Psyllid ID: psy6359


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
MKLIEHPHGEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLRGMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAISNLGCFKQKDLLIQELLNNQYLILEHVSGGELFDYLVKKGRLTPKEARNHRDLKPENLLLDEKTNIKIADFGMASLQPNGSNGGGYSYSPQTSPEMSKKYWFGQLVVTDKEETITLLVKGKSLAAIKADLIHAFLTVADLCHNVINPMSFKVEYQRNNARTLLFQSQVKFQVDITSVKTSNPDEDCFSITFSLAADITRKKLSTSSSWNGNVKGQRNIRRFKRICDHIQAHICDNHAPSIPTSPKVCRKFSSDLSESSSCSSDTAEPSEQPMPSNLYSNNIQIQCR
ccEEEcccccccccccccEEHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEEEEccccccccccEEHHHHHHHHHHHHcccccccccHHHHHHHHHcccEEccccccHHHHHHHHHHccccccccEcHHHHHccccHHccccccccccccccHccccccccccccccHHHHHHHHHHcHcccccEEEEccccHHHEEEEcccccEHHHHHHHcccccHHHHHHcccccHHHEEEcccccEEEcccccccccccccccccccccccccHHHHHcccccccEEEcccEEEEEEEEcccccHHHHHHHccccccccHHHHHcccccEccccHccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcc
mkliehphgekydgrradvWSCGVILYALLVgalpfdddNLRQLLEKVKRgvfhiphfvppdcqcllrgmievnpekrmtladinshpwvtaggrgeleleLPMMEVIQthiipsveeidpDVLQAISNLGCFKQKDLLIQELLNNQYLILEHVSGGELFDYLVKKgrltpkearnhrdlkpenllldektniKIADFgmaslqpngsngggysyspqtspemskkyWFGQLVVTDKEETITLLVKGKSLAAIKADLIHAFLTVADLchnvinpmsfkvEYQRNNARTLLFQSQVKFQVDItsvktsnpdedcfSITFSLAADitrkklstssswngnvkgqRNIRRFKRICDHIQAhicdnhapsiptspkvcrkfssdlsessscssdtaepseqpmpsnlysnniqiqcr
mkliehphgekydgrradVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGvfhiphfvppdcqCLLRGMIEVNPEKRMTladinshpwvTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAISNLGCFKQKDLLIQELLNNQYLILEHVSGGELFDYLVKKGRltpkearnhrdlkpenllldekTNIKIADFGMASLQPNGSNGGGYSYSPQTSPEMSKKYWFGQLVVTDKEETITLLVKGKSLAAIKADLIHAFLTVADLCHNVINPMSFKVEYQRNNARTLLFQSQVKFQVDITsvktsnpdedCFSITFSLAADITrkklstssswngnvkgqrNIRRFKRICDHIQAHIcdnhapsiptSPKVCRKFSSDLSESSSCSSdtaepseqpmpsnlysnniqiqcr
MKLIEHPHGEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLRGMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAISNLGCFKQKDLLIQELLNNQYLILEHVSGGELFDYLVKKGRLTPKEARNHRDLKPENLLLDEKTNIKIADFGMASLQPngsngggysysPQTSPEMSKKYWFGQLVVTDKEETITLLVKGKSLAAIKADLIHAFLTVADLCHNVINPMSFKVEYQRNNARTLLFQSQVKFQVDITSVKTSNPDEDCFSITFSLAADITRKKLSTSSSWNGNVKGQRNIRRFKRICDHIQAHICDNHAPSIPTSPKVCRKFssdlsessscssDTAEPSEQPMPSNLYSNNIQIQCR
**************RRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLRGMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAISNLGCFKQKDLLIQELLNNQYLILEHVSGGELFDYLVKKGRL*****************L***TNIKIADF***************************KYWFGQLVVTDKEETITLLVKGKSLAAIKADLIHAFLTVADLCHNVINPMSFKVEYQRNNARTLLFQSQVKFQVDITSVKTSNPDEDCFSITFSLAADITRKKLSTSSSWNGNVKGQRNIRRFKRICDHIQAHICDNH**************************************************
*KLIEHPHGEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLRGMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAISNLGCFKQKDLLIQELLNNQYLILEHVSGGELFDY***********************************************************************************************************************************************************************************QRNIRRF*****************************************************************
MKLIEHPHGEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLRGMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAISNLGCFKQKDLLIQELLNNQYLILEHVSGGELFDYLVKKGRLTPKEARNHRDLKPENLLLDEKTNIKIADFGMASLQPNGSNGGGYSYSPQTSPEMSKKYWFGQLVVTDKEETITLLVKGKSLAAIKADLIHAFLTVADLCHNVINPMSFKVEYQRNNARTLLFQSQVKFQVDITSVKTSNPDEDCFSITFSLAADITRKKLSTSSSWNGNVKGQRNIRRFKRICDHIQAHICDNHAPSIPTSPKVC************************MPSNLYSNNIQIQCR
MKLIEHPHGEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLRGMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAISNLGCFKQKDLLIQELLNNQYLILEHVSGGELFDYLVKKGRLTPKEARNHRDLKPENLLLDEKTNIKIADFGMASLQPNGSNGGGYSYSPQTSPEMSKKYWFGQLVVTDKEETITLLVKGKSLAAIKADLIHAFLTVADLCHNVINPMSFKVEYQRNNARTLLFQSQVKFQVDITSVKTSNPDEDCFSITFSLAADITRKKLSTSSSWNGNVKGQRNIRRFKRICDHIQAH************************************************N******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLIEHPHGEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLRGMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAISNLGCFKQKDLLIQELLNNQYLILEHVSGGELFDYLVKKGRLTPKEARNHRDLKPENLLLDEKTNIKIADFGMASLQPNGSNGGGYSYSPQTSPEMSKKYWFGQLVVTDKEETITLLVKGKSLAAIKADLIHAFLTVADLCHNVINPMSFKVEYQRNNARTLLFQSQVKFQVDITSVKTSNPDEDCFSITFSLAADITRKKLSTSSSWNGNVKGQRNIRRFKRICDHIQAHICDNHAPSIPTSPKVCRKFSSDLSESSSCSSDTAEPSEQPMPSNLYSNNIQIQCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query413 2.2.26 [Sep-21-2011]
Q19469 914 Serine/threonine kinase S yes N/A 0.295 0.133 0.7 1e-55
Q8IWQ3 736 Serine/threonine-protein yes N/A 0.334 0.187 0.647 3e-50
Q69Z98 735 Serine/threonine-protein yes N/A 0.334 0.187 0.647 3e-50
D3ZML2 735 Serine/threonine-protein no N/A 0.334 0.187 0.647 9e-50
Q5RJI5 778 Serine/threonine-protein no N/A 0.346 0.183 0.597 5e-48
Q8TDC3 778 Serine/threonine-protein no N/A 0.346 0.183 0.597 6e-48
B2DD29 778 Serine/threonine-protein no N/A 0.346 0.183 0.597 6e-48
Q76P07 833 Probable serine/threonine yes N/A 0.389 0.193 0.408 7e-28
Q5REX1 925 Serine/threonine-protein no N/A 0.324 0.144 0.378 2e-21
Q9H0K1 926 Serine/threonine-protein no N/A 0.324 0.144 0.378 3e-21
>sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 Back     alignment and function desciption
 Score =  217 bits (553), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%)

