. The LA proteins are
          one of the main autoantigens in Systemic lupus
          erythematosus (SLE), an autoimmune disease.
          Length = 70

 Score = 34.5 bits (80), Expect = 5e-04
 Identities = 10/38 (26%), Positives = 19/38 (50%)

Query: 1  MKGFTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSN 38
          ++  T   +   F+ F+   +AE+A++ LNG    G  
Sbjct: 31 VRDETGRSKGFAFVEFEDEEDAEKALEALNGKELGGRE 68


>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in
          CELF/Bruno-like family of RNA binding proteins and
          plant flowering time control protein FCA.  This
          subfamily corresponds to the RRM1 and RRM2 domains of
          the CUGBP1 and ETR-3-like factors (CELF) as well as
          plant flowering time control protein FCA. CELF, also
          termed BRUNOL (Bruno-like) proteins, is a family of
          structurally related RNA-binding proteins involved in
          regulation of pre-mRNA splicing in the nucleus, and
          control of mRNA translation and deadenylation in the
          cytoplasm. The family contains six members: CELF-1
          (also known as BRUNOL-2, CUG-BP1, NAPOR, EDEN-BP),
          CELF-2 (also known as BRUNOL-3, ETR-3, CUG-BP2,
          NAPOR-2), CELF-3 (also known as BRUNOL-1, TNRC4, ETR-1,
          CAGH4, ER DA4), CELF-4 (BRUNOL-4), CELF-5 (BRUNOL-5)
          and CELF-6 (BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both, sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts.
          This subfamily also includes plant flowering time
          control protein FCA that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RRMs, and a
          WW protein interaction domain.  .
          Length = 77

 Score = 34.1 bits (79), Expect = 8e-04
 Identities = 13/34 (38%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 12 GFIRFDQRIEAERAIQELNGTIP-KGSNEPITVK 44
           F++F  R EA++AI+ L+G +   G++ P+ VK
Sbjct: 44 AFVKFSSREEAQKAIEALHGKVTMPGASRPLQVK 77


>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily.  RRM,
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), is a highly abundant domain
          in eukaryotes found in proteins involved in
          post-transcriptional gene expression processes
          including mRNA and rRNA processing, RNA export, and RNA
          stability. This domain is 90 amino acids in length and
          consists of a four-stranded beta-sheet packed against
          two alpha-helices. RRM usually interacts with ssRNA,
          but is also known to interact with ssDNA as well as
          proteins. RRM binds a variable number of nucleotides,
          ranging from two to eight. The active site includes
          three aromatic side-chains located within the conserved
          RNP1 and RNP2 motifs of the domain. The RRM domain is
          found in a variety heterogeneous nuclear
          ribonucleoproteins (hnRNPs), proteins implicated in
          regulation of alternative splicing, and protein
          components of small nuclear ribonucleoproteins
          (snRNPs).
          Length = 72

 Score = 33.4 bits (77), Expect = 0.001
 Identities = 10/44 (22%), Positives = 20/44 (45%), Gaps = 2/44 (4%)

Query: 1  MKGFTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVK 44
          ++      +   F+ F+   +AE+A++ LNG    G    + V 
Sbjct: 31 VRDKDGKSKGFAFVEFESPEDAEKALEALNGKELDGR--KLKVS 72


>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 76

 Score = 32.2 bits (74), Expect = 0.005
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 9/46 (19%)

Query: 1  MKGFTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
           KGF        F++F  + +AE+AI+ +NG   K    P+ V +A
Sbjct: 39 KKGF-------AFVQFTSKADAEKAIKGVNGK--KIKGRPVAVDWA 75


>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate
          paraspeckle protein 1 (PSP1).  This subgroup
          corresponds to the RRM1 of PSPC1, also termed
          paraspeckle component 1 (PSPC1), a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. It is ubiquitously
          expressed and highly conserved in vertebrates. Its
          cellular function remains unknown currently, however,
          PSPC1 forms a novel heterodimer with the nuclear
          protein p54nrb, also known as non-POU domain-containing
          octamer-binding protein (NonO), which localizes to
          paraspeckles in an RNA-dependent manner. PSPC1 contains
          two conserved RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 32.2 bits (73), Expect = 0.005
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 4  FTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKF 45
          F +  R  GFIR + R  AE A  EL+GTI K  N P+ ++F
Sbjct: 32 FINRDRGFGFIRLESRTLAEIAKAELDGTILK--NRPLRIRF 71


>gnl|CDD|214636 smart00360, RRM, RNA recognition motif. 
          Length = 73

 Score = 31.8 bits (73), Expect = 0.006
 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITV 43
          T   +   F+ F+   +AE+A++ LNG    G   P+ V
Sbjct: 37 TGKSKGFAFVEFESEEDAEKALEALNGKELDGR--PLKV 73


>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins (p40-TIA-1 and
          TIAR), and yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1.  This subfamily corresponds
          to the RRM3 of TIA-1, TIAR, and PUB1. Nucleolysin TIA-1
          isoform p40 (p40-TIA-1 or TIA-1) and nucleolysin
          TIA-1-related protein (TIAR) are granule-associated RNA
          binding proteins involved in inducing apoptosis in
          cytotoxic lymphocyte (CTL) target cells. They share
          high sequence similarity and are expressed in a wide
          variety of cell types. TIA-1 can be phosphorylated by a
          serine/threonine kinase that is activated during
          Fas-mediated apoptosis.TIAR is mainly localized in the
          nucleus of hematopoietic and nonhematopoietic cells. It
          is translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both TIA-1
          and TIAR bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains. This subfamily also
          includes a yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1, termed ARS consensus-binding
          protein ACBP-60, or poly uridylate-binding protein, or
          poly(U)-binding protein, which has been identified as
          both a heterogeneous nuclear RNA-binding protein
          (hnRNP) and a cytoplasmic mRNA-binding protein (mRNP).
          It may be stably bound to a translationally inactive
          subpopulation of mRNAs within the cytoplasm. PUB1 is
          distributed in both, the nucleus and the cytoplasm, and
          binds to poly(A)+ RNA (mRNA or pre-mRNA). Although it
          is one of the major cellular proteins cross-linked by
          UV light to polyadenylated RNAs in vivo, PUB1 is
          nonessential for cell growth in yeast. PUB1 also binds
          to T-rich single stranded DNA (ssDNA); however, there
          is no strong evidence implicating PUB1 in the mechanism
          of DNA replication. PUB1 contains three RRMs, and a GAR
          motif (glycine and arginine rich stretch) that is
          located between RRM2 and RRM3. .
          Length = 73

 Score = 31.4 bits (72), Expect = 0.009
 Identities = 13/38 (34%), Positives = 16/38 (42%), Gaps = 7/38 (18%)

Query: 1  MKGFTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSN 38
           KG+        F+RFD    A  AI  +NGT   G  
Sbjct: 35 DKGY-------AFVRFDTHEAAATAIVAVNGTSINGQT 65


>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein R (hnRNP R) and
          similar proteins.  This subfamily corresponds to the
          RRM3 in hnRNP R, hnRNP Q, and APOBEC-1 complementation
          factor (ACF). hnRNP R is a ubiquitously expressed
          nuclear RNA-binding protein that specifically bind
          mRNAs with a preference for poly(U) stretches and has
          been implicated in mRNA processing and mRNA transport,
          and also acts as a regulator to modify binding to
          ribosomes and RNA translation. hnRNP Q is also a
          ubiquitously expressed nuclear RNA-binding protein. It
          has been identified as a component of the spliceosome
          complex, as well as a component of the apobec-1
          editosome, and has been implicated in the regulation of
          specific mRNA transport. ACF is an RNA-binding subunit
          of a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone and play a
          key role in cell growth and differentiation. This
          family also includes two functionally unknown
          RNA-binding proteins, RBM46 and RBM47. All members
          contain three conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains).
          Length = 72

 Score = 31.4 bits (72), Expect = 0.009
 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
           F+ F++R +A +A++E+NG   +GS  PI V  A
Sbjct: 38 AFVHFEERDDAVKAMEEMNGKELEGS--PIEVSLA 70


>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic
          RNA-binding protein 18 and similar proteins.  This
          subfamily corresponds to the RRM of RBM18, a putative
          RNA-binding protein containing a well-conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). The
          biological role of RBM18 remains unclear. .
          Length = 80

 Score = 31.1 bits (71), Expect = 0.014
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFAN 47
           F+ F+ + EAE+A++ LNG    G    + V++A+
Sbjct: 47 CFVTFETKEEAEKALKSLNGKTALGKK--LVVRWAH 80


>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subgroup corresponds to the
          RRM2 of CELF-3, CELF-4, CELF-5, and CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein. The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          being highly expressed throughout the brain and in
          glandular tissues, moderately expressed in heart,
          skeletal muscle, and liver, is also known as bruno-like
          protein 4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor
          4. Like CELF-3, CELF-4 also contain three highly
          conserved RRMs. The splicing activation or repression
          activity of CELF-4 on some specific substrates is
          mediated by its RRM1/RRM2. On the other hand, both RRM1
          and RRM2 of CELF-4 can activate cardiac troponin T
          (cTNT) exon 5 inclusion. CELF-5, expressed in brain, is
          also known as bruno-like protein 5 (BRUNOL-5), or
          CUG-BP- and ETR-3-like factor 5. Although its
          biological role remains unclear, CELF-5 shares same
          domain architecture with CELF-3. CELF-6, being strongly
          expressed in kidney, brain, and testis, is also known
          as bruno-like protein 6 (BRUNOL-6), or CUG-BP- and
          ETR-3-like factor 6. It activates exon inclusion of a
          cardiac troponin T minigene in transient transfection
          assays in a muscle-specific splicing enhancer
          (MSE)-dependent manner and can activate inclusion via
          multiple copies of a single element, MSE2. CELF-6 also
          promotes skipping of exon 11 of insulin receptor, a
          known target of CELF activity that is expressed in
          kidney. In addition to three highly conserved RRMs,
          CELF-6 also possesses numerous potential
          phosphorylation sites, a potential nuclear localization
          signal (NLS) at the C terminus, and an alanine-rich
          region within the divergent linker region. .
          Length = 81

 Score = 30.9 bits (70), Expect = 0.015
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 3/37 (8%)

Query: 13 FIRFDQRIEAERAIQELNG--TIPKGSNEPITVKFAN 47
          F++F    EA+ AI  L+G  T+P G++  + VKFA+
Sbjct: 46 FVKFSSHAEAQAAINALHGSQTMP-GASSSLVVKFAD 81


>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins
          family.  This subfamily corresponds to the RRM1 of the
          Hu proteins family which represents a group of
          RNA-binding proteins involved in diverse biological
          processes. Since the Hu proteins share high homology
          with the Drosophila embryonic lethal abnormal vision
          (ELAV) protein, the Hu family is sometimes referred to
          as the ELAV family. Drosophila ELAV is exclusively
          expressed in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress. HuR
          has an anti-apoptotic function during early cell stress
          response. It binds to mRNAs and enhances the expression
          of several anti-apoptotic proteins, such as p21waf1,
          p53, and prothymosin alpha. HuR also has pro-apoptotic
          function by promoting apoptosis when cell death is
          unavoidable. Furthermore, HuR may be important in
          muscle differentiation, adipogenesis, suppression of
          inflammatory response and modulation of gene expression
          in response to chronic ethanol exposure and amino acid
          starvation. Hu proteins perform their cytoplasmic and
          nuclear molecular functions by coordinately regulating
          functionally related mRNAs. In the cytoplasm, Hu
          proteins recognize and bind to AU-rich RNA elements
          (AREs) in the 3' untranslated regions (UTRs) of certain
          target mRNAs, such as GAP-43, vascular epithelial
          growth factor (VEGF), the glucose transporter GLUT1,
          eotaxin and c-fos, and stabilize those ARE-containing
          mRNAs. They also bind and regulate the translation of
          some target mRNAs, such as neurofilament M, GLUT1, and
          p27. In the nucleus, Hu proteins function as regulators
          of polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 78

 Score = 30.9 bits (70), Expect = 0.018
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          GF+ +    +AE+AI  LNG   +  N+ I V +A
Sbjct: 46 GFVNYVDPEDAEKAINTLNGL--RLQNKTIKVSYA 78


>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in
          RRM-containing coactivator activator/modulator (CoAA)
          and similar proteins.  This subfamily corresponds to
          the RRM in CoAA (also known as RBM14 or PSP2) and
          RNA-binding protein 4 (RBM4). CoAA is a heterogeneous
          nuclear ribonucleoprotein (hnRNP)-like protein
          identified as a nuclear receptor coactivator. It
          mediates transcriptional coactivation and RNA splicing
          effects in a promoter-preferential manner, and is
          enhanced by thyroid hormone receptor-binding protein
          (TRBP). CoAA contains two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a
          TRBP-interacting domain. RBM4 is a ubiquitously
          expressed splicing factor with two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may also function as a translational
          regulator of stress-associated mRNAs as well as play a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RRMs, a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. This family also includes Drosophila
          RNA-binding protein lark (Dlark), a homolog of human
          RBM4. It plays an important role in embryonic
          development and in the circadian regulation of adult
          eclosion. Dlark shares high sequence similarity with
          RBM4 at the N-terminal region. However, Dlark has three
          proline-rich segments instead of three alanine-rich
          segments within the C-terminal region. .
          Length = 66

 Score = 29.9 bits (68), Expect = 0.035
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVK 44
          GF+  ++  +AE AI+ LNG    G    I V+
Sbjct: 36 GFVHMEEEEDAEDAIKALNGYEFMGKR--INVE 66


>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 79

 Score = 29.9 bits (68), Expect = 0.042
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 8  CRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          CR  G++ F    +A+RA++E   T   G    I V+FA
Sbjct: 40 CRGFGYVTFALEEDAKRALEEKKKTKFGG--RKIHVEFA 76


>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated
          protein SR140 and similar proteins.  This subgroup
          corresponds to the RRM of SR140 (also termed U2
          snRNP-associated SURP motif-containing protein
          orU2SURP, or 140 kDa Ser/Arg-rich domain protein) which
          is a putative splicing factor mainly found in higher
          eukaryotes. Although it is initially identified as one
          of the 17S U2 snRNP-associated proteins, the molecular
          and physiological function of SR140 remains unclear.
          SR140 contains an N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), a SWAP/SURP domain that is
          found in a number of pre-mRNA splicing factors in the
          middle region, and a C-terminal arginine/serine-rich
          domain (RS domain).
          Length = 84

 Score = 29.9 bits (68), Expect = 0.042
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKG 36
          GF+ F  R +AERA+ EL+G    G
Sbjct: 49 GFVAFMNRADAERALDELDGKDVMG 73


>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM4 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in theThe
          CD corresponds to the RRM. regulation of poly(A) tail
          length during the polyadenylation reaction, translation
          initiation, mRNA stabilization by influencing the rate
          of deadenylation and inhibition of mRNA decapping. The
          family represents type I polyadenylate-binding proteins
          (PABPs), including polyadenylate-binding protein 1
          (PABP-1 or PABPC1), polyadenylate-binding protein 3
          (PABP-3 or PABPC3), polyadenylate-binding protein 4
          (PABP-4 or APP-1 or iPABP), polyadenylate-binding
          protein 5 (PABP-5 or PABPC5), polyadenylate-binding
          protein 1-like (PABP-1-like or PABPC1L),
          polyadenylate-binding protein 1-like 2 (PABPC1L2 or
          RBM32), polyadenylate-binding protein 4-like
          (PABP-4-like or PABPC4L), yeast polyadenylate-binding
          protein, cytoplasmic and nuclear (PABP or ACBP-67), and
          similar proteins. PABP-1 is an ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes the yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 79

 Score = 29.9 bits (68), Expect = 0.042
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 9/45 (20%)

Query: 2  KGFTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          KGF       GF+ F    EA +A+ E+NG I  G  +P+ V  A
Sbjct: 42 KGF-------GFVCFSSPEEATKAVTEMNGRIIGG--KPLYVALA 77


>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General
           function prediction only].
          Length = 306

 Score = 31.1 bits (69), Expect = 0.044
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 4   FTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANSPSSSNK 54
            T   R   F+ F+    AE+AI+ELNG   +G   P+ V+ A   S    
Sbjct: 152 ETGKSRGFAFVEFESEESAEKAIEELNGKELEGR--PLRVQKAQPASQPRS 200


