Diaphorina citri psyllid: psy6357

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-----

MRPAICNNGVRSLLCKISGQGGGGGGGRGDYRGGKREFDRQSGSDRTSTRKDTHHSDSGDAKERRYNGEARSYQGNRDREPREYREPREFREPREFREPREYREPREPRGEDGDRYRGGLGGSRPPRGRGGRGGRGGYCGGKARIRTASLDRRPNVSGGNPANDISGDWGDQNAKLSDSVTNNESNPEKAESVPGADQPTTEADEAAKEITLDEWKASRGTKLLKPQYNLRKAGEGEDLSQWEGMYELKKKKEEAAAAQLIEELSKVAIKIIDKKRLDERNLRKLFREVDIMSHLDHPHIIKLFQVMETTNNLYLVTEYARGGEIFSHLLTIGQMAEKEASRLFRQILSAVAYCHANNVVHRDIKAENLLFDENGDIKLADFGFSNYFTPGHMLTTWCGSPPYAAPELFGGREYDGTKSDVWSLGVVLYVMVTAQLPFDGPNLAVLKQRILFGKFRIPFYMSAECENLIRSMLVLDPAKRLTLTQISNHKWMSVHCPGDPVIVNPVPSEPKLPNSFVIDQMLQLPALTRNRILEFDDNLMETEICVSPTPQTSVTATRRHTVGPGDESHSQVLDAHSLQHYTNHLNIPQLPNANLLFNLPLVQYQHPQNFIIHDQYLLKPPPVMGACFNRENCNY

cccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHccccccccccccccccccccccccccEEcEEEEEEEEEEEEEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHHHHcccccccccEEEEEEcccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEECccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHccCEcccccccHHHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*******NGVRSLLCK************************************************************************************************************************************************************************************************************************************MYELKKKKEEAAAAQLIEELSKVAIKIIDKKRLDERNLRKLFREVDIMSHLDHPHIIKLFQVMETTNNLYLVTEYARGGEIFSHLLTIGQMAEKEASRLFRQILSAVAYCHANNVVHRDIKAENLLFDENGDIKLADFGFSNYFTPGHMLTTWCGSPPYAAPELFGGREYDGTKSDVWSLGVVLYVMVTAQLPFDGPNLAVLKQRILFGKFRIPFYMSAECENLIRSMLVLDPAKRLTLTQISNHKWMSVHCPGDPVIVNPVPSEPKLPNSFVIDQMLQLPALTRNRILEFDDNLMETEICVSPTPQTS*****************************************LLFNLPLVQYQHPQNFIIHDQYLLKPPPVMGACFNR*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022607 [BP]	cellular component assembly	probable	GO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008286 [BP]	insulin receptor signaling pathway	probable	GO:0042221, GO:0007169, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0032869, GO:0032868, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:1901698, GO:0071417, GO:0071310, GO:0065007, GO:0071495, GO:0044700, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0010243, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0050896
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0031594 [CC]	neuromuscular junction	probable	GO:0005575, GO:0045202
GO:0045172 [CC]	germline ring canal	probable	GO:0005575, GO:0005576, GO:0045171, GO:0044421
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0031667 [BP]	response to nutrient levels	probable	GO:0009991, GO:0008150, GO:0050896, GO:0009605
GO:0007243 [BP]	intracellular protein kinase cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0051239 [BP]	regulation of multicellular organismal process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0061174 [CC]	type I terminal bouton	probable	GO:0044306, GO:0043195, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0050321 [MF]	tau-protein kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0043015 [MF]	gamma-tubulin binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0009894 [BP]	regulation of catabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0048519 [BP]	negative regulation of biological process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0004674 [MF]	protein serine/threonine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0046626 [BP]	regulation of insulin receptor signaling pathway	probable	GO:0009966, GO:1900076, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0006950 [BP]	response to stress	probable	GO:0050896, GO:0008150
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0010604 [BP]	positive regulation of macromolecule metabolic process	probable	GO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0051179 [BP]	localization	probable	GO:0008150
GO:0080090 [BP]	regulation of primary metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0000226 [BP]	microtubule cytoskeleton organization	probable	GO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0045169 [CC]	fusome	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000287 [MF]	magnesium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0071822 [BP]	protein complex subunit organization	probable	GO:0043933, GO:0008150, GO:0071840, GO:0016043
GO:0048699 [BP]	generation of neurons	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FE3, chain A
Confidence level:very confident
Coverage over the Query: 221-247,262-497
View the alignment between query and template
View the model in PyMOL

Template: 3H4J, chain B
Confidence level:very confident
Coverage over the Query: 221-247,262-533
View the alignment between query and template
View the model in PyMOL

Template: 3TKU, chain A
Confidence level:confident
Coverage over the Query: 268-518,555-578
View the alignment between query and template
View the model in PyMOL

Template: 3LVP, chain A
Confidence level:probable
Coverage over the Query: 212-440
View the alignment between query and template
View the model in PyMOL