Query: 9   GEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLR 68
           GEKYDGR+ADVWSCGVILYALLVGALPFDDDNLR LLEKVKRGVFHIPHFVP D Q LLR
Sbjct: 217 GEKYDGRKADVWSCGVILYALLVGALPFDDDNLRNLLEKVKRGVFHIPHFVPADVQSLLR 276

Query: 69  GMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAIS 128
            MIEV+P KR +LAD+  HPWV+   + + ELELPM +V+QTH+IP  + IDPDVL+ ++
Sbjct: 277 AMIEVDPGKRYSLADVFKHPWVSGTTKADPELELPMSQVVQTHVIPGEDSIDPDVLRHMN 336

Query: 129 NLGCFKQKDLLIQELLNNQY 148
            LGCFK K  LI ELL+ ++
Sbjct: 337 CLGCFKDKQKLINELLSPKH 356




Regulates both neuronal polarity and synaptic organization when bound to strd-1. Kinase activity is required for the establishment, but not the maintenance, of both processes. Binding to nab-1 is essential for role in restricting axonal fate during neuronal polarization but is not required for regulating synapse morphology.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 Back     alignment and function description
>sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 Back     alignment and function description
>sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 Back     alignment and function description
>sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 Back     alignment and function description
>sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 Back     alignment and function description
>sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 Back     alignment and function description
>sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 Back     alignment and function description
>sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
426366848 613 PREDICTED: serine/threonine-protein kina 0.808 0.544 0.393 7e-73
170038593 802 BR serine/threonine-protein kinase 2 [Cu 0.508 0.261 0.607 4e-70
312377024 798 hypothetical protein AND_11800 [Anophele 0.508 0.263 0.611 8e-70
242017424 881 BR serine/threonine-protein kinase, puta 0.382 0.179 0.760 1e-69
157114788 774 br serine/threonine-protein kinase [Aede 0.508 0.271 0.611 2e-69
158300350 776 AGAP012244-PA [Anopheles gambiae str. PE 0.508 0.270 0.611 8e-69
270008742 777 hypothetical protein TcasGA2_TC015323 [T 0.242 0.128 0.854 1e-68
189238088 794 PREDICTED: similar to CG6114 CG6114-PA [ 0.268 0.139 0.854 2e-68
194749827 863 GF10369 [Drosophila ananassae] gi|190624 0.285 0.136 0.828 2e-67
16648124 701 GH13047p [Drosophila melanogaster] 0.285 0.168 0.821 3e-67
>gi|426366848|ref|XP_004050457.1| PREDICTED: serine/threonine-protein kinase BRSK2 [Gorilla gorilla gorilla] Back     alignment and taxonomy information
 Score =  280 bits (717), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 168/427 (39%), Positives = 234/427 (54%), Gaps = 93/427 (21%)

Query: 9   GEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLR 68
           GEKYDGR+ADVWSCGVIL+ALLVGALPFDDDNLRQLLEKVKRGVFH+PHF+PPDCQ LLR
Sbjct: 129 GEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLR 188

Query: 69  GMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAIS 128
           GMIEV+  +R+TL  I  H W   GG+ E E E P+   +Q   +PS+E+IDPDVL ++ 
Sbjct: 189 GMIEVDAARRLTLEHIQKHIWYI-GGKNEPEPEQPIPRKVQIRSLPSLEDIDPDVLDSMH 247

Query: 129 NLGCFKQKDLLIQELLNNQ-------YLIL----EHVSGGELFDYLVKKGRLTPKEAR-- 175
           +LGCF+ ++ L+Q+LL+ +       Y +L    E     E  D L  +  + P   R  
Sbjct: 248 SLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPSQEDED-LPPRNEIDPPRKRVD 306

Query: 176 -----NHRDLKPENLLLD------------EKTNIKIADFGMASLQPNGSNGG------- 211
                 H   +PE   ++             +  I++A  G  S   +G++ G       
Sbjct: 307 SPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQHGQRSRSISGASSGLSTSPLS 366

Query: 212 ---------GYS----------------------YSPQTSPEMSKKYWFGQLVVTDKEET 240
                    G+S                       +P++SPE++KK WFG  +  +KEE 
Sbjct: 367 SPRVARAGEGWSGHHAFPPVHPVCTVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQ 426

Query: 241 ITLLVKGKSLAAIKADLIHAFLTVADLCHNVINPMSFKVEYQRNNARTLLFQSQVKFQVD 300
           I +++K K L++IKAD++HAFL++  L H+VI+  SF+ EY+       +FQ  VKFQVD
Sbjct: 427 IFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGG-PAVFQKPVKFQVD 485

Query: 301 ITSVKTSNPDED--CFSITFSLAADITRKKLSTSSSWNGNVKGQRNIRRFKRICDHIQAH 358
           IT  +     ++   +S+TF+L        LS  S            RRFKR+ + IQA 
Sbjct: 486 ITYTEGGEAQKENGIYSVTFTL--------LSGPS------------RRFKRVVETIQAQ 525