>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering
          time control protein FCA and similar proteins.  This
          subgroup corresponds to the RRM1 of FCA, a gene
          controlling flowering time in Arabidopsis, encoding a
          flowering time control protein that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RNA
          recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNP (ribonucleoprotein domains),
          and a WW protein interaction domain. .
          Length = 80

 Score = 29.5 bits (66), Expect = 0.057
 Identities = 14/37 (37%), Positives = 27/37 (72%), Gaps = 3/37 (8%)

Query: 13 FIRFDQRIEAERAIQELNG--TIPKGSNEPITVKFAN 47
          F+++  R EA+RAI+ L+   T+P G++ P+ V++A+
Sbjct: 45 FVKYSTRDEADRAIRALHNQRTLPGGAS-PVQVRYAD 80


>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins p40-TIA-1 and
          TIAR.  This subfamily corresponds to the RRM2 of
          nucleolysin TIA-1 isoform p40 (p40-TIA-1 or TIA-1) and
          nucleolysin TIA-1-related protein (TIAR), both of which
          are granule-associated RNA binding proteins involved in
          inducing apoptosis in cytotoxic lymphocyte (CTL) target
          cells. TIA-1 and TIAR share high sequence similarity.
          They are expressed in a wide variety of cell types.
          TIA-1 can be phosphorylated by a serine/threonine
          kinase that is activated during Fas-mediated apoptosis.
          TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both,
          TIA-1 and TIAR, bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains.
          Length = 75

 Score = 29.3 bits (66), Expect = 0.059
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 12 GFIRFDQRIEAERAIQELNG 31
          GF+ F ++ +AE AIQ +NG
Sbjct: 44 GFVSFVKKEDAENAIQSMNG 63


>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation
          factor E (NELF-E) and similar proteins.  This subfamily
          corresponds to the RRM of NELF-E, also termed
          RNA-binding protein RD. NELF-E is the RNA-binding
          subunit of cellular negative transcription elongation
          factor NELF (negative elongation factor) involved in
          transcriptional regulation of HIV-1 by binding to the
          stem of the viral transactivation-response element
          (TAR) RNA which is synthesized by cellular RNA
          polymerase II at the viral long terminal repeat. NELF
          is a heterotetrameric protein consisting of NELF A, B,
          C or the splice variant D, and E. NELF-E contains an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). It
          plays a role in the control of HIV transcription by
          binding to TAR RNA. In addition, NELF-E is associated
          with the NELF-B subunit, probably via a leucine zipper
          motif. .
          Length = 75

 Score = 29.2 bits (66), Expect = 0.072
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 12 GFIRFDQRIEAERAIQELNGT 32
          GF+ F++   A+RAI ELNGT
Sbjct: 41 GFVTFEKMESADRAIAELNGT 61


>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic
          translation initiation factor 3 subunit G (eIF-3G) and
          similar proteins.  This subfamily corresponds to the
          RRM of eIF-3G and similar proteins. eIF-3G, also termed
          eIF-3 subunit 4, or eIF-3-delta, or eIF3-p42, or
          eIF3-p44, is the RNA-binding subunit of eIF3, a large
          multisubunit complex that plays a central role in the
          initiation of translation by binding to the 40 S
          ribosomal subunit and promoting the binding of
          methionyl-tRNAi and mRNA. eIF-3G binds 18 S rRNA and
          beta-globin mRNA, and therefore appears to be a
          nonspecific RNA-binding protein. eIF-3G is one of the
          cytosolic targets and interacts with mature
          apoptosis-inducing factor (AIF). eIF-3G contains one
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). This
          family also includes yeast eIF3-p33, a homolog of
          vertebrate eIF-3G, plays an important role in the
          initiation phase of protein synthesis in yeast. It
          binds both, mRNA and rRNA, fragments due to an RRM near
          its C-terminus. .
          Length = 77

 Score = 29.0 bits (66), Expect = 0.072
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNG 31
          T   R   F+ F  R +AERAI++LNG
Sbjct: 37 TGQSRGFAFVTFHTREDAERAIEKLNG 63


>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like
          family of RNA binding proteins CELF1, CELF2, CELF3,
          CELF4, CELF5, CELF6 and similar proteins.  This
          subgroup corresponds to the RRM3 of the CUGBP1 and
          ETR-3-like factors (CELF) or BRUNOL (Bruno-like)
          proteins, a family of structurally related RNA-binding
          proteins involved in the regulation of pre-mRNA
          splicing in the nucleus and in the control of mRNA
          translation and deadenylation in the cytoplasm. The
          family contains six members: CELF-1 (also termed
          BRUNOL-2, or CUG-BP1, or NAPOR, or EDEN-BP), CELF-2
          (also termed BRUNOL-3, or ETR-3, or CUG-BP2, or
          NAPOR-2), CELF-3 (also termed BRUNOL-1, or TNRC4, or
          ETR-1, or CAGH4, or ER DA4), CELF-4 (also termed
          BRUNOL-4), CELF-5 (also termed BRUNOL-5), CELF-6 (also
          termed BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts. .
          Length = 73

 Score = 29.1 bits (66), Expect = 0.072
 Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 7/30 (23%)

Query: 2  KGFTDFCRYLGFIRFDQRIEAERAIQELNG 31
          K F       GF+ +D    A+ AI+ +NG
Sbjct: 40 KCF-------GFVSYDNPESAQAAIKAMNG 62


>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding
          protein 45 (RBM45) and similar proteins.  This
          subfamily corresponds to the RRM4 of RBM45, also termed
          developmentally-regulated RNA-binding protein 1 (DRB1),
          a new member of RNA recognition motif (RRM)-type neural
          RNA-binding proteins, which expresses under
          spatiotemporal control. It is encoded by gene drb1 that
          is expressed in neurons, not in glial cells. RBM45
          predominantly localizes in cytoplasm of cultured cells
          and specifically binds to poly(C) RNA. It could play an
          important role during neurogenesis. RBM45 carries four
          RRMs, also known as RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 68

 Score = 28.8 bits (65), Expect = 0.073
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGS 37
          G+ ++  R  AERAI  L+G    G 
Sbjct: 38 GYAKYADRESAERAITTLHGKEVNGV 63


>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1
          complementation factor (ACF).  This subgroup
          corresponds to the RRM3 of ACF, also termed
          APOBEC-1-stimulating protein, an RNA-binding subunit of
          a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone and play a
          key role in cell growth and differentiation. ACF
          shuttles between the cytoplasm and nucleus. ACF
          contains three RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), which display high
          affinity for an 11 nucleotide AU-rich mooring sequence
          3' of the edited cytidine in apoB mRNA. All three RRMs
          may be required for complementation of editing activity
          in living cells. RRM2/3 are implicated in ACF
          interaction with APOBEC-1. .
          Length = 83

 Score = 29.2 bits (65), Expect = 0.074
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          R   F+ F  R +A  A+  LNG +  GS  PI V  A
Sbjct: 44 RDYAFVHFSNREDAVDAMNALNGKVIDGS--PIEVTLA 79


>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA
          selenocysteine-associated protein 1 (SECp43).  This
          subgroup corresponds to the RRM2 of SECp43, an
          RNA-binding protein associated specifically with
          eukaryotic selenocysteine tRNA [tRNA(Sec)]. It may play
          an adaptor role in the mechanism of selenocysteine
          insertion. SECp43 is located primarily in the nucleus
          and contains two N-terminal RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal
          polar/acidic region. .
          Length = 82

 Score = 29.2 bits (66), Expect = 0.083
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANS 48
          GF+RF    E +RA+ E+ G    G   PI V  A  
Sbjct: 46 GFVRFSDESEQKRALTEMQGASGLGGK-PIRVSLAIP 81


>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
          domain).  The RRM motif is probably diagnostic of an
          RNA binding protein. RRMs are found in a variety of RNA
          binding proteins, including various hnRNP proteins,
          proteins implicated in regulation of alternative
          splicing, and protein components of snRNPs. The motif
          also appears in a few single stranded DNA binding
          proteins.
          Length = 56

 Score = 28.6 bits (65), Expect = 0.083
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
           F+ F     AE+A+Q LNG +  G   P+ V ++
Sbjct: 24 AFVEFSTEEAAEKAVQYLNGVLFGG--RPLRVDYS 56


>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA
          selenocysteine-associated protein 1 (SECp43).  This
          subgroup corresponds to the RRM1 of SECp43, an
          RNA-binding protein associated specifically with
          eukaryotic selenocysteine tRNA [tRNA(Sec)]. It may play
          an adaptor role in the mechanism of selenocysteine
          insertion. SECp43 is located primarily in the nucleus
          and contains two N-terminal RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal
          polar/acidic region. .
          Length = 84

 Score = 29.2 bits (66), Expect = 0.087
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEP 40
           F+ F     AER + +LNG    GSN P
Sbjct: 45 CFVEFADEATAERCLHKLNGKPIPGSNPP 73


>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in
          serine/arginine-rich splicing factor 3 (SRSF3) and
          similar proteins.  This subfamily corresponds to the
          RRM of two serine/arginine (SR) proteins,
          serine/arginine-rich splicing factor 3 (SRSF3) and
          serine/arginine-rich splicing factor 7 (SRSF7). SRSF3,
          also termed pre-mRNA-splicing factor SRp20, modulates
          alternative splicing by interacting with RNA
          cis-elements in a concentration- and cell
          differentiation-dependent manner. It is also involved
          in termination of transcription, alternative RNA
          polyadenylation, RNA export, and protein translation.
          SRSF3 is critical for cell proliferation, and tumor
          induction and maintenance. It can shuttle between the
          nucleus and cytoplasm. SRSF7, also termed splicing
          factor 9G8, plays a crucial role in both constitutive
          splicing and alternative splicing of many pre-mRNAs.
          Its localization and functions are tightly regulated by
          phosphorylation. SRSF7 is predominantly present in the
          nuclear and can shuttle between nucleus and cytoplasm.
          It cooperates with the export protein, Tap/NXF1, helps
          mRNA export to the cytoplasm, and enhances the
          expression of unspliced mRNA. Moreover, SRSF7 inhibits
          tau E10 inclusion through directly interacting with the
          proximal downstream intron of E10, a clustering region
          for frontotemporal dementia with Parkinsonism (FTDP)
          mutations. Both SRSF3 and SRSF7 contain a single
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal RS domain rich in serine-arginine
          dipeptides. The RRM domain is involved in RNA binding,
          and the RS domain has been implicated in protein
          shuttling and protein-protein interactions. .
          Length = 73

 Score = 28.4 bits (64), Expect = 0.12
 Identities = 9/37 (24%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANS 48
           F+ F+   +AE A++ L+G    G+   + V+ +  
Sbjct: 39 AFVEFEDPRDAEDAVRALDGRRICGN--RVRVELSRG 73


>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding
          protein 45 (RBM45) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM45, also termed
          developmentally-regulated RNA-binding protein 1 (DRB1),
          a new member of RNA recognition motif (RRM)-type neural
          RNA-binding proteins, which expresses under
          spatiotemporal control. It is encoded by gene drb1 that
          is expressed in neurons, not in glial cells. RBM45
          predominantly localizes in cytoplasm of cultured cells
          and specifically binds to poly(C) RNA. It could play an
          important role during neurogenesis. RBM45 carries four
          RRMs, also known as RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 81

 Score = 28.1 bits (63), Expect = 0.19
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 13 FIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          +++F +   A RA++E+NG    G  +P+ V  A
Sbjct: 48 YVKFAKASSAARAMEEMNGKCLGGDTKPLKVLIA 81


>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM3 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is an ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. PABP-1 possesses an A-rich sequence in its
          5'-UTR and allows binding of PABP and blockage of
          translation of its own mRNA. In contrast, PABP-3 lacks
          the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes the yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 80

 Score = 27.9 bits (63), Expect = 0.20
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 7/35 (20%)

Query: 2  KGFTDFCRYLGFIRFDQRIEAERAIQELNGTIPKG 36
          KGF       GF+ F+    A++A++ELNG    G
Sbjct: 42 KGF-------GFVNFENHEAAQKAVEELNGKEVNG 69


>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM2 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is a ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Unlike other PABPs, PABP-5
          contains only four RRMs, but lacks both the linker
          region and the CTD. PABP-1-like and PABP-1-like 2 are
          the orthologs of PABP-1. PABP-4-like is the ortholog of
          PABP-5. Their cellular functions remain unclear. The
          family also includes the yeast PABP, a conserved
          poly(A) binding protein containing poly(A) tails that
          can be attached to the 3'-ends of mRNAs. The yeast PABP
          and its homologs may play important roles in the
          initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 77

 Score = 27.9 bits (63), Expect = 0.21
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 7/32 (21%)

Query: 2  KGFTDFCRYLGFIRFDQRIEAERAIQELNGTI 33
          KG+       GF+ F+    A RAI+++NG +
Sbjct: 43 KGY-------GFVHFETEEAAVRAIEKVNGML 67


>gnl|CDD|153349 cd07665, BAR_SNX1, The Bin/Amphiphysin/Rvs (BAR) domain of Sorting
           Nexin 1.  BAR domains are dimerization, lipid binding
           and curvature sensing modules found in many different
           proteins with diverse functions. Sorting nexins (SNXs)
           are Phox homology (PX) domain containing proteins that
           are involved in regulating membrane traffic and protein
           sorting in the endosomal system. SNXs differ from each
           other in their lipid-binding specificity, subcellular
           localization and specific function in the endocytic
           pathway. A subset of SNXs also contain BAR domains. The
           PX-BAR structural unit determines the specific membrane
           targeting of SNXs. SNX1 is a component of the retromer
           complex, a membrane coat multimeric complex required for
           endosomal retrieval of lysosomal hydrolase receptors to
           the Golgi. The retromer consists of a cargo-recognition
           subcomplex and a subcomplex formed by a dimer of sorting
           nexins (SNX1 and/or SNX2), which ensures effcient cargo
           sorting by facilitating proper membrane localization of
           the cargo-recognition subcomplex. SNX1 is localized to a
           microdomain in early endosomes where it regulates
           cation-independent mannose-6-phosphate receptor
           retrieval to the trans Golgi network. BAR domains form
           dimers that bind to membranes, induce membrane bending
           and curvature, and may also be involved in
           protein-protein interactions.
          Length = 234

 Score = 28.9 bits (64), Expect = 0.22
 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 4   FTDFCRYLGFIR--FDQRIEAERAIQELNGTIPKGSNEPITVKFANSP 49
             D+ R L  +R  FDQR++  +  Q+    + K       + +AN P
Sbjct: 111 LADYIRLLSAVRGAFDQRMKTWQRWQDAQAMLQKKREAEARLLWANKP 158


>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter
          pylori HP0827 protein and similar proteins.  This
          subfamily corresponds to the RRM of H. pylori HP0827, a
          putative ssDNA-binding protein 12rnp2 precursor,
          containing one RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). The ssDNA binding may be important in
          activation of HP0827. .
          Length = 78

 Score = 28.0 bits (63), Expect = 0.22
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 2/44 (4%)

Query: 4  FTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFAN 47
           T   R  GF+  +   EA  AI++LNGT   G    +TV  A 
Sbjct: 36 ETGRSRGFGFVEMETAEEANAAIEKLNGTDFGG--RTLTVNEAR 77


>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1,
           2, 3, 4 family.  These eukaryotic proteins recognize the
           poly-A of mRNA and consists of four tandem RNA
           recognition domains at the N-terminus (rrm: pfam00076)
           followed by a PABP-specific domain (pfam00658) at the
           C-terminus. The protein is involved in the transport of
           mRNA's from the nucleus to the cytoplasm. There are four
           paralogs in Homo sapiens which are expressed in testis
           (GP:11610605_PABP3 ), platelets (SP:Q13310_PABP4 ),
           broadly expressed (SP:P11940_PABP1) and of unknown
           tissue range (SP:Q15097_PABP2).
          Length = 562

 Score = 29.0 bits (65), Expect = 0.23
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 9   RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
           R  GF+ F    EA RA+ E++G +  G  +P+ V  A
Sbjct: 326 RGFGFVCFSNPEEANRAVTEMHGRMLGG--KPLYVALA 361



 Score = 28.2 bits (63), Expect = 0.39
 Identities = 9/22 (40%), Positives = 16/22 (72%)