Query: 359 ICDNHAP 365
           +   H P
Sbjct: 526 LLSTHDP 532




Source: Gorilla gorilla gorilla

Species: Gorilla gorilla

Genus: Gorilla

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|170038593|ref|XP_001847133.1| BR serine/threonine-protein kinase 2 [Culex quinquefasciatus] gi|167882332|gb|EDS45715.1| BR serine/threonine-protein kinase 2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312377024|gb|EFR23954.1| hypothetical protein AND_11800 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|242017424|ref|XP_002429188.1| BR serine/threonine-protein kinase, putative [Pediculus humanus corporis] gi|212514077|gb|EEB16450.1| BR serine/threonine-protein kinase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157114788|ref|XP_001652422.1| br serine/threonine-protein kinase [Aedes aegypti] gi|108883575|gb|EAT47800.1| AAEL001139-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158300350|ref|XP_320298.4| AGAP012244-PA [Anopheles gambiae str. PEST] gi|157013117|gb|EAA00228.5| AGAP012244-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|270008742|gb|EFA05190.1| hypothetical protein TcasGA2_TC015323 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189238088|ref|XP_972377.2| PREDICTED: similar to CG6114 CG6114-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194749827|ref|XP_001957338.1| GF10369 [Drosophila ananassae] gi|190624620|gb|EDV40144.1| GF10369 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|16648124|gb|AAL25327.1| GH13047p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
FB|FBgn0036544 861 sff "sugar-free frosting" [Dro 0.338 0.162 0.821 1.9e-104
UNIPROTKB|F1MVZ2 706 BRSK2 "Uncharacterized protein 0.406 0.237 0.568 8.6e-79
UNIPROTKB|E9PLM7614 BRSK2 "Serine/threonine-protei 0.406 0.273 0.568 7e-76
UNIPROTKB|E1C1T7 660 BRSK2 "Uncharacterized protein 0.406 0.254 0.573 8.9e-76
UNIPROTKB|Q8IWQ3 736 BRSK2 "Serine/threonine-protei 0.406 0.228 0.568 4.7e-75
UNIPROTKB|F1PF66 636 BRSK2 "Uncharacterized protein 0.406 0.264 0.568 7.9e-75
MGI|MGI:1923020 735 Brsk2 "BR serine/threonine kin 0.406 0.228 0.568 2.8e-74
WB|WBGene00004719 914 sad-1 [Caenorhabditis elegans 0.338 0.153 0.7 2.5e-68
UNIPROTKB|F1PPP8 688 BRSK1 "Uncharacterized protein 0.334 0.200 0.631 8.3e-68
UNIPROTKB|F1MXK4 793 BRSK1 "Uncharacterized protein 0.334 0.174 0.631 3.8e-67
FB|FBgn0036544 sff "sugar-free frosting" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 640 (230.4 bits), Expect = 1.9e-104, Sum P(4) = 1.9e-104
 Identities = 115/140 (82%), Positives = 131/140 (93%)

Query:     9 GEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLR 68
             GEKYDGR+ADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQ LLR
Sbjct:   188 GEKYDGRKADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQSLLR 247

Query:    69 GMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAIS 128
             GMIEVNP++R+TLA+IN HPWVTAGG+GELELELPMMEV+QTH+IP+   +DPDVL AI 
Sbjct:   248 GMIEVNPDRRLTLAEINRHPWVTAGGKGELELELPMMEVVQTHVIPTATAVDPDVLNAIC 307

Query:   129 NLGCFKQKDLLIQELLNNQY 148
             +LGCFK+K+ LIQELL++ +
Sbjct:   308 SLGCFKEKEKLIQELLSSSH 327


GO:0004674 "protein serine/threonine kinase activity" evidence=ISS;NAS
GO:0006468 "protein phosphorylation" evidence=ISS;NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0007528 "neuromuscular junction development" evidence=IMP
GO:0006487 "protein N-linked glycosylation" evidence=IMP
UNIPROTKB|F1MVZ2 BRSK2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PLM7 BRSK2 "Serine/threonine-protein kinase BRSK2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1T7 BRSK2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IWQ3 BRSK2 "Serine/threonine-protein kinase BRSK2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PF66 BRSK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1923020 Brsk2 "BR serine/threonine kinase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00004719 sad-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPP8 BRSK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXK4 BRSK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-21
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-19
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-18
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-16
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-16
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 3e-15
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-14
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-13
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 4e-13
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 8e-13
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-12
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-12
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 3e-12
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 4e-11
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 5e-11
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 5e-11
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-10
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-10
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 3e-10
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 4e-10
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 9e-10
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-09
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 1e-09
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 3e-09
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 4e-09
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 1e-08
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 1e-08
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 1e-08
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-08
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 2e-08
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 3e-08
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 3e-08
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 3e-08
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 4e-08
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 5e-08
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 5e-08
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 5e-08
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 5e-08
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 6e-08
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 6e-08
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 7e-08
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 7e-08
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 7e-08
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 8e-08
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 8e-08
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 1e-07
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-07
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 3e-07
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 4e-07
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 5e-07
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 5e-07
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 5e-07
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 5e-07
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 6e-07
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 8e-07
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 9e-07
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 1e-06
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 1e-06
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 1e-06
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 1e-06
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 1e-06
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 1e-06
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 2e-06
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-06
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-06
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 2e-06
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 2e-06
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 2e-06
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 3e-06
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 3e-06
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 3e-06
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 3e-06
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 3e-06
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 3e-06
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 3e-06
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 3e-06
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 3e-06
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 3e-06
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 4e-06
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 4e-06
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 4e-06
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 5e-06
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 5e-06
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 5e-06
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 6e-06
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 7e-06
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 8e-06
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 9e-06
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 1e-05
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 1e-05
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 1e-05
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 1e-05
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 1e-05
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 1e-05
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 1e-05
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 1e-05
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-05
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 2e-05
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 2e-05
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-05
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 2e-05
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 2e-05
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 3e-05
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 3e-05
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 3e-05
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 3e-05
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 3e-05
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 3e-05
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 3e-05
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-05
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 4e-05
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 4e-05
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 4e-05
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 4e-05
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 4e-05
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 4e-05
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 5e-05
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 5e-05
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 5e-05
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 5e-05
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 5e-05
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 6e-05
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 6e-05
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 6e-05
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 6e-05
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 6e-05
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 7e-05
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 7e-05
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 7e-05
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 8e-05
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 9e-05
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 1e-04
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 1e-04
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 1e-04
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 1e-04
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 1e-04
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 1e-04
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 1e-04
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 1e-04
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 2e-04
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-04
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 2e-04
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 2e-04
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-04
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 2e-04
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-04
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 2e-04
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-04
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-04
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 2e-04
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 2e-04
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 2e-04
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 2e-04
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 2e-04
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-04
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 3e-04
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 3e-04
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 3e-04
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 3e-04
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 3e-04
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 3e-04
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 4e-04
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 4e-04
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 4e-04
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 4e-04
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 4e-04
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 4e-04
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 4e-04
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 4e-04
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 5e-04
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 5e-04
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 5e-04
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 5e-04
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 5e-04
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 6e-04
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 6e-04
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 6e-04
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 7e-04
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 7e-04
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 7e-04
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 7e-04
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 7e-04
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 8e-04
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 8e-04
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 8e-04
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 8e-04
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 8e-04
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 8e-04
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 9e-04
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 0.001
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 0.001
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 0.001
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 0.001
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 0.001
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 0.001
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 0.001
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 0.001
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 0.001
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 0.001
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 0.001
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 0.001
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 0.002
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 0.002
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 0.002
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 0.002
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 0.002
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 0.002
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 0.002
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 0.002
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 0.002
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 0.002
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 0.002
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 0.003
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 0.003
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 0.003
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 0.003
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 0.003
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 0.003
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 0.003
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 0.003
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 0.003
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 0.003
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 0.003
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 0.003
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 0.004
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 0.004
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 0.004
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 0.004
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 0.004
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 0.004
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 0.004
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 0.004
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 0.004
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score = 93.4 bits (233), Expect = 1e-21
 Identities = 40/104 (38%), Positives = 57/104 (54%), Gaps = 21/104 (20%)