Query: 12  GFIRFDQRIEAERAIQELNGTI 33
           GF+ F++   A+ AIQ++NG +
Sbjct: 132 GFVHFEKEESAKAAIQKVNGML 153



 Score = 26.3 bits (58), Expect = 2.2
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKG 36
          G++ F    +AERA++ +N     G
Sbjct: 45 GYVNFQNPADAERALETMNFKRLGG 69



 Score = 25.2 bits (55), Expect = 5.3
 Identities = 8/25 (32%), Positives = 16/25 (64%)

Query: 8   CRYLGFIRFDQRIEAERAIQELNGT 32
            R   F+ F++  +A +A++E+NG 
Sbjct: 218 SRGFAFVNFEKHEDAAKAVEEMNGK 242


>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and
          cytoplasmic polyadenylated RNA-binding protein PUB1 and
          similar proteins.  This subgroup corresponds to the
          RRM2 of yeast protein PUB1, also termed ARS
          consensus-binding protein ACBP-60, or poly
          uridylate-binding protein, or poly(U)-binding protein.
          PUB1 has been identified as both, a heterogeneous
          nuclear RNA-binding protein (hnRNP) and a cytoplasmic
          mRNA-binding protein (mRNP), which may be stably bound
          to a translationally inactive subpopulation of mRNAs
          within the cytoplasm. It is distributed in both, the
          nucleus and the cytoplasm, and binds to poly(A)+ RNA
          (mRNA or pre-mRNA). Although it is one of the major
          cellular proteins cross-linked by UV light to
          polyadenylated RNAs in vivo, PUB1 is nonessential for
          cell growth in yeast. PUB1 also binds to T-rich single
          stranded DNA (ssDNA). However, there is no strong
          evidence implicating PUB1 in the mechanism of DNA
          replication. PUB1 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a GAR motif (glycine
          and arginine rich stretch) that is located between RRM2
          and RRM3. .
          Length = 75

 Score = 27.9 bits (62), Expect = 0.26
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 9  RYLGFIRFDQRIEAERAIQELNG 31
          R  GF+ F  + +AE AI E+NG
Sbjct: 41 RGYGFVSFRSQQDAENAINEMNG 63


>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding
          protein 19 (RBM19 or RBD-1) and similar proteins.  This
          subfamily corresponds to the RRM5 of RBM19 and RRM4 of
          MRD1. RBM19, also termed RNA-binding domain-1 (RBD-1),
          is a nucleolar protein conserved in eukaryotes involved
          in ribosome biogenesis by processing rRNA and is
          essential for preimplantation development. It has a
          unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 82

 Score = 27.6 bits (62), Expect = 0.28
 Identities = 8/21 (38%), Positives = 14/21 (66%)

Query: 12 GFIRFDQRIEAERAIQELNGT 32
          GF+ F  +  A++A++ L GT
Sbjct: 50 GFVEFKSKEAAQKALKRLQGT 70


>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and
          cytoplasmic polyadenylated RNA-binding protein PUB1 and
          similar proteins.  This subgroup corresponds to the
          RRM1 of yeast protein PUB1, also termed ARS
          consensus-binding protein ACBP-60, or poly
          uridylate-binding protein, or poly(U)-binding protein.
          PUB1 has been identified as both, a heterogeneous
          nuclear RNA-binding protein (hnRNP) and a cytoplasmic
          mRNA-binding protein (mRNP), which may be stably bound
          to a translationally inactive subpopulation of mRNAs
          within the cytoplasm. It is distributed in both, the
          nucleus and the cytoplasm, and binds to poly(A)+ RNA
          (mRNA or pre-mRNA). Although it is one of the major
          cellular proteins cross-linked by UV light to
          polyadenylated RNAs in vivo, PUB1 is nonessential for
          cell growth in yeast. PUB1 also binds to T-rich single
          stranded DNA (ssDNA); however, there is no strong
          evidence implicating PUB1 in the mechanism of DNA
          replication. PUB1 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a GAR motif (glycine
          and arginine rich stretch) that is located between RRM2
          and RRM3. .
          Length = 74

 Score = 27.5 bits (61), Expect = 0.28
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 12 GFIRFDQRIEAERAIQELNG 31
          GF+ + Q  +AE A+Q LNG
Sbjct: 42 GFVEYHQSHDAEIALQTLNG 61


>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA
          recognition motif 1 (hRBMY), testis-specific
          heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T)
          and similar proteins.  This subfamily corresponds to
          the RRM domain of hnRNP G, also termed glycoprotein p43
          or RBMX, an RNA-binding motif protein located on the X
          chromosome. It is expressed ubiquitously and has been
          implicated in the splicing control of several
          pre-mRNAs. Moreover, hnRNP G may function as a
          regulator of transcription for SREBP-1c and GnRH1.
          Research has shown that hnRNP G may also act as a
          tumor-suppressor since it upregulates the Txnip gene
          and promotes the fidelity of DNA end-joining activity.
          In addition, hnRNP G appears to play a critical role in
          proper neural development of zebrafish and frog
          embryos. The family also includes several paralogs of
          hnRNP G, such as hRBMY and hnRNP G-T (also termed
          RNA-binding motif protein, X-linked-like-2). Both,
          hRBMY and hnRNP G-T, are exclusively expressed in
          testis and critical for male fertility. Like hnRNP G,
          hRBMY and hnRNP G-T interact with factors implicated in
          the regulation of pre-mRNA splicing, such as
          hTra2-beta1 and T-STAR. Although members in this family
          share a high conserved N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), they appear to recognize
          different RNA targets. For instance, hRBMY interacts
          specifically with a stem-loop structure in which the
          loop is formed by the sequence CA/UCAA. In contrast,
          hnRNP G associates with single stranded RNA sequences
          containing a CCA/C motif. In addition to the RRM, hnRNP
          G contains a nascent transcripts targeting domain (NTD)
          in the middle region and a novel auxiliary RNA-binding
          domain (RBD) in its C-terminal region. The C-terminal
          RBD exhibits distinct RNA binding specificity, and
          would play a critical role in the regulation of
          alternative splicing by hnRNP G. .
          Length = 80

 Score = 27.6 bits (62), Expect = 0.30
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGT 32
          R  GF+ F+   +A+ AI++LNG 
Sbjct: 43 RGFGFVTFESVEDADAAIRDLNGK 66


>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA
          binding protein fox-1 homologs and similar proteins.
          This subfamily corresponds to the RRM of several
          tissue-specific alternative splicing isoforms of
          vertebrate RNA binding protein Fox-1 homologs, which
          show high sequence similarity to the Caenorhabditis
          elegans feminizing locus on X (Fox-1) gene encoding
          Fox-1 protein. RNA binding protein Fox-1 homolog 1
          (RBFOX1), also termed ataxin-2-binding protein 1
          (A2BP1), or Fox-1 homolog A, or
          hexaribonucleotide-binding protein 1 (HRNBP1), is
          predominantly expressed in neurons, skeletal muscle and
          heart. It regulates alternative splicing of
          tissue-specific exons by binding to UGCAUG elements.
          Moreover, RBFOX1 binds to the C-terminus of ataxin-2
          and forms an ataxin-2/A2BP1 complex involved in RNA
          processing. RNA binding protein fox-1 homolog 2
          (RBFOX2), also termed Fox-1 homolog B, or
          hexaribonucleotide-binding protein 2 (HRNBP2), or
          RNA-binding motif protein 9 (RBM9), or repressor of
          tamoxifen transcriptional activity, is expressed in
          ovary, whole embryo, and human embryonic cell lines in
          addition to neurons and muscle. RBFOX2 activates
          splicing of neuron-specific exons through binding to
          downstream UGCAUG elements. RBFOX2 also functions as a
          repressor of tamoxifen activation of the estrogen
          receptor. RNA binding protein Fox-1 homolog 3 (RBFOX3
          or NeuN or HRNBP3), also termed Fox-1 homolog C, is a
          nuclear RNA-binding protein that regulates alternative
          splicing of the RBFOX2 pre-mRNA, producing a message
          encoding a dominant negative form of the RBFOX2
          protein. Its message is detected exclusively in
          post-mitotic regions of embryonic brain. Like RBFOX1,
          both RBFOX2 and RBFOX3 bind to the hexanucleotide
          UGCAUG elements and modulate brain and muscle-specific
          splicing of exon EIIIB of fibronectin, exon N1 of
          c-src, and calcitonin/CGRP. Members in this family also
          harbor one RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 76

 Score = 27.4 bits (61), Expect = 0.33
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 7/35 (20%)

Query: 2  KGFTDFCRYLGFIRFDQRIEAERAIQELNGTIPKG 36
          KGF       GF+ F    +A+RA ++L+GT+ +G
Sbjct: 40 KGF-------GFVTFANSADADRAREKLHGTVVEG 67


>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear
          cap-binding protein subunit 2 (CBP20) and similar
          proteins.  This subfamily corresponds to the RRM of
          CBP20, also termed nuclear cap-binding protein subunit
          2 (NCBP2), or cell proliferation-inducing gene 55
          protein, or NCBP-interacting protein 1 (NIP1). CBP20 is
          the small subunit of the nuclear cap binding complex
          (CBC), which is a conserved eukaryotic heterodimeric
          protein complex binding to 5'-capped polymerase II
          transcripts and plays a central role in the maturation
          of pre-mRNA and uracil-rich small nuclear RNA (U
          snRNA). CBP20 is most likely responsible for the
          binding of capped RNA. It contains an RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), and interacts with the
          second and third domains of CBP80, the large subunit of
          CBC. .
          Length = 78

 Score = 27.5 bits (62), Expect = 0.36
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 4/27 (14%)

Query: 7  FCRYLGFIRFDQRIEAERAIQELNGTI 33
          FC    F+ +  R +AE A++ LNGT 
Sbjct: 42 FC----FVEYYTREDAENAVKYLNGTK 64


>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate
          heterogeneous nuclear ribonucleoprotein M (hnRNP M).
          This subgroup corresponds to the RRM2 of hnRNP M, a
          pre-mRNA binding protein that may play an important
          role in the pre-mRNA processing. It also preferentially
          binds to poly(G) and poly(U) RNA homopolymers. hnRNP M
          is able to interact with early spliceosomes, further
          influencing splicing patterns of specific pre-mRNAs. It
          functions as the receptor of carcinoembryonic antigen
          (CEA) that contains the penta-peptide sequence PELPK
          signaling motif. In addition, hnRNP M and another
          splicing factor Nova-1 work together as dopamine D2
          receptor (D2R) pre-mRNA-binding proteins. They regulate
          alternative splicing of D2R pre-mRNA in an antagonistic
          manner. hnRNP M contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an unusual
          hexapeptide-repeat region rich in methionine and
          arginine residues (MR repeat motif). .
          Length = 76

 Score = 26.9 bits (59), Expect = 0.50
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKF 45
          R +G + F+Q IEA +AI   NG +    + P+ VK 
Sbjct: 41 RGIGTVTFEQPIEAVQAISMFNGQLL--FDRPMHVKM 75


>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 4 (SRSF4) and
          similar proteins.  This subfamily corresponds to the
          RRM1 in three serine/arginine (SR) proteins:
          serine/arginine-rich splicing factor 4 (SRSF4 or SRp75
          or SFRS4), serine/arginine-rich splicing factor 5
          (SRSF5 or SRp40 or SFRS5 or HRS), serine/arginine-rich
          splicing factor 6 (SRSF6 or SRp55). SRSF4 plays an
          important role in both, constitutive  and alternative,
          splicing of many pre-mRNAs. It can shuttle between the
          nucleus and cytoplasm. SRSF5 regulates both alternative
          splicing and basal splicing. It is the only SR protein
          efficiently selected from nuclear extracts (NE) by the
          splicing enhancer (ESE) and essential for enhancer
          activation. SRSF6 preferentially interacts with a
          number of purine-rich splicing enhancers (ESEs) to
          activate splicing of the ESE-containing exon. It is the
          only protein from HeLa nuclear extract or purified SR
          proteins that specifically binds B element RNA after UV
          irradiation. SRSF6 may also recognize different types
          of RNA sites. Members in this family contain two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a C-terminal RS domains rich in
          serine-arginine dipeptides. .
          Length = 70

 Score = 26.9 bits (60), Expect = 0.53
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          GF+ F+   +A+ A+ ELNG    G  E + V+ A
Sbjct: 36 GFVEFEDPRDADDAVYELNGKELCG--ERVIVEHA 68


>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA
          selenocysteine-associated protein 1 (SECp43) and
          similar proteins.  This subfamily corresponds to the
          RRM2 in tRNA selenocysteine-associated protein 1
          (SECp43), yeast negative growth regulatory protein NGR1
          (RBP1), yeast protein NAM8, and similar proteins.
          SECp43 is an RNA-binding protein associated
          specifically with eukaryotic selenocysteine tRNA
          [tRNA(Sec)]. It may play an adaptor role in the
          mechanism of selenocysteine insertion. SECp43 is
          located primarily in the nucleus and contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal polar/acidic region. Yeast
          proteins, NGR1 and NAM8, show high sequence similarity
          with SECp43. NGR1 is a putative glucose-repressible
          protein that binds both RNA and single-stranded DNA
          (ssDNA). It may function in regulating cell growth in
          early log phase, possibly through its participation in
          RNA metabolism. NGR1 contains three RRMs, two of which
          are followed by a glutamine-rich stretch that may be
          involved in transcriptional activity. In addition, NGR1
          has an asparagine-rich region near the C-terminus which
          also harbors a methionine-rich region. NAM8 is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. NAM8
          also contains three RRMs.  .
          Length = 80

 Score = 26.9 bits (60), Expect = 0.55
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 12 GFIRFDQRIEAERAIQELNG 31
          GF+RF    E +RA+ E+NG
Sbjct: 47 GFVRFGDEDERDRALTEMNG 66


>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate
          heterogeneous nuclear ribonucleoprotein Q (hnRNP Q).
          This subgroup corresponds to the RRM3 of hnRNP Q, also
          termed glycine- and tyrosine-rich RNA-binding protein
          (GRY-RBP), or NS1-associated protein 1 (NASP1), or
          synaptotagmin-binding, cytoplasmic RNA-interacting
          protein (SYNCRIP). It is a ubiquitously expressed
          nuclear RNA-binding protein identified as a component
          of the spliceosome complex, as well as a component of
          the apobec-1 editosome. As an alternatively spliced
          version of NSAP, it acts as an interaction partner of a
          multifunctional protein required for viral replication,
          and is implicated in the regulation of specific mRNA
          transport. hnRNP Q has also been identified as SYNCRIP
          that is a dual functional protein participating in both
          viral RNA replication and translation. As a
          synaptotagmin-binding protein, hnRNP Q plays a putative
          role in organelle-based mRNA transport along the
          cytoskeleton. Moreover, hnRNP Q has been found in
          protein complexes involved in translationally coupled
          mRNA turnover and mRNA splicing. It functions as a
          wild-type survival motor neuron (SMN)-binding protein
          that may participate in pre-mRNA splicing and modulate
          mRNA transport along microtubuli. hnRNP Q contains an
          acidic auxiliary N-terminal region, followed by two
          well defined and one degenerated RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal RGG
          motif; hnRNP Q binds RNA through its RRM domains. .
          Length = 72

 Score = 26.9 bits (59), Expect = 0.55
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
           FI FD+R  A +A++E+NG   +G N  I + FA
Sbjct: 38 AFIHFDERDGAVKAMEEMNGKELEGEN--IEIVFA 70