Query: 145 NNQYLILEHVSGGELFDYLVKKGRLTPKEARN------------------HRDLKPENLL 186
           +  YL++E+  GG+LFD L K+GRL+  EAR                   HRDLKPEN+L
Sbjct: 70  DKLYLVMEYCEGGDLFDLLKKRGRLSEDEARFYLRQILSALEYLHSKGIVHRDLKPENIL 129

Query: 187 LDEKTNIKIADFGMASLQPNGSNGGGYSYSPQ-TSPE--MSKKY 227
           LDE  ++K+ADFG+A     G     +  +P+  +PE  + K Y
Sbjct: 130 LDEDGHVKLADFGLARQLDPGEKLTTFVGTPEYMAPEVLLGKGY 173


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 413
KOG0588|consensus786 100.0
KOG0581|consensus364 99.97
KOG0615|consensus475 99.97
KOG0603|consensus612 99.95
KOG0575|consensus 592 99.95
KOG0588|consensus 786 99.93
KOG0583|consensus370 99.93
KOG0198|consensus313 99.93
KOG0598|consensus357 99.93
KOG0578|consensus550 99.93
KOG0616|consensus355 99.92
KOG0595|consensus429 99.92
KOG0605|consensus550 99.91
KOG0591|consensus375 99.91
KOG0597|consensus 808 99.91
KOG0592|consensus 604 99.91
KOG0593|consensus396 99.91
KOG0582|consensus 516 99.91
KOG0201|consensus467 99.91
KOG0585|consensus576 99.91
KOG0660|consensus359 99.91
KOG0580|consensus281 99.9
KOG0600|consensus560 99.9
KOG0574|consensus502 99.9
KOG0661|consensus 538 99.9
KOG0659|consensus318 99.9
KOG0663|consensus419 99.9
KOG4717|consensus 864 99.9
KOG0197|consensus468 99.89
KOG0192|consensus362 99.89
KOG0611|consensus 668 99.88
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.88
KOG0577|consensus 948 99.88
KOG4721|consensus 904 99.87
KOG0032|consensus382 99.87
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.86
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.86
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.86
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.86
KOG4645|consensus1509 99.86
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.86
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.86
KOG0589|consensus426 99.86
KOG0586|consensus 596 99.86
KOG0694|consensus694 99.86
KOG0579|consensus 1187 99.86
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.86
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.85
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.85
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.85
KOG0604|consensus400 99.85
KOG0033|consensus355 99.85
KOG0612|consensus 1317 99.85
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.85
KOG4236|consensus888 99.85
KOG0690|consensus516 99.85
KOG0607|consensus463 99.85
KOG0590|consensus601 99.85
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.85
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.85
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.85
PHA02988283 hypothetical protein; Provisional 99.84
KOG1187|consensus361 99.84
KOG0599|consensus411 99.84
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.84
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.84
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.84
KOG0196|consensus996 99.84
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.84
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.84
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.84
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.84
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.84
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.84
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.84
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.84
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.84
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.83
KOG0983|consensus391 99.83
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.83
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.83
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.83
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.83
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.83
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.83
KOG1006|consensus361 99.83
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.83
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.83
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.83
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.83
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.83
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.83
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.83
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.83
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.82
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.82
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.82
KOG1035|consensus 1351 99.82
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.82
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.82
KOG0658|consensus364 99.82
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.82
KOG2345|consensus302 99.82
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.82
KOG0587|consensus 953 99.82
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.82
KOG1989|consensus 738 99.82
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.82
PHA03212391 serine/threonine kinase US3; Provisional 99.82
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.81
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.81
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.81
PTZ00267478 NIMA-related protein kinase; Provisional 99.81
PTZ00283496 serine/threonine protein kinase; Provisional 99.81
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.81
PTZ00284467 protein kinase; Provisional 99.81
PTZ00036440 glycogen synthase kinase; Provisional 99.81
KOG0986|consensus591 99.81
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.8
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.8
KOG4279|consensus 1226 99.8
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.8
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.8
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.8
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.79
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.79
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.79
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.79
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.79
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.79
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.79
KOG0194|consensus474 99.79
KOG0033|consensus355 99.78
PHA03207392 serine/threonine kinase US3; Provisional 99.78
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.78
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.78
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.78
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.78
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.78
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.78
KOG0596|consensus677 99.78
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.78
KOG0193|consensus678 99.78
KOG0667|consensus586 99.78
PHA03209357 serine/threonine kinase US3; Provisional 99.78
KOG0576|consensus 829 99.78
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.78
PHA03211461 serine/threonine kinase US3; Provisional 99.77
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.77
KOG1095|consensus1025 99.77
KOG0594|consensus323 99.77
KOG0696|consensus683 99.77
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.77
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.77
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.77
KOG2052|consensus513 99.77
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.77
KOG1026|consensus774 99.77
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.77
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.77
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.77
KOG0608|consensus1034 99.77
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.76
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.76
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.76
KOG0669|consensus376 99.76
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.76
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.76
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.75
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.75
KOG1094|consensus807 99.75
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.75
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.75
KOG3653|consensus534 99.75
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.75
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.75
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.75
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.75
KOG4717|consensus 864 99.75
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.75
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.75
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.75
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.75
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.75
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.75
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.74
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.74
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.74
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.74
PHA03210501 serine/threonine kinase US3; Provisional 99.74
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.74
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.74
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.74
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.74
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.74
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.74
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.74
KOG0984|consensus282 99.74
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.74
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.74
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.74
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.73
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.73
KOG0583|consensus370 99.73
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.73
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.73
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.73
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.73
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.73
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.73
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.73
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.73
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.73
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.73
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.73
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.73
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.73
KOG0575|consensus592 99.73
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.73
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.73
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.73
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.73
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.73
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.73
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.73
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.73
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.73
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.73
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.73
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.73
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.72
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.72
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.72
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.72
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.72
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.72
KOG0610|consensus459 99.72
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.72
KOG0584|consensus 632 99.72
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.72
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.72
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.72
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.72
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.72
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.72
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.72
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.72
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.72
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.72
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.72
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.72
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.72
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.72
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.72
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.72
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.72