>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like
          family member CELF-1, CELF-2 and similar proteins.
          This subgroup corresponds to the RRM3 of CELF-1 (also
          termed BRUNOL-2, or CUG-BP1, or EDEN-BP) and CELF-2
          (also termed BRUNOL-3, or ETR-3, or CUG-BP2, or NAPOR),
          both of which belong to the CUGBP1 and ETR-3-like
          factors (CELF) or BRUNOL (Bruno-like) family of
          RNA-binding proteins that have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-1 is strongly
          expressed in all adult and fetal tissues tested. Human
          CELF-1 is a nuclear and cytoplasmic RNA-binding protein
          that regulates multiple aspects of nuclear and
          cytoplasmic mRNA processing, with implications for
          onset of type 1 myotonic dystrophy (DM1), a
          neuromuscular disease associated with an unstable CUG
          triplet expansion in the 3'-UTR (3'-untranslated
          region) of the DMPK (myotonic dystrophy protein kinase)
          gene; it preferentially targets UGU-rich mRNA elements.
          It has been shown to bind to a Bruno response element,
          a cis-element involved in translational control of
          oskar mRNA in Drosophila, and share sequence similarity
          to Bruno, the Drosophila protein that mediates this
          process. The Xenopus homolog embryo deadenylation
          element-binding protein (EDEN-BP) mediates
          sequence-specific deadenylation of Eg5 mRNA. It
          specifically binds to the EDEN motif in the
          3'-untranslated regions of maternal mRNAs and targets
          these mRNAs for deadenylation and translational
          repression. CELF-1 contain three highly conserved RNA
          recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein. The two N-terminal RRMs of EDEN-BP are
          necessary for the interaction with EDEN as well as a
          part of the linker region (between RRM2 and RRM3).
          Oligomerization of EDEN-BP is required for specific
          mRNA deadenylation and binding. CELF-2 is expressed in
          all tissues at some level, but highest in brain, heart,
          and thymus. It has been implicated in the regulation of
          nuclear and cytoplasmic RNA processing events,
          including alternative splicing, RNA editing, stability
          and translation. CELF-2 shares high sequence identity
          with CELF-1, but shows different binding specificity;
          it binds preferentially to sequences with UG repeats
          and UGUU motifs. It has been shown to bind to a Bruno
          response element, a cis-element involved in
          translational control of oskar mRNA in Drosophila, and
          share sequence similarity to Bruno, the Drosophila
          protein that mediates this process. It also binds to
          the 3'-UTR of cyclooxygenase-2 messages, affecting both
          translation and mRNA stability, and binds to apoB mRNA,
          regulating its C to U editing. CELF-2 also contain
          three highly conserved RRMs. It binds to RNA via the
          first two RRMs, which are important for localization in
          the cytoplasm. The splicing activation or repression
          activity of CELF-2 on some specific substrates is
          mediated by RRM1/RRM2. Both, RRM1 and RRM2 of CELF-2,
          can activate cardiac troponin T (cTNT) exon 5
          inclusion. In addition, CELF-2 possesses a typical
          arginine and lysine-rich nuclear localization signal
          (NLS) in the C-terminus, within RRM3. .
          Length = 92

 Score = 27.3 bits (60), Expect = 0.56
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNG 31
          T+  +  GF+ +D  + A+ AIQ +NG
Sbjct: 45 TNLSKCFGFVSYDNPVSAQAAIQAMNG 71


>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic
          activator RIM4 and similar proteins.  This subfamily
          corresponds to the RRM2 of RIM4, also termed regulator
          of IME2 protein 4, a putative RNA binding protein that
          is expressed at elevated levels early in meiosis. It
          functions as a meiotic activator required for both the
          IME1- and IME2-dependent pathways of meiotic gene
          expression, as well as early events of meiosis, such as
          meiotic division and recombination, in Saccharomyces
          cerevisiae. RIM4 contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The family also includes a
          putative RNA-binding protein termed multicopy
          suppressor of sporulation protein Msa1. It is a
          putative RNA-binding protein encoded by a novel gene,
          msa1, from the fission yeast Schizosaccharomyces pombe.
          Msa1 may be involved in the inhibition of sexual
          differentiation by controlling the expression of
          Ste11-regulated genes, possibly through the
          pheromone-signaling pathway. Like RIM4, Msa1 also
          contains two RRMs, both of which are essential for the
          function of Msa1. .
          Length = 80

 Score = 26.9 bits (60), Expect = 0.58
 Identities = 8/26 (30%), Positives = 15/26 (57%)

Query: 13 FIRFDQRIEAERAIQELNGTIPKGSN 38
          FI+F++   A RA++  N ++ K   
Sbjct: 47 FIKFEREQAAARAVESENHSMLKNKT 72


>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate
          serine/arginine-rich splicing factor 5 (SRSF5).  This
          subgroup corresponds to the RRM1 of SRSF5, also termed
          delayed-early protein HRS, or pre-mRNA-splicing factor
          SRp40, or splicing factor, arginine/serine-rich 5
          (SFRS5). SFSF5 is an essential splicing regulatory
          serine/arginine (SR) protein that regulates both
          alternative splicing and basal splicing. It is the only
          SR protein efficiently selected from nuclear extracts
          (NE) by the splicing enhancer (ESE) and it is necessary
          for enhancer activation. SRSF5 also functions as a
          factor required for insulin-regulated splice site
          selection for protein kinase C (PKC) betaII mRNA. It is
          involved in the regulation of PKCbetaII exon inclusion
          by insulin via its increased phosphorylation by a
          phosphatidylinositol 3-kinase (PI 3-kinase) signaling
          pathway. Moreover, SRSF5 can regulate alternative
          splicing in exon 9 of glucocorticoid receptor pre-mRNA
          in a dose-dependent manner. SRSF5 contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a C-terminal RS domains rich in
          serine-arginine dipeptides. The specific RNA binding by
          SRSF5 requires the phosphorylation of its SR domain.  .
          Length = 70

 Score = 26.8 bits (59), Expect = 0.60
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 6  DFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          D  R  GF+ FD   +A+ A+ EL+G   +  NE +T++ A
Sbjct: 30 DLKRGFGFVEFDDPRDADDAVYELDGK--ELCNERVTIEHA 68


>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM1 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 69

 Score = 26.7 bits (59), Expect = 0.62
 Identities = 11/30 (36%), Positives = 14/30 (46%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSN 38
          R   F+       A+RAI+ELNG    G  
Sbjct: 34 RQFAFVHLRGEAAADRAIEELNGRELHGRK 63


>gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in
          serine/arginine-rich splicing factor SRSF1, SRSF4 and
          similar proteins.  This subfamily corresponds to the
          RRM2 of several serine/arginine (SR) proteins that have
          been classified into two subgroups. The first subgroup
          consists of serine/arginine-rich splicing factor 4
          (SRSF4 or SRp75 or SFRS4), serine/arginine-rich
          splicing factor 5 (SRSF5 or SRp40 or SFRS5 or HRS) and
          serine/arginine-rich splicing factor 6 (SRSF6 or
          SRp55). The second subgroup is composed of
          serine/arginine-rich splicing factor 1 (SRSF1 or
          ASF-1), serine/arginine-rich splicing factor 9 (SRSF9
          or SRp30C) and plant pre-mRNA-splicing factor SF2
          (SR1). These SR proteins are mainly involved in
          regulating constitutive and alternative pre-mRNA
          splicing. They also have been implicated in
          transcription, genomic stability, mRNA export and
          translation. All SR proteins in this family, except
          SRSF5, undergo nucleocytoplasmic shuttling, suggesting
          their widespread roles in gene expression. These SR
          proteins share a common domain architecture comprising
          two N-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by a C-terminal
          RS domains rich in serine-arginine dipeptides. Both
          domains can directly contact with RNA. The RRMs appear
          to determine the binding specificity and the SR domain
          also mediates protein-protein interactions. In
          addition, this subfamily includes the yeast nucleolar
          protein 3 (Npl3p), also termed mitochondrial targeting
          suppressor 1 protein, or nuclear polyadenylated
          RNA-binding protein 1. It is a major yeast RNA-binding
          protein that competes with 3'-end processing factors,
          such as Rna15, for binding to the nascent RNA,
          protecting the transcript from premature termination
          and coordinating transcription termination and the
          packaging of the fully processed transcript for export.
          It specifically recognizes a class of G/U-rich RNAs.
          Npl3p is a multi-domain protein with two RRMs,
          separated by a short linker and a C-terminal domain
          rich in glycine, arginine and serine residues. .
          Length = 71

 Score = 26.4 bits (59), Expect = 0.65
 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVK 44
          G + F  + + ERA+++L+GT  +G    + V+
Sbjct: 40 GVVEFTSQEDMERALRKLDGTEFRGRR--VRVE 70


>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila
          melanogaster Bruno protein and similar proteins.  This
          subgroup corresponds to the RRM2 of Bruno, a Drosophila
          RNA recognition motif (RRM)-containing protein that
          plays a central role in regulation of Oskar (Osk)
          expression. It mediates repression by binding to
          regulatory Bruno response elements (BREs) in the Osk
          mRNA 3' UTR. The full-length Bruno protein contains
          three RRMs, two located in the N-terminal half of the
          protein and the third near the C-terminus, separated by
          a linker region. .
          Length = 81

 Score = 26.7 bits (59), Expect = 0.70
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 13 FIRFDQRIEAERAIQELNGT-IPKGSNEPITVKFAN 47
          F+ F  R  A  AI+ ++ +   +G + P+ VKFA+
Sbjct: 46 FVTFASRQCALNAIKAMHHSQTMEGCSSPLVVKFAD 81


>gnl|CDD|203813 pfam07943, PBP5_C, Penicillin-binding protein 5, C-terminal
          domain.  Penicillin-binding protein 5 expressed by E.
          coli functions as a D-alanyl-D-alanine
          carboxypeptidase. It is composed of two domains that
          are oriented at approximately right angles to each
          other. The N-terminal domain (pfam00768) is the
          catalytic domain. The C-terminal domain featured in
          this family is organised into a sandwich of two
          anti-parallel beta-sheets, and has a relatively
          hydrophobic surface as compared to the N-terminal
          domain. Its precise function is unknown; it may mediate
          interactions with other cell wall-synthesising enzymes,
          thus allowing the protein to be recruited to areas of
          active cell wall synthesis. It may also function as a
          linker domain that positions the active site in the
          catalytic domain closer to the peptidoglycan layer, to
          allow it to interact with cell wall peptides.
          Length = 91

 Score = 26.8 bits (60), Expect = 0.74
 Identities = 7/30 (23%), Positives = 13/30 (43%), Gaps = 4/30 (13%)

Query: 32 TIPKGSNEPITVKFANSPSSSNKVIAPLAA 61
          T+PKG  + +  K     +    + AP+  
Sbjct: 37 TLPKGEKKKLKAKV----TLKKPLEAPIKK 62


>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein M (hnRNP M) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of heterogeneous nuclear ribonucleoprotein M
          (hnRNP M), myelin expression factor 2 (MEF-2 or MyEF-2
          or MST156) and similar proteins. hnRNP M is pre-mRNA
          binding protein that may play an important role in the
          pre-mRNA processing. It also preferentially binds to
          poly(G) and poly(U) RNA homopolymers. hnRNP M is able
          to interact with early spliceosomes, further
          influencing splicing patterns of specific pre-mRNAs.
          hnRNP M functions as the receptor of carcinoembryonic
          antigen (CEA) that contains the penta-peptide sequence
          PELPK signaling motif. In addition, hnRNP M and another
          splicing factor Nova-1 work together as dopamine D2
          receptor (D2R) pre-mRNA-binding proteins. They regulate
          alternative splicing of D2R pre-mRNA in an antagonistic
          manner. hnRNP M contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an unusual
          hexapeptide-repeat region rich in methionine and
          arginine residues (MR repeat motif). MEF-2 is a
          sequence-specific single-stranded DNA (ssDNA) binding
          protein that binds specifically to ssDNA derived from
          the proximal (MB1) element of the myelin basic protein
          (MBP) promoter and represses transcription of the MBP
          gene. MEF-2 shows high sequence homology with hnRNP M.
          It also contains three RRMs, which may be responsible
          for its ssDNA binding activity. .
          Length = 72

 Score = 26.5 bits (59), Expect = 0.76
 Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVK 44
          G + F+   +A+RAI+  NG   +G    + V+
Sbjct: 42 GTVLFESPEDAQRAIEMFNGYDLEG--RELEVR 72


>gnl|CDD|240887 cd12441, RRM_Nup53_like, RNA recognition motif in nucleoporin
          Nup53 and similar proteins.  This subfamily corresponds
          to the RRM domain of nucleoporin Nup53, also termed
          mitotic phosphoprotein 44 (MP-44), or nuclear pore
          complex protein Nup53, required for normal cell growth
          and nuclear morphology in vertebrate. It tightly
          associates with the nuclear envelope membrane and the
          nuclear lamina where it interacts with lamin B. It may
          also interact with a group of nucleoporins including
          Nup93, Nup155, and Nup205 and play a role in the
          association of the mitotic checkpoint protein Mad1 with
          the nuclear pore complex (NPC). The family also
          includes Saccharomyces cerevisiae Nup53p, an ortholog
          of vertebrate nucleoporin Nup53. A unique property of
          yeast Nup53p is that it contains an additional
          Kap121p-binding domain and interacts specifically with
          the karyopherin Kap121p, which is involved in the
          assembly of Nup53p into NPCs. Both, vertebrate Nup35
          and yeast Nup53p, contain an atypical RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), a C-terminal
          amphipathic alpha-helix and several FG repeats. This
          family corresponds to the RRM domain which lacks the
          conserved residues that typically bind RNA in canonical
          RRM domains.
          Length = 73

 Score = 26.4 bits (59), Expect = 0.77
 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 1/20 (5%)

Query: 14 IRFDQRIEAERAIQELNGTI 33
          +++  R+EAERA+   NGTI
Sbjct: 41 LKYSSRLEAERALS-KNGTI 59


>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible
          RNA binding protein (CIRBP), RNA binding motif protein
          3 (RBM3) and similar proteins.  This subfamily
          corresponds to the RRM domain of two structurally
          related heterogenous nuclear ribonucleoproteins, CIRBP
          (also termed CIRP or A18 hnRNP) and RBM3 (also termed
          RNPL), both of which belong to a highly conserved cold
          shock proteins family. The cold shock proteins can be
          induced after exposure to a moderate cold-shock and
          other cellular stresses such as UV radiation and
          hypoxia. CIRBP and RBM3 may function in
          posttranscriptional regulation of gene expression by
          binding to different transcripts, thus allowing the
          cell to response rapidly to environmental signals.
          However, the kinetics and degree of cold induction are
          different between CIRBP and RBM3. Tissue distribution
          of their expression is different. CIRBP and RBM3 may be
          differentially regulated under physiological and stress
          conditions and may play distinct roles in cold
          responses of cells. CIRBP, also termed glycine-rich
          RNA-binding protein CIRP, is localized in the nucleus
          and mediates the cold-induced suppression of cell cycle
          progression. CIRBP also binds DNA and possibly serves
          as a chaperone that assists in the folding/unfolding,
          assembly/disassembly and transport of various proteins.
          RBM3 may enhance global protein synthesis and the
          formation of active polysomes while reducing the levels
          of ribonucleoprotein complexes containing microRNAs.
          RBM3 may also serve to prevent the loss of muscle mass
          by its ability to decrease cell death. Furthermore,
          RBM3 may be essential for cell proliferation and
          mitosis. Both, CIRBP and RBM3, contain an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), that
          is involved in RNA binding, and C-terminal glycine-rich
          domain (RGG motif) that probably enhances RNA-binding
          via protein-protein and/or protein-RNA interactions.
          Like CIRBP, RBM3 can also bind to both RNA and DNA via
          its RRM domain. .
          Length = 80

 Score = 26.7 bits (59), Expect = 0.78
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNGT 32
          T   R  GF+ F+   +A+ A+  +NG 
Sbjct: 38 TQRSRGFGFVTFENPDDAKDAMMAMNGK 65


>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in
          heterogeneous nuclear ribonucleoprotein M (hnRNP M) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of heterogeneous nuclear ribonucleoprotein M
          (hnRNP M), myelin expression factor 2 (MEF-2 or MyEF-2
          or MST156) and similar proteins. hnRNP M is pre-mRNA
          binding protein that may play an important role in the
          pre-mRNA processing. It also preferentially binds to
          poly(G) and poly(U) RNA homopolymers. hnRNP M is able
          to interact with early spliceosomes, further
          influencing splicing patterns of specific pre-mRNAs. It
          functions as the receptor of carcinoembryonic antigen
          (CEA) that contains the penta-peptide sequence PELPK
          signaling motif. In addition, hnRNP M and another
          splicing factor Nova-1 work together as dopamine D2
          receptor (D2R) pre-mRNA-binding proteins. They regulate
          alternative splicing of D2R pre-mRNA in an antagonistic
          manner. hnRNP M contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an unusual
          hexapeptide-repeat region rich in methionine and
          arginine residues (MR repeat motif). MEF-2 is a
          sequence-specific single-stranded DNA (ssDNA) binding
          protein that binds specifically to ssDNA derived from
          the proximal (MB1) element of the myelin basic protein
          (MBP) promoter and represses transcription of the MBP
          gene. MEF-2 shows high sequence homology with hnRNP M.
          It also contains three RRMs, which may be responsible
          for its ssDNA binding activity. .
          Length = 74

 Score = 26.6 bits (59), Expect = 0.80
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVK 44
          R +G ++F+  IEA +AI   NG +      P+ VK
Sbjct: 39 RGMGVVQFEHPIEAVQAISMFNGQMLFD--RPMRVK 72


>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene
          single-strand binding proteins (MSSP) family.  This
          subfamily corresponds to the RRM1 of c-myc gene
          single-strand binding proteins (MSSP) family, including
          single-stranded DNA-binding protein MSSP-1 (also termed
          RBMS1 or SCR2) and MSSP-2 (also termed RBMS2 or SCR3).
          All MSSP family members contain two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), both of which are
          responsible for the specific DNA binding activity.
          Both, MSSP-1 and -2, have been identified as protein
          factors binding to a putative DNA replication
          origin/transcriptional enhancer sequence present
          upstream from the human c-myc gene in both single- and
          double-stranded forms. Thus, they have been implied in
          regulating DNA replication, transcription, apoptosis
          induction, and cell-cycle movement, via the interaction
          with c-MYC, the product of protooncogene c-myc.
          Moreover, the family includes a new member termed
          RNA-binding motif, single-stranded-interacting protein
          3 (RBMS3), which is not a transcriptional regulator.
          RBMS3 binds with high affinity to A/U-rich stretches of
          RNA, and to A/T-rich DNA sequences, and functions as a
          regulator of cytoplasmic activity. In addition, a
          putative meiosis-specific RNA-binding protein termed
          sporulation-specific protein 5 (SPO5, or meiotic
          RNA-binding protein 1, or meiotically up-regulated gene
          12 protein), encoded by Schizosaccharomyces pombe
          Spo5/Mug12 gene, is also included in this family. SPO5
          is a novel meiosis I regulator that may function in the
          vicinity of the Mei2 dot. .
          Length = 71

 Score = 26.4 bits (59), Expect = 0.83
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNG 31
          T+ C+  GF+ FD    A +AI+ LNG
Sbjct: 38 TNKCKGYGFVDFDSPEAALKAIEGLNG 64


>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila
          melanogaster Bruno protein and similar proteins.  This
          subgroup corresponds to the RRM3 of Bruno protein, a
          Drosophila RNA recognition motif (RRM)-containing
          protein that plays a central role in regulation of
          Oskar (Osk) expression. It mediates repression by
          binding to regulatory Bruno response elements (BREs) in
          the Osk mRNA 3' UTR. The full-length Bruno protein
          contains three RRMs, two located in the N-terminal half
          of the protein and the third near the C-terminus,
          separated by a linker region. .
          Length = 79

 Score = 26.5 bits (58), Expect = 0.84
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNG 31
          T+  +  GF+ +D    A+ AIQ +NG
Sbjct: 42 TNLSKCFGFVSYDNPDSAQAAIQAMNG 68


>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of
          poly(U)-binding-splicing factor PUF60 and similar
          proteins.  This subgroup corresponds to the RRM3 of
          PUF60, also termed FUSE-binding protein-interacting
          repressor (FBP-interacting repressor or FIR), or
          Ro-binding protein 1 (RoBP1), or Siah-binding protein 1
          (Siah-BP1), an essential splicing factor that functions
          as a poly-U RNA-binding protein required to
          reconstitute splicing in depleted nuclear extracts. Its
          function is enhanced through interaction with U2
          auxiliary factor U2AF65. PUF60 also controls human
          c-myc gene expression by binding and inhibiting the
          transcription factor far upstream sequence element
          (FUSE)-binding-protein (FBP), an activator of c-myc
          promoters. PUF60 contains two central RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          U2AF (U2 auxiliary factor) homology motifs (UHM) that
          harbors another RRM and binds to tryptophan-containing
          linear peptide motifs (UHM ligand motifs, ULMs) in
          several nuclear proteins. The research indicates that
          PUF60 binds FUSE as a dimer, and only the first two RRM
          domains participate in the single-stranded DNA
          recognition. .
          Length = 98

 Score = 26.6 bits (59), Expect = 0.86
 Identities = 11/19 (57%), Positives = 13/19 (68%)

Query: 13 FIRFDQRIEAERAIQELNG 31
          F+ F    EAE+AIQ LNG
Sbjct: 56 FVEFSLPSEAEKAIQALNG 74


>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding
          protein 40 (RBM40) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM40 and the RRM
          of RBM41. RBM40, also known as RNA-binding
          region-containing protein 3 (RNPC3) or U11/U12 small
          nuclear ribonucleoprotein 65 kDa protein (U11/U12-65K
          protein). It serves as a bridging factor between the
          U11 and U12 snRNPs. It contains two RNA recognition
          motifs (RRMs), also known as RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), connected by a
          linker that includes a proline-rich region. It binds to
          the U11-associated 59K protein via its RRM1 and employs
          the RRM2 to bind hairpin III of the U12 small nuclear
          RNA (snRNA). The proline-rich region might be involved
          in protein-protein interactions. RBM41 contains only
          one RRM. Its biological function remains unclear. .
          Length = 82

 Score = 26.4 bits (59), Expect = 0.91
 Identities = 10/34 (29%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 13 FIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          F+ F     A +A+  +NG + KG  +P+ ++F 
Sbjct: 51 FVTFPSEEIATKALNLVNGYVLKG--KPMVIQFG 82


>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split
          end) protein family.  This subfamily corresponds to the
          RRM3 domain in the Spen (split end) protein family
          which includes RNA binding motif protein 15 (RBM15),
          putative RNA binding motif protein 15B (RBM15B) and
          similar proteins found in Metazoa. RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, is a novel mRNA export factor and is a
          novel component of the NXF1 pathway. It binds to NXF1
          and serves as receptor for the RNA export element RTE.
          It also possess mRNA export activity and can facilitate
          the access of DEAD-box protein DBP5 to mRNA at the
          nuclear pore complex (NPC). RNA-binding protein 15B
          (RBM15B), also termed one twenty-two 3 (OTT3), is a
          paralog of RBM15 and therefore has post-transcriptional
          regulatory activity. It is a nuclear protein sharing
          with RBM15 the association with the splicing factor
          compartment and the nuclear envelope as well as the
          binding to mRNA export factors NXF1 and Aly/REF.
          Members in this family belong to the Spen (split end)
          protein family, which shares a domain architecture
          comprising of three N-terminal RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal SPOC (Spen
          paralog and ortholog C-terminal) domain. .
          Length = 72

 Score = 26.0 bits (58), Expect = 0.92
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 13 FIRFDQRIEAERAIQELNGTIPKGSNEPITVKFAN 47
          +I ++    A+ A + L G    G    + V FA+
Sbjct: 38 YIEYESIEAAQAAKEALRGFPLGGPGRRLRVDFAD 72


>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA
          selenocysteine-associated protein 1 (SECp43) and
          similar proteins.  This subfamily corresponds to the
          RRM1 in tRNA selenocysteine-associated protein 1
          (SECp43), yeast negative growth regulatory protein NGR1
          (RBP1), yeast protein NAM8, and similar proteins.
          SECp43 is an RNA-binding protein associated
          specifically with eukaryotic selenocysteine tRNA
          [tRNA(Sec)]. It may play an adaptor role in the
          mechanism of selenocysteine insertion. SECp43 is
          located primarily in the nucleus and contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal polar/acidic region. Yeast
          proteins, NGR1 and NAM8, show high sequence similarity
          with SECp43. NGR1 is a putative glucose-repressible
          protein that binds both RNA and single-stranded DNA
          (ssDNA). It may function in regulating cell growth in
          early log phase, possibly through its participation in
          RNA metabolism. NGR1 contains three RRMs, two of which
          are followed by a glutamine-rich stretch that may be
          involved in transcriptional activity. In addition, NGR1
          has an asparagine-rich region near the C-terminus which
          also harbors a methionine-rich region. NAM8 is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. NAM8
          also contains three RRMs.  .
          Length = 81

 Score = 26.5 bits (59), Expect = 0.94
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%)

Query: 12 GFIRFDQRIEAERAIQELNGT-IPK 35
          GF+ F     AE+A+Q LNG  IP 
Sbjct: 44 GFVEFATHEAAEQALQSLNGKPIPN 68


>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila
          sex-lethal (SXL) and similar proteins.  This subfamily
          corresponds to the RRM1 of SXL which governs sexual
          differentiation and X chromosome dosage compensation in
          Drosophila melanogaster. It induces female-specific
          alternative splicing of the transformer (tra) pre-mRNA
          by binding to the tra uridine-rich polypyrimidine tract
          at the non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 81

 Score = 26.2 bits (58), Expect = 0.95
 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 4/40 (10%)

Query: 12 GFIRFDQRIEAERAIQELNG-TIPKGSNEPITVKFANSPS 50
          GF+ +    +A+RAI+ LNG  +    N+ I V +A    
Sbjct: 45 GFVDYQSAEDAQRAIRTLNGLQL---QNKRIKVAYARPGG 81


>gnl|CDD|241126 cd12682, RRM_RBPMS, RNA recognition motif in vertebrate
          RNA-binding protein with multiple splicing (RBP-MS).
          This subfamily corresponds to the RRM of RBP-MS, also
          termed heart and RRM expressed sequence (hermes), an
          RNA-binding proteins found in various vertebrate
          species. It contains an RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain). RBP-MS physically interacts
          with Smad2, Smad3 and Smad4 and plays a role in
          regulation of Smad-mediated transcriptional activity.
          In addition, RBP-MS may be involved in regulation of
          mRNA translation and localization during Xenopus laevis
          development. .
          Length = 76

 Score = 26.2 bits (57), Expect = 1.0
 Identities = 12/21 (57%), Positives = 14/21 (66%)

Query: 11 LGFIRFDQRIEAERAIQELNG 31
          +GF+ FD R EAE A   LNG
Sbjct: 41 VGFVSFDSRSEAEAAKNALNG 61


>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subgroup corresponds to the
          RRM3 of CELF-3, CELF-4, CELF-5, and CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein.The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          highly expressed throughout the brain and in glandular
          tissues, moderately expressed in heart, skeletal
          muscle, and liver, is also known as bruno-like protein
          4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor 4. Like
          CELF-3, CELF-4 also contains three highly conserved
          RRMs. The splicing activation or repression activity of
          CELF-4 on some specific substrates is mediated by its
          RRM1/RRM2. Both, RRM1 and RRM2 of CELF-4, can activate
          cardiac troponin T (cTNT) exon 5 inclusion. CELF-5,
          expressed in brain, is also known as bruno-like protein
          5 (BRUNOL-5), or CUG-BP- and ETR-3-like factor 5.
          Although its biological role remains unclear, CELF-5
          shares same domain architecture with CELF-3. CELF-6,
          strongly expressed in kidney, brain, and testis, is
          also known as bruno-like protein 6 (BRUNOL-6), or
          CUG-BP- and ETR-3-like factor 6. It activates exon
          inclusion of a cardiac troponin T minigene in transient
          transfection assays in an muscle-specific splicing
          enhancer (MSE)-dependent manner and can activate
          inclusion via multiple copies of a single element,
          MSE2. CELF-6 also promotes skipping of exon 11 of
          insulin receptor, a known target of CELF activity that
          is expressed in kidney. In addition to three highly
          conserved RRMs, CELF-6 also possesses numerous
          potential phosphorylation sites, a potential nuclear
          localization signal (NLS) at the C terminus, and an
          alanine-rich region within the divergent linker region.
          .
          Length = 79

 Score = 26.0 bits (57), Expect = 1.4
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNG 31
          T+  +  GF+ FD    A+ AIQ +NG
Sbjct: 42 TNQSKCFGFVSFDNPASAQAAIQAMNG 68


>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate
          RNA-binding protein 4 (RBM4).  This subgroup
          corresponds to the RRM1 of RBM4, a ubiquitously
          expressed splicing factor that has two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may function as a translational
          regulator of stress-associated mRNAs and also plays a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. The C-terminal region may be crucial for
          nuclear localization and protein-protein interaction.
          The RRMs, in combination with the C-terminal region,
          are responsible for the splicing function of RBM4. .
          Length = 67

 Score = 25.6 bits (56), Expect = 1.4
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 6  DFCRYLGFIRFDQRIEAERAIQELN 30
          D  +  GF+  D +  A+ AI+ L+
Sbjct: 31 DIIKNYGFVHMDDKTAADEAIRNLH 55


>gnl|CDD|222768 PHA00002, A, DNA replication initiation protein gpA.
          Length = 515

 Score = 26.8 bits (59), Expect = 1.4
 Identities = 10/30 (33%), Positives = 15/30 (50%)

Query: 16  FDQRIEAERAIQELNGTIPKGSNEPITVKF 45
           F + +   R I  L  T P G + PI V++
Sbjct: 284 FGRLVRNNRQINSLQNTWPYGYSMPIAVRY 313


>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in
          polypyrimidine tract-binding protein 1 (PTB or hnRNP
          I), heterogeneous nuclear ribonucleoprotein L
          (hnRNP-L), and similar proteins.  This subfamily
          corresponds to the RRM2 of polypyrimidine tract-binding
          protein 1 (PTB or hnRNP I), polypyrimidine
          tract-binding protein 2 (PTBP2 or nPTB), regulator of
          differentiation 1 (Rod1), heterogeneous nuclear
          ribonucleoprotein L (hnRNP-L), heterogeneous nuclear
          ribonucleoprotein L-like (hnRNP-LL), polypyrimidine
          tract-binding protein homolog 3 (PTBPH3),
          polypyrimidine tract-binding protein homolog 1 and 2
          (PTBPH1 and PTBPH2), and similar proteins, and RRM3 of
          PTBPH1 and PTBPH2. PTB is an important negative
          regulator of alternative splicing in mammalian cells
          and also functions at several other aspects of mRNA
          metabolism, including mRNA localization, stabilization,
          polyadenylation, and translation. PTBP2 is highly
          homologous to PTB and is perhaps specific to the
          vertebrates. Unlike PTB, PTBP2 is enriched in the brain
          and in some neural cell lines. It binds more stably to
          the downstream control sequence (DCS) RNA than PTB does
          but is a weaker repressor of splicing in vitro. PTBP2
          also greatly enhances the binding of two other
          proteins, heterogeneous nuclear ribonucleoprotein
          (hnRNP) H and KH-type splicing-regulatory protein
          (KSRP), to the DCS RNA. The binding properties of PTBP2
          and its reduced inhibitory activity on splicing imply
          roles in controlling the assembly of other
          splicing-regulatory proteins. Rod1 is a mammalian
          polypyrimidine tract binding protein (PTB) homolog of a
          regulator of differentiation in the fission yeast
          Schizosaccharomyces pombe, where the nrd1 gene encodes
          an RNA binding protein negatively regulates the onset
          of differentiation. ROD1 is predominantly expressed in
          hematopoietic cells or organs. It might play a role
          controlling differentiation in mammals. hnRNP-L is a
          higher eukaryotic specific subunit of human KMT3a (also
          known as HYPB or hSet2) complex required for histone H3
          Lys-36 trimethylation activity. It plays both, nuclear
          and cytoplasmic, roles in mRNA export of intronless
          genes, IRES-mediated translation, mRNA stability, and
          splicing. hnRNP-LL protein plays a critical and unique
          role in the signal-induced regulation of CD45 and acts
          as a global regulator of alternative splicing in
          activated T cells. This family also includes
          polypyrimidine tract binding protein homolog 3 (PTBPH3)
          found in plant. Although its biological roles remain
          unclear, PTBPH3 shows significant sequence similarity
          to other family members, all of which contain four RNA
          recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain).
          Although their biological roles remain unclear, both
          PTBPH1 and PTBPH2 show significant sequence similarity
          to PTB. However, in contrast to PTB, they have three
          RRMs. .
          Length = 85

 Score = 26.0 bits (58), Expect = 1.4
 Identities = 10/27 (37%), Positives = 13/27 (48%), Gaps = 1/27 (3%)