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.72
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.72
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.72
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.72
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.71
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.71
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.71
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.71
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.71
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.71
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.71
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.71
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.71
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.71
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.71
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.71
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.71
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.71
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.71
PLN03224507 probable serine/threonine protein kinase; Provisio 99.71
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.71
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.71
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.71
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.71
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.71
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.71
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.71
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.71
KOG0662|consensus292 99.71
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.71
KOG0666|consensus438 99.71
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.71
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.7
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.7
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.7
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.7
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.7
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.7
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.7
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.7
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.7
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.7
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.7
KOG4257|consensus 974 99.7
KOG0694|consensus694 99.7
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.7
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.7
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.7
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.7
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.7
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.7
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.7
KOG0610|consensus459 99.7
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.7
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.7
KOG4278|consensus 1157 99.7
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.69
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.69
KOG0616|consensus355 99.69
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.69
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.69
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.69
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.69
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.69
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.69
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.69
KOG0605|consensus550 99.69
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.69
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.69
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.69
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.69
KOG4250|consensus 732 99.69
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.69
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.69
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.69
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.69
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.69
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.68
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.68
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.68
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.68
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.68
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.68
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.68
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.68
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.68
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.68
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.68
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.68
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.68
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.68
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.68
KOG0598|consensus357 99.68
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.68
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.68
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.68
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.68
KOG0614|consensus732 99.68
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.67
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.67
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.67
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.67
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.67
KOG0671|consensus415 99.67
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.67
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.67
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.67
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.67
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.67
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.67
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.67
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.67
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.67
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.67
PLN00009294 cyclin-dependent kinase A; Provisional 99.66
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.66
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.66
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.66
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.66
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.66
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.66
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.66
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.66
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.65
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.65
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.65
KOG0670|consensus752 99.65
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.65
KOG1027|consensus903 99.65
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.65
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.64
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.64
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.64
KOG0592|consensus604 99.64
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.64
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.64
KOG0581|consensus364 99.62
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.62
KOG0615|consensus475 99.62
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.61
KOG0664|consensus449 99.61
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.61
KOG1151|consensus775 99.6
KOG0665|consensus369 99.6
KOG0585|consensus576 99.6
PHA02882294 putative serine/threonine kinase; Provisional 99.59
KOG0604|consensus400 99.58
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.58
KOG0695|consensus593 99.57
KOG0580|consensus281 99.57
KOG0597|consensus 808 99.57
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.56
KOG0200|consensus609 99.56
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.56
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.55
KOG0586|consensus596 99.55
KOG0696|consensus683 99.54
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.54
KOG1025|consensus 1177 99.53
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.53
KOG0603|consensus612 99.53
KOG0032|consensus382 99.53
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.52
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.52
KOG0591|consensus375 99.52
KOG0199|consensus 1039 99.52
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.52
KOG0578|consensus550 99.51
KOG0690|consensus516 99.51
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.51
KOG0599|consensus411 99.51
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.51
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.51
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.51
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.51
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.5
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.5
PTZ00284467 protein kinase; Provisional 99.5
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.49
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.49
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.49
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.48
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.48
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.47
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.47
KOG0611|consensus668 99.47
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.47
PTZ00036440 glycogen synthase kinase; Provisional 99.47
KOG1152|consensus772 99.46
KOG0201|consensus467 99.46
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.45
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.45
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.45
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.45
KOG1345|consensus378 99.44
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.43
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.43
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.43
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.43
PLN00181 793 protein SPA1-RELATED; Provisional 99.43
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.43
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.42
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.42
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.42
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.41
KOG0660|consensus359 99.41
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.41
KOG0198|consensus313 99.41
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.41
KOG0667|consensus586 99.41
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.41
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.41
KOG0596|consensus677 99.4
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.4
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.4
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.4
PHA02988283 hypothetical protein; Provisional 99.4
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.39
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.39
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.39
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.39
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.39
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.39
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.39
KOG0607|consensus463 99.39
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.39
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.38
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.38
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.38
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.38
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.38
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.37
KOG0986|consensus591 99.37
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.37
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.37
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.37
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.37
PTZ00283496 serine/threonine protein kinase; Provisional 99.37
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.36
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.36
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.36
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.36
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.36
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.36
>KOG0588|consensus Back     alignment and domain information
Probab=100.00  E-value=9.5e-41  Score=335.96  Aligned_cols=343  Identities=31%  Similarity=0.503  Sum_probs=263.7

Q ss_pred             CCCCcccCCCCcCCCchhHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHcCccccCCCCCccHHHHHhhhhccCcccccc
Q psy6359           1 MKLIEHPHGEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLRGMIEVNPEKRMT   80 (413)
Q Consensus         1 ~~~PE~l~g~~y~~~k~DiWSlGvil~ell~G~~Pf~~~~~~~~~~~i~~~~~~~p~~~s~~~~~li~~~L~~dP~kR~s   80 (413)
                      |-+||++.|++|+|.++||||||||||+||+|++||+++|.+.++.+|++|.|++|++++++|++||++||++||++|++
T Consensus       177 YA~PEIV~G~pYdG~~sDVWSCGVILfALLtG~LPFdDdNir~LLlKV~~G~f~MPs~Is~eaQdLLr~ml~VDp~~RiT  256 (786)
T KOG0588|consen  177 YAAPEIVSGRPYDGRPSDVWSCGVILFALLTGKLPFDDDNIRVLLLKVQRGVFEMPSNISSEAQDLLRRMLDVDPSTRIT  256 (786)
T ss_pred             cCCchhhcCCCCCCCccccchhHHHHHHHHhCCCCCCCccHHHHHHHHHcCcccCCCcCCHHHHHHHHHHhccCcccccc
Confidence            67999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCccccCCCCccccccccchhccccccccccccCccchhchhcccccccchhHHHhhhcc--------eeEEEe
Q psy6359          81 LADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAISNLGCFKQKDLLIQELLNN--------QYLILE  152 (413)
Q Consensus        81 ~~ell~h~~ig~g~~G~V~~~~~~~~~VAvK~l~~~~~~d~~il~el~~l~~~~~~~il~~~l~~~--------~~lv~E  152 (413)
                      ++++++|||+..+..-.....++..+.+.+..++...++|+.+++.|..++|+++++.++.++...        |+|+++
T Consensus       257 ~~eI~kHP~l~g~~~~~~~~~~~~~~~~~i~s~ps~~~IDp~Il~~l~iLwc~~d~~kl~~kLls~~~n~EK~~Y~LLl~  336 (786)
T KOG0588|consen  257 TEEILKHPFLSGYTSLPSSKSLRPPVSVPILSIPSIQEIDPLILQHLCILWCGRDPEKLVEKLLSPDDNDEKTLYFLLLR  336 (786)
T ss_pred             HHHHhhCchhhcCCCCChhhhcCCCcccceeecCCcccCCHHHHhhhhheeecCChHHHHHHHcCCCcchhHHHHHHHHH
Confidence            999999999975554445566777778888888989999999999999999999999998888755        888899


Q ss_pred             eecCCChhhhhh---h-c-----------------------CCCChhh-hcc----------------------------
Q psy6359         153 HVSGGELFDYLV---K-K-----------------------GRLTPKE-ARN----------------------------  176 (413)
Q Consensus       153 ~~~~g~L~~~i~---~-~-----------------------~~l~~~~-~~~----------------------------  176 (413)
                      |+.+......-.   . .                       .++.... ...                            
T Consensus       337 ~k~r~~~~~~~~~~~kk~~~~s~~~~p~k~~~~~~~~~~~~s~~s~r~~~~~~a~~~~~si~t~s~~~~~~St~~~~~~~  416 (786)
T KOG0588|consen  337 RKRRDSSQLDDFDENKKDLLGSAADPPRKRVDEEIESAINISPLSSRKLIKDNASSTSSSILTTSLVSSRVSTNSAFSSS  416 (786)
T ss_pred             hhccchhhhhhhhhhhhhhhccccCCchhhhhhhhhhhcccCccccccccccccccccccccccCCccCCCCccccccCC
Confidence            887744432110   0 0                       0010000 000                            


Q ss_pred             ------cC-CCCCcc--------------------------------------------cccC------CCCCEEEccCC
Q psy6359         177 ------HR-DLKPEN--------------------------------------------LLLD------EKTNIKIADFG  199 (413)
Q Consensus       177 ------HR-DlKp~N--------------------------------------------ILl~------~~~~~Ki~DFG  199 (413)
                            .| +..+.-                                            .-.+      ..+.+-..|++
T Consensus       417 ~~~~~~qr~~rs~~s~rss~s~~p~s~~~s~~~~~s~~r~s~~~~~~s~~~~~s~d~s~~~~~v~~~r~~~ss~s~~d~~  496 (786)
T KOG0588|consen  417 FSAELAQRISRSPSSARSSNSQLPKSIPVSLAYRHSSSRRSSNYSPPSASSKRSFDRSDKDAEVYACRTVVSSASSLDDD  496 (786)
T ss_pred             ccchhhhhhccccchhhcccccCcccCCccccccchhhhhhcccCCcccccccccccccccccceecccccCCCCcCccc
Confidence                  00 000000                                            0000      00001111222


Q ss_pred             CC----------C--CCCCC----------CC--C----------------------------Cc----c-ccCCCCCCc
Q psy6359         200 MA----------S--LQPNG----------SN--G----------------------------GG----Y-SYSPQTSPE  222 (413)
Q Consensus       200 la----------~--~~~~~----------~~--~----------------------------~~----~-~~~~~~aPE  222 (413)
                      ..          .  ..+.+          ..  .                            ++    . ....-.+||
T Consensus       497 ~~~~~~~v~~v~~p~~~p~s~~~~r~~~~s~~S~~~~p~r~klesikn~~~g~pr~~r~~~~~~tae~~~~n~~~~~~p~  576 (786)
T KOG0588|consen  497 YNENDPSVVFVCPPSESPASETNNRKDPLSLQSFGPEPTREKLESIKNSFEGDPRFHRQNLSKSTAEGYSDNNPDNSSPE  576 (786)
T ss_pred             cccCCceeecccCcccCcccCCCCCCCccchhccCCcchHHHHhccccccccCcchhhhhcccCccccccccCCccCCcc
Confidence            11          0  00000          00  0                            00    0 122236788


Q ss_pred             cccccccceeeE-eCCcceeeecccCCChhHHHHHHHHHHHhHhHHHHHHhhhhcccCcccCCCh--hhhhcCchhhhhc
Q psy6359         223 MSKKYWFGQLVV-TDKEETITLLVKGKSLAAIKADLIHAFLTVADLCHNVINPMSFKVEYQRNNA--RTLLFQSQVKFQV  299 (413)
Q Consensus       223 ~~d~~sfG~~~~-~~~~~~~~~~~~g~~l~~~~~~~~~~~~~i~~~~~~li~~~l~k~p~kR~s~--~~~l~~~~vk~q~  299 (413)
                      .....|||.+.. ..+.....+.+.++|+..+..++...|+.++...++.+++..++.++++-..  +++.+.++.+|+|
T Consensus       577 ~~~k~~~~~l~~~~e~~~s~~~~~q~kp~s~~~~~i~~sf~~~~~~s~s~~~~~~~R~~~q~k~~~~~p~~~~~~s~~~V  656 (786)
T KOG0588|consen  577 EPTKSNFNNLDSSKEGERSMRVDLQQKPLSSISANINRSFLSIPVLSHSVINKKNFRSEYQPKCSFLSPLVSSRGSKFNV  656 (786)
T ss_pred             ccccccccccccccccccceeeecccCcccccccccccccccccccCCcccccccccccccccccccccccccccceeEe
Confidence            888899999976 4677778888999999999999999999999999999999999999997443  7899999999999