Query: 13 FIRFDQRIEAERAIQELNGT-IPKGSN 38
           ++FD    AE A + LNG  I  G  
Sbjct: 43 LVQFDSVESAENAKKALNGRNIYDGCC 69


>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor
          3B subunit 4 (SF3B4) and similar proteins.  This
          subfamily corresponds to the RRM2 of SF3B4, also termed
          pre-mRNA-splicing factor SF3b 49 kDa (SF3b50), or
          spliceosome-associated protein 49 (SAP 49). SF3B4 is a
          component of the multiprotein complex splicing factor
          3b (SF3B), an integral part of the U2 small nuclear
          ribonucleoprotein (snRNP) and the U11/U12 di-snRNP.
          SF3B is essential for the accurate excision of introns
          from pre-messenger RNA, and is involved in the
          recognition of the pre-mRNA's branch site within the
          major and minor spliceosomes. SF3B4 functions to tether
          U2 snRNP with pre-mRNA at the branch site during
          spliceosome assembly. It is an evolutionarily highly
          conserved protein with orthologs across diverse
          species. SF3B4 contains two closely adjacent N-terminal
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It binds directly to pre-mRNA and also interacts
          directly and highly specifically with another SF3B
          subunit called SAP 145. .
          Length = 83

 Score = 25.7 bits (57), Expect = 1.5
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          +   FI +D    ++ AI+ +NG      N PITV +A
Sbjct: 44 KGFAFISYDSFEASDAAIEAMNGQYL--CNRPITVSYA 79


>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q
           family.  Sequences in this subfamily include the human
           heterogeneous nuclear ribonucleoproteins (hnRNP) R , Q
           and APOBEC-1 complementation factor (aka APOBEC-1
           stimulating protein). These proteins contain three RNA
           recognition domains (rrm: pfam00076) and a somewhat
           variable C-terminal domain.
          Length = 578

 Score = 26.5 bits (58), Expect = 1.6
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 13  FIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANSP 49
           F+ F+ R +A +A+ ELNG   +GS   I V  A   
Sbjct: 273 FVHFEDREDAVKAMDELNGKELEGS--EIEVTLAKPV 307


>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate
          RNA-binding protein 39 (RBM39) and similar proteins.
          This subfamily corresponds to the RRM3 of RBM39, also
          termed hepatocellular carcinoma protein 1, or
          RNA-binding region-containing protein 2, or splicing
          factor HCC1, ia nuclear autoantigen that contains an
          N-terminal arginine/serine rich (RS) motif and three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          An octapeptide sequence called the RS-ERK motif is
          repeated six times in the RS region of RBM39. Based on
          the specific domain composition, RBM39 has been
          classified into a family of non-snRNP (small nuclear
          ribonucleoprotein) splicing factors that are usually
          not complexed to snRNAs. .
          Length = 85

 Score = 25.6 bits (57), Expect = 1.7
 Identities = 7/19 (36%), Positives = 12/19 (63%)

Query: 13 FIRFDQRIEAERAIQELNG 31
          +++F     A++ IQ LNG
Sbjct: 53 YVKFKTVEAAQKCIQALNG 71


>gnl|CDD|221463 pfam12211, LMWSLP_N, Low molecular weight S layer protein N
          terminal.  This family of proteins is found in
          bacteria. Proteins in this family are typically between
          328 and 381 amino acids in length. There is a conserved
          LGDG sequence motif. Clostridial species have a layer
          of surface proteins surrounding their membrane. This
          layer is comprised of a high molecular weight protein
          and a low molecular weight protein. This domain is the
          N terminal domain of the low molecular weight protein.
          It is a structural domain.
          Length = 253

 Score = 26.2 bits (58), Expect = 1.7
 Identities = 13/47 (27%), Positives = 20/47 (42%)

Query: 23 ERAIQELNGTIPKGSNEPITVKFANSPSSSNKVIAPLAAYLTPQAAA 69
          ++A+++L   I  GS   I V F     S+  V+    A     AA 
Sbjct: 12 KKALKQLQDGIKDGSITSIDVYFDGKVVSTITVVPGSDAADKSAAAD 58


>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate
          heterogeneous nuclear ribonucleoprotein R (hnRNP R).
          This subgroup corresponds to the RRM3 of hnRNP R. a
          ubiquitously expressed nuclear RNA-binding protein that
          specifically bind mRNAs with a preference for poly(U)
          stretches. Upon binding of RNA, hnRNP R forms
          oligomers, most probably dimers. hnRNP R has been
          implicated in mRNA processing and mRNA transport, and
          also acts as a regulator to modify binding to ribosomes
          and RNA translation. hnRNP R is predominantly located
          in axons of motor neurons and to a much lower degree in
          sensory axons. In axons of motor neurons, it also
          functions as a cytosolic protein and interacts with
          wild type of survival motor neuron (SMN) proteins
          directly, further providing a molecular link between
          SMN and the spliceosome. Moreover, hnRNP R plays an
          important role in neural differentiation and
          development, as well as in retinal development and
          light-elicited cellular activities. hnRNP R contains an
          acidic auxiliary N-terminal region, followed by two
          well-defined and one degenerated RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal RGG
          motif; hnRNP R binds RNA through its RRM domains. .
          Length = 72

 Score = 25.4 bits (55), Expect = 1.8
 Identities = 9/20 (45%), Positives = 14/20 (70%)

Query: 12 GFIRFDQRIEAERAIQELNG 31
           F+ F++R  A RA+ E+NG
Sbjct: 38 AFVHFEERDAAVRAMDEMNG 57


>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins
          family.  This subfamily corresponds to the RRM3 of the
          Hu proteins family which represent a group of
          RNA-binding proteins involved in diverse biological
          processes. Since the Hu proteins share high homology
          with the Drosophila embryonic lethal abnormal vision
          (ELAV) protein, the Hu family is sometimes referred to
          as the ELAV family. Drosophila ELAV is exclusively
          expressed in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress. Hu
          proteins perform their cytoplasmic and nuclear
          molecular functions by coordinately regulating
          functionally related mRNAs. In the cytoplasm, Hu
          proteins recognize and bind to AU-rich RNA elements
          (AREs) in the 3' untranslated regions (UTRs) of certain
          target mRNAs, such as GAP-43, vascular epithelial
          growth factor (VEGF), the glucose transporter GLUT1,
          eotaxin and c-fos, and stabilize those ARE-containing
          mRNAs. They also bind and regulate the translation of
          some target mRNAs, such as neurofilament M, GLUT1, and
          p27. In the nucleus, Hu proteins function as regulators
          of polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 78

 Score = 25.4 bits (56), Expect = 1.8
 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 2/41 (4%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKF 45
          T+ C+  GF+      EA  AI  LNG   +     + V F
Sbjct: 39 TNKCKGYGFVTMTNYEEAYSAIASLNGY--RLGGRVLQVSF 77


>gnl|CDD|164919 PHA02458, A, protein A*; Reviewed.
          Length = 341

 Score = 26.4 bits (58), Expect = 1.8
 Identities = 11/36 (30%), Positives = 17/36 (47%)

Query: 16  FDQRIEAERAIQELNGTIPKGSNEPITVKFANSPSS 51
           F + +   R I  L  T P G + PI V+++    S
Sbjct: 110 FGKLVRNNRQINSLQNTWPYGYSMPIAVRYSQDAFS 145


>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM1 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is a ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammals, such
          as ovary and testis. It may play an important role in
          germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 80

 Score = 25.6 bits (57), Expect = 1.9
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKG 36
           ++ F    +AERA+  LN  + KG
Sbjct: 44 AYVNFQNPADAERALDTLNFDVIKG 68


>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate
          RNA-binding protein 47 (RBM47).  This subgroup
          corresponds to the RRM3 of RBM47, a putative
          RNA-binding protein that shows high sequence homology
          with heterogeneous nuclear ribonucleoprotein R (hnRNP
          R) and heterogeneous nuclear ribonucleoprotein Q (hnRNP
          Q). Its biological function remains unclear. Like hnRNP
          R and hnRNP Q, RBM47 contains two well defined and one
          degenerated RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 74

 Score = 25.4 bits (55), Expect = 1.9
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITV 43
          R   F+ F  R +A  A+  LNGT  +GS   +T+
Sbjct: 37 RDYAFVHFTSREDAVHAMNNLNGTELEGSCIEVTL 71


>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate
          RNA-binding protein 47 (RBM47).  This subgroup
          corresponds to the RRM1 of RBM47, a putative
          RNA-binding protein that shows high sequence homology
          with heterogeneous nuclear ribonucleoprotein R (hnRNP
          R) and heterogeneous nuclear ribonucleoprotein Q (hnRNP
          Q). Its biological function remains unclear. Like hnRNP
          R and hnRNP Q, RBM47 contains two well-defined and one
          degenerated RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 78

 Score = 25.3 bits (55), Expect = 2.2
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 1  MKGFTDFCRYLGFIRFDQRIEAERAIQELN 30
          M  F    R   F+ + Q+ EA+RA++ELN
Sbjct: 34 MMDFDGKNRGYAFVMYTQKHEAKRAVRELN 63


>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein
          RBM8A, RBM8B nd similar proteins.  This subfamily
          corresponds to the RRM of RBM8, also termed binder of
          OVCA1-1 (BOV-1), or RNA-binding protein Y14, which is
          one of the components of the exon-exon junction complex
          (EJC). It has two isoforms, RBM8A and RBM8B, both of
          which are identical except that RBM8B is 16 amino acids
          shorter at its N-terminus. RBM8, together with other
          EJC components (such as Magoh, Aly/REF, RNPS1, Srm160,
          and Upf3), plays critical roles in postsplicing
          processing, including nuclear export and cytoplasmic
          localization of the mRNA, and the nonsense-mediated
          mRNA decay (NMD) surveillance process. RBM8 binds to
          mRNA 20-24 nucleotides upstream of a spliced exon-exon
          junction. It is also involved in spliced mRNA nuclear
          export, and the process of nonsense-mediated decay of
          mRNAs with premature stop codons. RBM8 forms a specific
          heterodimer complex with the EJC protein Magoh which
          then associates with Aly/REF, RNPS1, DEK, and SRm160 on
          the spliced mRNA, and inhibits ATP turnover by
          eIF4AIII, thereby trapping the EJC core onto RNA. RBM8
          contains an N-terminal putative bipartite nuclear
          localization signal, one RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), in the central region, and
          a C-terminal serine-arginine rich region (SR domain)
          and glycine-arginine rich region (RG domain). .
          Length = 88

 Score = 25.3 bits (56), Expect = 2.3
 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 13 FIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
           I ++ + EA+ AI+ LNG    G  + I+V +A
Sbjct: 52 LIEYETKKEAQAAIEGLNGKELLG--QTISVDWA 83


>gnl|CDD|240959 cd12515, RRM5_RBM12_like, RNA recognition motif 5 in RNA-binding
          protein RBM12, RBM12B and similar proteins.  This
          subfamily corresponds to the RRM5 of RBM12 and RBM12B.
          RBM12, also termed SH3/WW domain anchor protein in the
          nucleus (SWAN), is ubiquitously expressed. It contains
          five distinct RNA binding motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two proline-rich regions, and several
          putative transmembrane domains. RBM12B show high
          sequence semilarity with RBM12. It contains five
          distinct RRMs as well. The biological roles of both
          RBM12 and RBM12B remain unclear. .
          Length = 75

 Score = 25.1 bits (55), Expect = 2.4
 Identities = 9/18 (50%), Positives = 12/18 (66%)

Query: 14 IRFDQRIEAERAIQELNG 31
          + FD   EA  A++ELNG
Sbjct: 47 VAFDTHREAMAAVRELNG 64


>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate
          RNA-binding protein RBM23, RBM39 and similar proteins. 
          This subfamily corresponds to the RRM2 of RBM39 (also
          termed HCC1), a nuclear autoantigen that contains an
          N-terminal arginine/serine rich (RS) motif and three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          An octapeptide sequence called the RS-ERK motif is
          repeated six times in the RS region of RBM39. Although
          the cellular function of RBM23 remains unclear, it
          shows high sequence homology to RBM39 and contains two
          RRMs. It may possibly function as a pre-mRNA splicing
          factor. .
          Length = 73

 Score = 24.9 bits (55), Expect = 2.5
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNG 31
          T   +  GFI+F    +A++A+++LNG
Sbjct: 36 TGRSKGYGFIQFADAEDAKKALEQLNG 62


>gnl|CDD|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain.  The BRCT domain
          is found predominantly in proteins involved in cell
          cycle checkpoint functions responsive to DNA damage.
          The BRCT domain of XRCC1 forms a homodimer in the
          crystal structure. This suggests that pairs of BRCT
          domains associate as homo- or heterodimers. BRCT
          domains are often found as tandem-repeat pairs.
          Structures of the BRCA1 BRCT domains revealed a basis
          for a widely utilised head-to-tail BRCT-BRCT
          oligomerisation mode. This conserved tandem BRCT
          architecture facilitates formation of the canonical
          BRCT phospho-peptide interaction cleft at a groove
          between the BRCT domains. Disease associated missense
          and nonsense mutations in the BRCA1 BRCT domains
          disrupt peptide binding by directly occluding this
          peptide binding groove, or by disrupting key conserved
          BRCT core folding determinants.
          Length = 77

 Score = 25.0 bits (55), Expect = 2.6
 Identities = 12/66 (18%), Positives = 25/66 (37%), Gaps = 3/66 (4%)

Query: 4  FTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANSPSSSNKV---IAPLA 60
          F      +  +   +R E E  I++L G +    ++  T       + + K+   IA   
Sbjct: 6  FKGKTFVITGLDSLEREELEELIEKLGGKVTDSLSKKTTHVIVGENAGTLKLLKAIALGI 65

Query: 61 AYLTPQ 66
            +T +
Sbjct: 66 PIVTEE 71


>gnl|CDD|241161 cd12717, RRM_ETP1, RNA recognition motif in yeast RING finger
          protein ETP1 and similar proteins.  This subgroup
          corresponds to the RRM of ETP1, also termed BRAP2
          homolog, or ethanol tolerance protein 1, the yeast
          homolog of BRCA1-associated protein (BRAP2) found in
          vertebrates. It may be involved in ethanol and
          salt-induced transcriptional activation of the NHA1
          promoter and heat shock protein genes (HSP12 and
          HSP26), and participate in ethanol-induced turnover of
          the low-affinity hexose transporter Hxt3p. ETP1
          contains an N-terminal RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a C3HC4-type
          ring finger domain and a UBP-type zinc finger. .
          Length = 82

 Score = 25.0 bits (55), Expect = 2.8
 Identities = 7/23 (30%), Positives = 12/23 (52%)

Query: 9  RYLGFIRFDQRIEAERAIQELNG 31
          R +  ++F    +A+R   E NG
Sbjct: 40 RCMVLLKFRDAQDAKRFQSEYNG 62


>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast
          negative growth regulatory protein NGR1, yeast protein
          NAM8 and similar proteins.  This subgroup corresponds
          to the RRM2 of NGR1 and NAM8. NGR1, also termed
          RNA-binding protein RBP1, is a putative
          glucose-repressible protein that binds both, RNA and
          single-stranded DNA (ssDNA), in yeast. It may function
          in regulating cell growth in early log phase, possibly
          through its participation in RNA metabolism. NGR1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a glutamine-rich stretch that may
          be involved in transcriptional activity. In addition,
          NGR1 has an asparagine-rich region near the carboxyl
          terminus which also harbors a methionine-rich region.
          The family also includes protein NAM8, which is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. Like
          NGR1, NAM8 contains two RRMs. .
          Length = 80

 Score = 25.2 bits (55), Expect = 2.9
 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 2/42 (4%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          T   R  GF+RF    + +RA+ E+ G    G   P+ +  A
Sbjct: 40 TGVSRGYGFVRFSDENDQQRALIEMQGVYCGG--RPMRISTA 79


>gnl|CDD|129703 TIGR00616, rect, recombinase, phage RecT family.  All proteins in
          this family for which functions are known bind ssDNA
          and are involved in the the pairing of homologous DNA
          This family is based on the phylogenomic analysis of JA
          Eisen (1999, Ph.D. Thesis, Stanford University). RecT
          and homologs are found in prophage regions of bacterial
          genomes. RecT works with a partner protein, RecE [DNA
          metabolism, DNA replication, recombination, and repair,
          Mobile and extrachromosomal element functions, Prophage
          functions].
          Length = 241

 Score = 25.7 bits (56), Expect = 2.9
 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 6/57 (10%)

Query: 18 QRIEAERAIQELNGTIPKGSNEPITVK-FANSPSSSNKVIAPLAAYLTPQAAAARRF 73
          Q    +  +Q+  G +P    +   VK   +SPS    +I      L P+   A RF
Sbjct: 4  QSPIIKNNLQKKQGNVPPVQVKGADVKGLLSSPS----MIKRFEEVL-PRHKRATRF 55


>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold
          attachment factor (SAFB) family.  This subfamily
          corresponds to the RRM domain of the SAFB family,
          including scaffold attachment factor B1 (SAFB1),
          scaffold attachment factor B2 (SAFB2), SAFB-like
          transcriptional modulator (SLTM), and similar proteins,
          which are ubiquitously expressed. SAFB1, SAFB2 and SLTM
          have been implicated in many diverse cellular processes
          including cell growth and transformation, stress
          response, and apoptosis. They share high sequence
          similarities and all contain a scaffold attachment
          factor-box (SAF-box, also known as SAP domain)
          DNA-binding motif, an RNA recognition motif (RRM), also
          known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a region rich in
          glutamine and arginine residues. SAFB1 is a nuclear
          protein with a distribution similar to that of SLTM,
          but unlike that of SAFB2, which is also found in the
          cytoplasm. To a large extent, SAFB1 and SLTM might
          share similar functions, such as the inhibition of an
          oestrogen reporter gene. The additional cytoplasmic
          localization of SAFB2 implies that it could play
          additional roles in the cytoplasmic compartment which
          are distinct from the nuclear functions shared with
          SAFB1 and SLTM. .
          Length = 74

 Score = 25.0 bits (55), Expect = 3.0
 Identities = 9/24 (37%), Positives = 12/24 (50%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGT 32
          R  GF+      EA + IQ L+ T
Sbjct: 41 RCFGFVTMASVEEAAKCIQHLHRT 64


>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2
          and similar proteins.  This subfamily corresponds to
          the RRM1 of yeast protein gar2, a novel nucleolar
          protein required for 18S rRNA and 40S ribosomal subunit
          accumulation. It shares similar domain architecture
          with nucleolin from vertebrates and NSR1 from
          Saccharomyces cerevisiae. The highly phosphorylated
          N-terminal domain of gar2 is made up of highly acidic
          regions separated from each other by basic sequences,
          and contains multiple phosphorylation sites. The
          central domain of gar2 contains two closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RGG (or GAR) domain of gar2 is
          rich in glycine, arginine and phenylalanine residues. .
          Length = 76

 Score = 24.7 bits (54), Expect = 3.5
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 5  TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          T   R  G++ F+   +A++AI+ ++G    G   PI V F+
Sbjct: 37 TGRSRGFGYVDFESPEDAKKAIEAMDGKELDG--RPINVDFS 76


>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM2 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 68

 Score = 24.4 bits (53), Expect = 3.6
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 13 FIRFDQRIEAERAIQELNGTIPKG 36
          F+  ++  EA  AI+ LNG   KG
Sbjct: 38 FVHMEREEEALAAIEALNGKEVKG 61


>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF
          family.  This subfamily corresponds to the RRM of
          Aly/REF family which includes THO complex subunit 4
          (THOC4, also termed Aly/REF), S6K1 Aly/REF-like target
          (SKAR, also termed PDIP3 or PDIP46) and similar
          proteins. THOC4 is an mRNA transporter protein with a
          well conserved RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). It is involved in RNA transportation from the
          nucleus, and was initially identified as a
          transcription coactivator of LEF-1 and AML-1 for the
          TCRalpha enhancer function. In addition, THOC4
          specifically binds to rhesus (RH) promoter in
          erythroid, and might be a novel transcription cofactor
          for erythroid-specific genes. SKAR shows high sequence
          homology with THOC4 and possesses one RRM as well. SKAR
          is widely expressed and localizes to the nucleus. It
          may be a critical player in the function of S6K1 in
          cell and organism growth control by binding the
          activated, hyperphosphorylated form of S6K1 but not
          S6K2. Furthermore, SKAR functions as a protein partner
          of the p50 subunit of DNA polymerase delta. In
          addition, SKAR may have particular importance in
          pancreatic beta cell size determination and insulin
          secretion. .
          Length = 75

 Score = 24.5 bits (54), Expect = 3.8
 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 12 GFIRFDQRIEAERAIQELNGTIPKGSNEPITVKF 45
            + F++R +AERAI++ NG +  G   P+ V+ 
Sbjct: 44 ADVVFEKREDAERAIKQFNGVLLDGQ--PMQVEL 75


>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin
          expression factor 2 (MEF-2).  This subgroup corresponds
          to the RRM2 of MEF-2, also termed MyEF-2 or MST156, a
          sequence-specific single-stranded DNA (ssDNA) binding
          protein that binds specifically to ssDNA derived from
          the proximal (MB1) element of the myelin basic protein
          (MBP) promoter and represses transcription of the MBP
          gene. MEF-2 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), which may be responsible
          for its ssDNA binding activity. .
          Length = 76

 Score = 24.6 bits (53), Expect = 3.9
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 9  RYLGFIRFDQRIEAERAIQELNG 31
          R +G + F+Q IEA +AI   NG
Sbjct: 41 RGMGTVTFEQPIEAVQAISMFNG 63


>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate
          serine/arginine-rich splicing factor 6 (SRSF6).  This
          subfamily corresponds to the RRM1 of SRSF6, also termed
          pre-mRNA-splicing factor SRp55, which is an essential
          splicing regulatory serine/arginine (SR) protein that
          preferentially interacts with a number of purine-rich
          splicing enhancers (ESEs) to activate splicing of the
          ESE-containing exon. It is the only protein from HeLa
          nuclear extract or purified SR proteins that
          specifically binds B element RNA after UV irradiation.
          SRSF6 may also recognize different types of RNA sites.
          For instance, it does not bind to the purine-rich
          sequence in the calcitonin-specific ESE, but binds to a
          region adjacent to the purine tract. Moreover, cellular
          levels of SRSF6 may control tissue-specific alternative
          splicing of the calcitonin/ calcitonin gene-related
          peptide (CGRP) pre-mRNA. SRSF6 contains two N-terminal
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a C-terminal SR domains rich in
          serine-arginine dipeptides. .
          Length = 70

 Score = 24.5 bits (53), Expect = 4.1
 Identities = 9/20 (45%), Positives = 14/20 (70%)

Query: 12 GFIRFDQRIEAERAIQELNG 31
          GF+ F+   +A+ A+ ELNG
Sbjct: 36 GFVEFEDSRDADDAVYELNG 55


>gnl|CDD|225205 COG2323, COG2323, Predicted membrane protein [Function unknown].
          Length = 224

 Score = 25.3 bits (56), Expect = 4.1
 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 3/30 (10%)

Query: 21  EAERAIQELNGTI---PKGSNEPITVKFAN 47
           + E AI E NG +    K   +P+T K  N
Sbjct: 132 DVEFAILETNGQLSVIKKEEKQPVTPKDLN 161


>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein
          with serine-rich domain 1 (RNPS1) and similar proteins.
           This subfamily corresponds to the RRM of RNPS1 and its
          eukaryotic homologs. RNPS1, also termed RNA-binding
          protein prevalent during the S phase, or SR-related
          protein LDC2, was originally characterized as a general
          pre-mRNA splicing activator, which activates both
          constitutive and alternative splicing of pre-mRNA in
          vitro.It has been identified as a protein component of
          the splicing-dependent mRNP complex, or exon-exon
          junction complex (EJC), and is directly involved in
          mRNA surveillance. Furthermore, RNPS1 is a splicing
          regulator whose activator function is controlled in
          part by CK2 (casein kinase II) protein kinase
          phosphorylation. It can also function as a
          squamous-cell carcinoma antigen recognized by T cells-3
          (SART3)-binding protein, and is involved in the
          regulation of mRNA splicing. RNPS1 contains an
          N-terminal serine-rich (S) domain, a central RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and the
          C-terminal arginine/serine/proline-rich (RS/P) domain.
          .
          Length = 73

 Score = 24.4 bits (54), Expect = 4.3
 Identities = 6/20 (30%), Positives = 14/20 (70%)

Query: 12 GFIRFDQRIEAERAIQELNG 31
           ++ F+   +AE+AI+ ++G
Sbjct: 43 AYVEFESPEDAEKAIKHMDG 62


>gnl|CDD|240733 cd12287, RRM_U2AF35_like, RNA recognition motif in U2 small
          nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa
          subunit (U2AF35) and similar proteins.  This subfamily
          corresponds to the RRM in U2 small nuclear
          ribonucleoprotein (snRNP) auxiliary factor (U2AF) which
          has been implicated in the recruitment of U2 snRNP to
          pre-mRNAs. It is a highly conserved heterodimer
          composed of large and small subunits; this family
          includes the small subunit of U2AF (U2AF35 or U2AF1)
          and U2AF 35 kDa subunit B (U2AF35B or C3H60). U2AF35
          directly binds to the 3' splice site of the conserved
          AG dinucleotide and performs multiple functions in the
          splicing process in a substrate-specific manner. It
          promotes U2 snRNP binding to the branch-point sequences
          of introns through association with the large subunit
          of U2AF (U2AF65 or U2AF2). Although the biological role
          of U2AF35B remains unclear, it shows high sequence
          homolgy to U2AF35, which contains two N-terminal zinc
          fingers, a central RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal
          arginine/serine (SR) -rich segment interrupted by
          glycines. In contrast to U2AF35, U2AF35B has a
          plant-specific conserved C-terminal region containing
          SERE motif(s), which may have an important function
          specific to higher plants. .
          Length = 102

 Score = 24.9 bits (55), Expect = 4.3
 Identities = 8/19 (42%), Positives = 14/19 (73%)

Query: 13 FIRFDQRIEAERAIQELNG 31
          +++F+   +AE A+Q LNG
Sbjct: 70 YVKFETEEDAEAALQALNG 88


>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in
          serine/arginine-rich splicing factor SRSF2, SRSF8 and
          similar proteins.  This subfamily corresponds to the
          RRM of SRSF2 and SRSF8. SRSF2, also termed protein
          PR264, or splicing component, 35 kDa (splicing factor
          SC35 or SC-35), is a prototypical SR protein that plays
          important roles in the alternative splicing of
          pre-mRNA. It is also involved in transcription
          elongation by directly or indirectly mediating the
          recruitment of elongation factors to the C-terminal
          domain of polymerase II. SRSF2 is exclusively localized
          in the nucleus and is restricted to nuclear processes.
          It contains a single N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a C-terminal RS
          domain rich in serine-arginine dipeptides. The RRM is
          responsible for the specific recognition of 5'-SSNG-3'
          (S=C/G) RNA. In the regulation of alternative splicing
          events, it specifically binds to cis-regulatory
          elements on the pre-mRNA. The RS domain modulates SRSF2
          activity through phosphorylation, directly contacts
          RNA, and promotes protein-protein interactions with the
          spliceosome. SRSF8, also termed SRP46 or SFRS2B, is a
          novel mammalian SR splicing factor encoded by a
          PR264/SC35 functional retropseudogene. SRSF8 is
          localized in the nucleus and does not display the same
          activity as PR264/SC35. It functions as an essential
          splicing factor in complementing a HeLa cell S100
          extract deficient in SR proteins. Like SRSF2, SRSF8
          contains a single N-terminal RRM and a C-terminal RS
          domain. .
          Length = 73

 Score = 24.6 bits (54), Expect = 4.4
 Identities = 10/33 (30%), Positives = 17/33 (51%)

Query: 4  FTDFCRYLGFIRFDQRIEAERAIQELNGTIPKG 36
          +T   R   F+RF  + +AE A+  ++G    G
Sbjct: 35 YTRESRGFAFVRFYDKRDAEDAMDAMDGKELDG 67


>gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional.
          Length = 249

 Score = 25.0 bits (55), Expect = 4.7
 Identities = 9/17 (52%), Positives = 11/17 (64%)

Query: 54  KVIAPLAAYLTPQAAAA 70
           K + P   YL P+AAAA
Sbjct: 222 KPLNPGGTYLDPEAAAA 238


>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large
          nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa
          subunit (U2AF65) and similar proteins.  This subfamily
          corresponds to the RRM3 of U2AF65 and dU2AF50. U2AF65,
          also termed U2AF2, is the large subunit of U2 small
          nuclear ribonucleoprotein (snRNP) auxiliary factor
          (U2AF), which has been implicated in the recruitment of
          U2 snRNP to pre-mRNAs and is a highly conserved
          heterodimer composed of large and small subunits.
          U2AF65 specifically recognizes the intron
          polypyrimidine tract upstream of the 3' splice site and
          promotes binding of U2 snRNP to the pre-mRNA
          branchpoint. U2AF65 also plays an important role in the
          nuclear export of mRNA. It facilitates the formation of
          a messenger ribonucleoprotein export complex,
          containing both the NXF1 receptor and the RNA
          substrate. Moreover, U2AF65 interacts directly and
          specifically with expanded CAG RNA, and serves as an
          adaptor to link expanded CAG RNA to NXF1 for RNA
          export. U2AF65 contains an N-terminal RS domain rich in
          arginine and serine, followed by a proline-rich segment
          and three C-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The N-terminal RS domain
          stabilizes the interaction of U2 snRNP with the branch
          point (BP) by contacting the branch region, and further
          promotes base pair interactions between U2 snRNA and
          the BP. The proline-rich segment mediates
          protein-protein interactions with the RRM domain of the
          small U2AF subunit (U2AF35 or U2AF1). The RRM1 and RRM2
          are sufficient for specific RNA binding, while RRM3 is
          responsible for protein-protein interactions. The
          family also includes Splicing factor U2AF 50 kDa
          subunit (dU2AF50), the Drosophila ortholog of U2AF65.
          dU2AF50 functions as an essential pre-mRNA splicing
          factor in flies. It associates with intronless mRNAs
          and plays a significant and unexpected role in the
          nuclear export of a large number of intronless mRNAs.
          Length = 89

 Score = 24.4 bits (54), Expect = 4.8
 Identities = 6/19 (31%), Positives = 10/19 (52%)

Query: 13 FIRFDQRIEAERAIQELNG 31
          F+ F    +A++A   L G
Sbjct: 60 FVEFADVEDAQKAQLALAG 78


>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein
          PTB-binding raver-1, raver-2 and similar proteins.
          This subfamily corresponds to the RRM3 of raver-1 and
          raver-2. Raver-1 is a ubiquitously expressed
          heterogeneous nuclear ribonucleoprotein (hnRNP) that
          serves as a co-repressor of the nucleoplasmic splicing
          repressor polypyrimidine tract-binding protein
          (PTB)-directed splicing of select mRNAs. It shuttles
          between the cytoplasm and the nucleus and can
          accumulate in the perinucleolar compartment, a dynamic
          nuclear substructure that harbors PTB. Raver-1 also
          modulates focal adhesion assembly by binding to the
          cytoskeletal proteins, including alpha-actinin,
          vinculin, and metavinculin (an alternatively spliced
          isoform of vinculin) at adhesion complexes,
          particularly in differentiated muscle tissue. Raver-2
          is a novel member of the heterogeneous nuclear
          ribonucleoprotein (hnRNP) family. It shows high
          sequence homology to raver-1. Raver-2 exerts a
          spatio-temporal expression pattern during embryogenesis
          and is mainly limited to differentiated neurons and
          glia cells. Although it displays nucleo-cytoplasmic
          shuttling in heterokaryons, raver2 localizes to the
          nucleus in glia cells and neurons. Raver-2 can interact
          with PTB and may participate in PTB-mediated
          RNA-processing. However, there is no evidence
          indicating that raver-2 can bind to cytoplasmic
          proteins. Both, raver-1 and raver-2, contain three
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two putative nuclear localization signals
          (NLS) at the N- and C-termini, a central leucine-rich
          region, and a C-terminal region harboring two
          [SG][IL]LGxxP motifs. They binds to RNA through the
          RRMs. In addition, the two [SG][IL]LGxxP motifs serve
          as the PTB-binding motifs in raver1. However, raver-2
          interacts with PTB through the SLLGEPP motif only. .
          Length = 92

 Score = 24.5 bits (54), Expect = 5.3
 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 2/52 (3%)

Query: 8  CRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANSPSSSNKVIAPL 59
           R   F+ +    +AE A Q LNG   +GS  PI V F N       ++  L
Sbjct: 43 PRGFAFVEYATAEDAEEAQQALNGHSLQGS--PIRVSFGNPGRPGASLLNAL 92


>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease
           protein; Provisional.
          Length = 648

 Score = 25.1 bits (55), Expect = 5.5
 Identities = 13/60 (21%), Positives = 21/60 (35%), Gaps = 11/60 (18%)

Query: 21  EAERAIQELNGTIPKGSNEPITVKFANSPSSSNKVIAPLAAYLTPQAAAARRFGGPIHHA 80
           +AER I+  +G I             N P+     +A     +   A+  R+F      A
Sbjct: 209 QAERVIEIRDGEI-----------VRNPPAQEKVNVAGGTEPVVNTASGWRQFVSGFREA 257


>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4;
           Provisional.
          Length = 144

 Score = 24.6 bits (53), Expect = 5.8
 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%)

Query: 9   RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFANSPSSSNKVIAPLAAY 62
           R  GF+ F+    A  AI E++G    G +  I V  AN   S+ +       Y
Sbjct: 76  RGFGFVNFNDEGAATAAISEMDGKELNGRH--IRVNPANDRPSAPRAYGGGGGY 127


>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein
          homolog TRA2-alpha, TRA2-beta and similar proteins.
          This subfamily corresponds to the RRM of two mammalian
          homologs of Drosophila transformer-2 (Tra2),
          TRA2-alpha, TRA2-beta (also termed SFRS10), and similar
          proteins found in eukaryotes. TRA2-alpha is a 40-kDa
          serine/arginine-rich (SR) protein that specifically
          binds to gonadotropin-releasing hormone (GnRH) exonic
          splicing enhancer on exon 4 (ESE4) and is necessary for
          enhanced GnRH pre-mRNA splicing. It strongly stimulates
          GnRH intron A excision in a dose-dependent manner. In
          addition, TRA2-alpha can interact with either 9G8 or
          SRp30c, which may also be crucial for ESE-dependent
          GnRH pre-mRNA splicing. TRA2-beta is a
          serine/arginine-rich (SR) protein that controls the
          pre-mRNA alternative splicing of the
          calcitonin/calcitonin gene-related peptide (CGRP), the
          survival motor neuron 1 (SMN1) protein and the tau
          protein. Both, TRA2-alpha and TRA2-beta, contains a
          well conserved RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), flanked by the N- and C-terminal
          arginine/serine (RS)-rich regions. .
          Length = 78

 Score = 24.1 bits (53), Expect = 5.8
 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 7/30 (23%)

Query: 2  KGFTDFCRYLGFIRFDQRIEAERAIQELNG 31
          +GF       GF+ F+   +A+ A + LNG
Sbjct: 41 RGF-------GFVYFESVEDAKEAKERLNG 63


>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate
          APOBEC-1 complementation factor (ACF).  This subgroup
          corresponds to the RRM1 of ACF, also termed
          APOBEC-1-stimulating protein, an RNA-binding subunit of
          a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone, and play a
          key role in cell growth and differentiation. ACF
          shuttles between the cytoplasm and nucleus. It contains
          three RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which display high affinity for an 11
          nucleotide AU-rich mooring sequence 3' of the edited
          cytidine in apoB mRNA. All three RRMs may be required
          for complementation of editing activity in living
          cells. RRM2/3 are implicated in ACF interaction with
          APOBEC-1. .
          Length = 78

 Score = 24.2 bits (52), Expect = 5.9
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 1  MKGFTDFCRYLGFIRFDQRIEAERAIQELN 30
          M  F    R   F+ F  + EA+ AI++LN
Sbjct: 34 MMDFNGNNRGYAFVTFSNKQEAKNAIKQLN 63


>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family.  This model
           represents a subfamily of RNA splicing factors including
           the Pad-1 protein (N. crassa), CAPER (M. musculus) and
           CC1.3 (H.sapiens). These proteins are characterized by
           an N-terminal arginine-rich, low complexity domain
           followed by three (or in the case of 4 H. sapiens
           paralogs, two) RNA recognition domains (rrm: pfam00706).
           These splicing factors are closely related to the U2AF
           splicing factor family (TIGR01642). A homologous gene
           from Plasmodium falciparum was identified in the course
           of the analysis of that genome at TIGR and was included
           in the seed.
          Length = 457

 Score = 24.9 bits (54), Expect = 6.0
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%)

Query: 5   TDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFAN 47
           T   +  GFI+F    EA+ A++ +NG    G   PI V +A 
Sbjct: 224 TGRSKGFGFIQFHDAEEAKEALEVMNGFELAG--RPIKVGYAQ 264


>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of
          rDNA transcription protein 5 (RRT5) and similar
          proteins.  This subfamily corresponds to the RRM1 of
          the lineage specific family containing a group of
          uncharacterized yeast regulators of rDNA transcription
          protein 5 (RRT5), which may play roles in the
          modulation of rDNA transcription. RRT5 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 84

 Score = 24.3 bits (53), Expect = 6.0
 Identities = 9/34 (26%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 11 LGFIRFDQRIEAERAIQELNGTIPKGSNEPITVK 44
          + +  F    +AE+ +++LNG + K     + VK
Sbjct: 48 IAYAEFSSPEQAEKVVKDLNGKVFKNRK--LFVK 79


>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). MRD1
          is essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. It contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 76

 Score = 24.1 bits (53), Expect = 6.5
 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFA 46
          R  GF+ F    +A++A++  N T    S   I+V+ A
Sbjct: 41 RRFGFVGFKSEEDAQQAVKYFNKTFIDTSK--ISVELA 76


>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb).
          This subgroup corresponds to the RRM1 of p54nrb, also
          termed non-POU domain-containing octamer-binding
          protein (NonO), or 55 kDa nuclear protein (NMT55), or
          DNA-binding p52/p100 complex 52 kDa subunit. p54nrb is
          a multifunctional protein involved in numerous nuclear
          processes including transcriptional regulation,
          splicing, DNA unwinding, nuclear retention of
          hyperedited double-stranded RNA, viral RNA processing,
          control of cell proliferation, and circadian rhythm
          maintenance. It is ubiquitously expressed and highly
          conserved in vertebrates. p54nrb binds both, single-
          and double-stranded RNA and DNA, and also possesses
          inherent carbonic anhydrase activity. It forms a
          heterodimer with paraspeckle component 1 (PSPC1 or
          PSP1), localizing to paraspeckles in an RNA-dependent
          manneras well as with polypyrimidine tract-binding
          protein-associated-splicing factor (PSF). p54nrb
          contains two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 23.7 bits (51), Expect = 7.2
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 9  RYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKF 45
          +  GFIR + R  AE A  EL+    +G    + V+F
Sbjct: 37 KGFGFIRLETRTLAEIAKAELDNMPLRGKQ--LRVRF 71


>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 78

 Score = 24.1 bits (53), Expect = 7.2
 Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 6/41 (14%)

Query: 7  FCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKFAN 47
          FC    +++F     A  A+  LNG + +G    + VK ++
Sbjct: 43 FC----YVQFTSPESAAAAVALLNGKLGEGYK--LVVKISD 77


>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic
          translation initiation factor 3 subunit B (eIF-3B) and
          similar proteins.  This subfamily corresponds to the
          RRM domain in eukaryotic translation initiation factor
          3 (eIF-3), a large multisubunit complex that plays a
          central role in the initiation of translation by
          binding to the 40 S ribosomal subunit and promoting the
          binding of methionyl-tRNAi and mRNA. eIF-3B, also
          termed eIF-3 subunit 9, or Prt1 homolog, eIF-3-eta,
          eIF-3 p110, or eIF-3 p116, is the major scaffolding
          subunit of eIF-3. It interacts with eIF-3 subunits A,
          G, I, and J. eIF-3B contains an N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), which is
          involved in the interaction with eIF-3J. The
          interaction between eIF-3B and eIF-3J is crucial for
          the eIF-3 recruitment to the 40 S ribosomal subunit.
          eIF-3B also binds directly to domain III of the
          internal ribosome-entry site (IRES) element of
          hepatitis-C virus (HCV) RNA through its N-terminal RRM,
          which may play a critical role in both cap-dependent
          and cap-independent translation. Additional research
          has shown that eIF-3B may function as an oncogene in
          glioma cells and can be served as a potential
          therapeutic target for anti-glioma therapy. This family
          also includes the yeast homolog of eIF-3 subunit B
          (eIF-3B, also termed PRT1 or eIF-3 p90) that interacts
          with the yeast homologs of eIF-3 subunits A(TIF32),
          G(TIF35), I(TIF34), J(HCR1), and E(Pci8). In yeast,
          eIF-3B (PRT1) contains an N-terminal RRM that is
          directly involved in the interaction with eIF-3A
          (TIF32) and eIF-3J (HCR1). In contrast to its human
          homolog, yeast eIF-3B (PRT1) may have potential to bind
          its total RNA through its RRM domain. .
          Length = 84

 Score = 24.1 bits (53), Expect = 7.3
 Identities = 8/19 (42%), Positives = 12/19 (63%)

Query: 13 FIRFDQRIEAERAIQELNG 31
          F+ F    EA+ A++ LNG
Sbjct: 54 FVEFATPEEAKEAVKALNG 72


>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate
          RNA-binding motif, single-stranded-interacting protein
          3 (RBMS3).  This subgroup corresponds to the RRM2 of
          RBMS3, a new member of the c-myc gene single-strand
          binding proteins (MSSP) family of DNA regulators.
          Unlike other MSSP proteins, RBMS3 is not a
          transcriptional regulator. It binds with high affinity
          to A/U-rich stretches of RNA, and to A/T-rich DNA
          sequences, and functions as a regulator of cytoplasmic
          activity. RBMS3 contain two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and its C-terminal
          region is acidic and enriched in prolines, glutamines
          and threonines. .
          Length = 88

 Score = 24.3 bits (52), Expect = 7.3
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 6/45 (13%)

Query: 9  RYLGFIRFDQRIEAERAIQELNG---TIPKG---SNEPITVKFAN 47
          R +GF R +   + E  IQ  NG     P G     EP+  KFA+
Sbjct: 42 RGVGFARMESTEKCEVVIQHFNGKYLKTPPGVPAPTEPLLCKFAD 86


>gnl|CDD|234941 PRK01315, PRK01315, putative inner membrane protein translocase
           component YidC; Provisional.
          Length = 329

 Score = 24.7 bits (54), Expect = 7.6
 Identities = 20/71 (28%), Positives = 28/71 (39%), Gaps = 15/71 (21%)

Query: 23  ERAIQEL------NGTIPKGSNEPITVK----FA-----NSPSSSNKVIAPLAAYLTPQA 67
           ER  QE+       GT P  S  P+ ++    FA     +S +S    I P+   L    
Sbjct: 90  ERMSQEMMKLYKETGTNPLSSCLPLLLQMPIFFALYRVLDSAASRGDGIGPINPPLLESF 149

Query: 68  AAARRFGGPIH 78
             A  FG P+ 
Sbjct: 150 RHAHIFGAPLA 160


>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate
          polypyrimidine tract-binding protein
          (PTB)-associated-splicing factor (PSF).  This subgroup
          corresponds to the RRM1 of PSF, also termed proline-
          and glutamine-rich splicing factor, or 100 kDa
          DNA-pairing protein (POMp100), or 100 kDa subunit of
          DNA-binding p52/p100 complex, a multifunctional protein
          that mediates diverse activities in the cell. It is
          ubiquitously expressed and highly conserved in
          vertebrates. PSF binds not only RNA but also both
          single-stranded DNA (ssDNA) and double-stranded DNA
          (dsDNA) and facilitates the renaturation of
          complementary ssDNAs. Besides, it promotes the
          formation of D-loops in superhelical duplex DNA, and is
          involved in cell proliferation. PSF can also interact
          with multiple factors. It is an RNA-binding component
          of spliceosomes and binds to insulin-like growth factor
          response element (IGFRE). PSF functions as a
          transcriptional repressor interacting with Sin3A and
          mediating silencing through the recruitment of histone
          deacetylases (HDACs) to the DNA binding domain (DBD) of
          nuclear hormone receptors. Additionally, PSF is an
          essential pre-mRNA splicing factor and is dissociated
          from PTB and binds to U1-70K and serine-arginine (SR)
          proteins during apoptosis. PSF forms a heterodimer with
          the nuclear protein p54nrb, also known as non-POU
          domain-containing octamer-binding protein (NonO). The
          PSF/p54nrb complex displays a variety of functions,
          such as DNA recombination and RNA synthesis,
          processing, and transport. PSF contains two conserved
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          which are responsible for interactions with RNA and for
          the localization of the protein in speckles. It also
          contains an N-terminal region rich in proline, glycine,
          and glutamine residues, which may play a role in
          interactions recruiting other molecules. .
          Length = 71

 Score = 23.7 bits (51), Expect = 8.3
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 4  FTDFCRYLGFIRFDQRIEAERAIQELNGTIPKGSNEPITVKF 45
          F +  +  GFI+ + R  AE A  EL+ T  +G    + V+F
Sbjct: 32 FINKGKGFGFIKLESRALAEIAKAELDDTPMRG--RQLRVRF 71


>gnl|CDD|226090 COG3560, FMR2, Predicted oxidoreductase related to nitroreductase
          [General function prediction only].
          Length = 200

 Score = 24.3 bits (53), Expect = 8.9
 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 3/41 (7%)

Query: 16 FDQRIEAERAIQELNGTIPKGSNEPI-TVKFA--NSPSSSN 53
          F   IE  R I  L   +P    E    VK A  ++PS+ N
Sbjct: 6  FLNAIENRRTIYALKKNLPVSDEEIKEIVKEAVKHTPSAFN 46


>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and
           metabolism].
          Length = 917

 Score = 24.2 bits (53), Expect = 9.7
 Identities = 6/24 (25%), Positives = 10/24 (41%)

Query: 11  LGFIRFDQRIEAERAIQELNGTIP 34
              + F Q   AE+A++ L     
Sbjct: 116 NALLGFVQEYRAEKALEALKKMSS 139


>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in
          eukaryotic RNA-binding protein RBM24, RBM38 and similar
          proteins.  This subfamily corresponds to the RRM of
          RBM24 and RBM38 from vertebrate, SUPpressor family
          member SUP-12 from Caenorhabditis elegans and similar
          proteins. Both, RBM24 and RBM38, are preferentially
          expressed in cardiac and skeletal muscle tissues. They
          regulate myogenic differentiation by controlling the
          cell cycle in a p21-dependent or -independent manner.
          RBM24, also termed RNA-binding region-containing
          protein 6, interacts with the 3'-untranslated region
          (UTR) of myogenin mRNA and regulates its stability in
          C2C12 cells. RBM38, also termed CLL-associated antigen
          KW-5, or HSRNASEB, or RNA-binding region-containing
          protein 1(RNPC1), or ssDNA-binding protein SEB4, is a
          direct target of the p53 family. It is required for
          maintaining the stability of the basal and
          stress-induced p21 mRNA by binding to their 3'-UTRs. It
          also binds the AU-/U-rich elements in p63 3'-UTR and
          regulates p63 mRNA stability and activity. SUP-12 is a
          novel tissue-specific splicing factor that controls
          muscle-specific splicing of the ADF/cofilin pre-mRNA in
          C. elegans. All family members contain a conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 76

 Score = 23.3 bits (51), Expect = 9.8
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 12 GFIRFDQRIEAERAIQELNGTI 33
          GF+ F  +  AERA ++ N  I
Sbjct: 45 GFVTFKDKESAERACKDPNPII 66


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.323    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0783    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,430,286
Number of extensions: 343143
Number of successful extensions: 557
Number of sequences better than 10.0: 1
Number of HSP's gapped: 556
Number of HSP's successfully gapped: 138
Length of query: 83
Length of database: 10,937,602
Length adjustment: 52
Effective length of query: 31
Effective length of database: 8,631,194
Effective search space: 267567014
Effective search space used: 267567014
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.1 bits)