Q ss_pred             cccccccc--CCCCceeEEEEEecchhhhhccccCCCCCCCccCCCcchhhHH-HHHhhhhhhhccC
Q psy6359         300 DITSVKTS--NPDEDCFSITFSLAADITRKKLSTSSSWNGNVKGQRNIRRFKR-ICDHIQAHICDNH  363 (413)
Q Consensus       300 di~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rr~~~-~~~~~~~~~~~~~  363 (413)
                      |+.+..++  .+....|.++|.++.                    |+.|||+| |+|||+|+++...
T Consensus       657 d~~~~~~~~~~~s~~~~~v~f~l~~--------------------g~~~~fk~~~se~vsa~~~~k~  703 (786)
T KOG0588|consen  657 DARLTPSKVESGSLSRYRVSFVLLD--------------------GPARRFKRSVSEHVSARLLRKN  703 (786)
T ss_pred             eeeeccccccccccceeEEEEeecc--------------------ChHHHhhHhhhhhHhhhhhhhh
Confidence            99999865  456789999999999                    89999999 9999999998873



>KOG0581|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-20
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 4e-13
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 3e-20
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 4e-13
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-20
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-12
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 6e-20
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 9e-13
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-20
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 9e-13
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-20
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-12
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 7e-20
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-12
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 8e-20
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 9e-12
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-19
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-12
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 6e-19
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 4e-12
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 6e-19
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 4e-12
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 1e-18
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 5e-10
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 2e-18
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 4e-13
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 2e-17
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 6e-11
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 2e-16
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 1e-12
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 2e-14
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 3e-10
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 2e-14
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 3e-10
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 2e-14
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 3e-10
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-14
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 3e-10
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 3e-14
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 2e-06
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 3e-14
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 1e-05
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 3e-14
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 1e-04
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 3e-14
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 8e-05
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 3e-14
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 1e-04
3soa_A444 Full-Length Human Camkii Length = 444 8e-14
3soa_A444 Full-Length Human Camkii Length = 444 3e-05
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 9e-14
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 8e-06
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 2e-13
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 1e-05
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 3e-13
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 3e-13
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 1e-05
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 3e-13
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 1e-05
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 5e-13
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 2e-05
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 3e-12
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 6e-05
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 2e-11
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 6e-05
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 3e-11
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 7e-05
3kk8_A284 Camkii Substrate Complex A Length = 284 3e-11
3kk8_A284 Camkii Substrate Complex A Length = 284 6e-05
3kk9_A282 Camkii Substrate Complex B Length = 282 3e-11
3kk9_A282 Camkii Substrate Complex B Length = 282 6e-05
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 9e-11
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 3e-06
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 9e-11
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 3e-06
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 2e-10
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 2e-10
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 2e-10
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 2e-10
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-10
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 2e-10
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 3e-04
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 2e-10
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 3e-04
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 2e-10
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 2e-10
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 2e-10
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 2e-10
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 2e-10
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 1e-04
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 3e-10
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 3e-10
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 3e-10
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-10
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 3e-10
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 3e-10
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-10
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 3e-10
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 3e-10
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 3e-10
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 3e-10
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 3e-10
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 3e-10
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 3e-10
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 3e-10
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 3e-10
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 3e-10
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 3e-10
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 3e-10
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-10
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 4e-10
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 4e-10
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-10
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-06
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 4e-10
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 5e-10
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 5e-10
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 5e-10
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 1e-06
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 5e-10
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 1e-06
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 5e-10
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 5e-10
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 5e-10
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 5e-10
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 6e-10
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 6e-10
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 6e-10
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 6e-10
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 6e-10
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 6e-10
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 6e-10
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 6e-10
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 6e-10
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 7e-10
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 7e-10
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 7e-10
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 8e-10
2xix_A301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 8e-10
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 1e-09
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 1e-09
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 1e-09
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 1e-09
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 1e-09
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 1e-09
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 1e-09
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 1e-09
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-09
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-06
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 1e-09
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 1e-09
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 1e-09
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 1e-09
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 1e-09
4fst_A269 Crystal Structure Of The Chk1 Length = 269 1e-09
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 1e-09
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 1e-09
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 1e-09
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 1e-09
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 1e-09
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 1e-09
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 1e-09
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 1e-09
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-09
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-06
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 2e-09
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 2e-09
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 2e-09
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 2e-09
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 3e-09
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 3e-06
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 3e-09
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 3e-06
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 3e-09
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 3e-09
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-09
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 3e-09
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 4e-09
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 4e-09
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 4e-09
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 4e-09
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 4e-09
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 5e-09
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 6e-09
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 6e-09
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 1e-06
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 7e-09
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 7e-09
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 7e-09
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 8e-09
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 9e-09
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 1e-08
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 1e-08
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 1e-08
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 1e-08
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 1e-08
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 1e-08
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 1e-08
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 1e-08
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 1e-08
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 1e-08
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 1e-08
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 1e-08
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 1e-08
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 1e-08
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 1e-08
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 1e-08
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-08
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 1e-08
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 6e-06
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 1e-08
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 2e-08
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 2e-08
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-08
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-08
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-08
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 2e-08
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-08
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 2e-08
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 2e-08
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 2e-08
2qcs_A350 A Complex Structure Between The Catalytic And Regul 2e-08
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 2e-08
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 2e-08
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 2e-08
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-08
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 2e-08
4ae6_A343 Structure And Function Of The Human Sperm-specific 3e-08
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 3e-08
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 3e-08
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 3e-08
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 3e-08
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 3e-08
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 3e-08
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 3e-08
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 3e-08
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 3e-08
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 3e-08
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 3e-08
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 3e-08
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 3e-08
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 4e-08
4ae9_A343 Structure And Function Of The Human Sperm-specific 5e-08
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 5e-08
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 5e-08
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 5e-08
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 5e-08
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 5e-08
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 5e-08
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 5e-08
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 5e-08
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 6e-08
2oza_A356 Structure Of P38alpha Complex Length = 356 6e-08
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 6e-08
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 6e-08
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 6e-08
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 6e-08
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 6e-08
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 6e-08
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 6e-08
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 7e-08
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 7e-08
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 7e-08
3g51_A325 Structural Diversity Of The Active Conformation Of 8e-08
3g51_A325 Structural Diversity Of The Active Conformation Of 1e-06
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 9e-08
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 1e-06
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 9e-08
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-06
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 9e-08
1smh_A350 Protein Kinase A Variant Complex With Completely Or 1e-07
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 1e-07
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 1e-07
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 1e-07
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 1e-06
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 1e-07
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 1e-07
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 2e-06
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 1e-07
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 1e-07
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 1e-06
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 1e-07
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 1e-06
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 1e-07
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 1e-06
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 1e-07
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 1e-07
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 1e-06
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 1e-07
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 1e-06
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 1e-07
3f5u_A295 Crystal Structure Of The Death Associated Protein K 1e-07
3f5u_A295 Crystal Structure Of The Death Associated Protein K 1e-06
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 1e-07
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 1e-06
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 1e-07
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 1e-06
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 1e-07
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 1e-07
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 1e-07
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 1e-05
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 1e-07
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 1e-06
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 2e-07
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 2e-06
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 2e-07
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 2e-06
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 4e-07
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 3e-06
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 6e-07
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 6e-07
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 2e-05
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 6e-07
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 2e-05
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 6e-07
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 2e-05
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 7e-07
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 8e-07
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 9e-07
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 9e-07
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 3e-06
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 9e-07
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 9e-07
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 1e-06
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 1e-06
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 1e-06
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 1e-06
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 1e-06
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 1e-06
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 1e-06
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 1e-06
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 1e-06
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 1e-06
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 1e-06
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 6e-04
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 1e-06
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 1e-06
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 6e-04
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 2e-06
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 5e-04
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 2e-06
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 6e-04
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 2e-06
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 6e-04
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 2e-06
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 2e-04
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 2e-06
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 2e-06
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 2e-04
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 2e-06
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 2e-04
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 2e-06
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 2e-04
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 2e-06
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 2e-04
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 2e-06
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 2e-04
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 2e-06
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 2e-04
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 2e-06
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 2e-06
3bhy_A283 Crystal Structure Of Human Death Associated Protein 2e-06
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 3e-06
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 5e-06
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 5e-06
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 9e-06
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 1e-05
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 4e-05
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 1e-05
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 4e-05
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 2e-05
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 4e-05
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 4e-05
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 4e-05
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 4e-05
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 4e-05
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 4e-05
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 4e-05
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 5e-05
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 5e-05
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 7e-05
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 1e-04
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 1e-04
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 1e-04
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 1e-04
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 1e-04
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-04
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 2e-04
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 2e-04
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 2e-04
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 3e-04
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 3e-04
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 3e-04
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 4e-04
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 4e-04
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 4e-04
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 4e-04
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 4e-04
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 4e-04
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 4e-04
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 4e-04
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 4e-04
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 4e-04
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 4e-04
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 4e-04
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 4e-04
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 4e-04
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 4e-04
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 4e-04
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 4e-04
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 4e-04
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 4e-04
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 5e-04
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 5e-04
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 5e-04
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 5e-04
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 5e-04
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 6e-04
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 6e-04
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 6e-04
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 6e-04
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 6e-04
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 7e-04
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 7e-04
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 8e-04
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 8e-04
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure

Iteration: 1

Score = 96.7 bits (239), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 43/86 (50%), Positives = 57/86 (66%) Query: 8 HGEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLL 67 G+KYDG DVWS GVILY L+ G+LPFD NL++L E+V RG + IP ++ DC+ LL Sbjct: 183 QGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLL 242 Query: 68 RGMIEVNPEKRMTLADINSHPWVTAG 93 + + +NP KR TL I W+ AG Sbjct: 243 KRFLVLNPIKRGTLEQIMKDRWINAG 268
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 8e-48
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 7e-27
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 2e-47
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 4e-27
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 3e-46
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 6e-28
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 4e-42
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 8e-29
2eue_A275 Carbon catabolite derepressing protein kinase; kin 1e-41
2eue_A275 Carbon catabolite derepressing protein kinase; kin 2e-26
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 8e-41
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 2e-24
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 8e-38
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-25
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 7e-37
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 3e-23
3dls_A335 PAS domain-containing serine/threonine-protein KI; 1e-35
3dls_A335 PAS domain-containing serine/threonine-protein KI; 8e-25
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 2e-35
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 3e-23
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 9e-35
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 5e-24
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 4e-34
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 4e-28
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-33
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-28
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-32
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 7e-23
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 5e-32
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 3e-24
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 1e-31
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-23
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-30
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 4e-23
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-29
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 6e-23
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 3e-29
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-22
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 6e-26
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-10
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 7e-24
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-13
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 6e-23
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 2e-19
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-22
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 9e-18
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-22
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-16
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-22
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 4e-21
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-22
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 4e-17
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 3e-22
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 2e-08
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 4e-22
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 4e-17
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 4e-22
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 6e-20
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 6e-22
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-16
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 7e-22
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-16
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-21
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 5e-19
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 2e-21
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 2e-21
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 4e-21
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 4e-20
3lij_A494 Calcium/calmodulin dependent protein kinase with A 7e-21
3lij_A494 Calcium/calmodulin dependent protein kinase with A 3e-16
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 9e-21
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 3e-18
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-20
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 1e-16
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 3e-20
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-18
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 3e-20
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 4e-18
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 3e-20
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 4e-17
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 4e-20
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-18
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 7e-20
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-09
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-19
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 1e-14
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-19
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-15
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 1e-18
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 5e-16
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-18
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-17
3bhy_A283 Death-associated protein kinase 3; death associate 3e-18
3bhy_A283 Death-associated protein kinase 3; death associate 4e-18
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 4e-18
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-17
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 4e-18
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 9e-18
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 4e-18
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 9e-17
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 4e-18
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-10
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 4e-18
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 8e-18
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 5e-18
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 6e-16
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 5e-18
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 7e-17
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 6e-18
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-15
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 9e-18
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 2e-17
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 2e-17
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-14
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-17
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 6e-15
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 2e-17
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-15
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 3e-17
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-16
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-17
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-16
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 4e-17
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 6e-14
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 4e-17
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 3e-15
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 5e-17
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-08
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 7e-17
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 2e-11
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 8e-17
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 9e-17
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 9e-17
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 4e-15
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 1e-16
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-13
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 1e-16
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 8e-14
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 2e-16
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 6e-12
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-16
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 5e-14
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 1e-14
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 8e-12
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-14
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 7e-14
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 2e-14
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 5e-14
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 3e-14
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 8e-14
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 5e-14
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 6e-13
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 8e-14
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 3e-10
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 9e-14
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 1e-10
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-13
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-10
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 1e-13
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 5e-13
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-13
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 1e-12
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-13
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-13
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-13
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-10
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-13
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-12
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-13
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-10
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 3e-13
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 7e-11
2a19_B284 Interferon-induced, double-stranded RNA-activated 3e-13
2a19_B284 Interferon-induced, double-stranded RNA-activated 4e-10
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 7e-13
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 5e-09
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 7e-13
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 2e-10
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 9e-13
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 5e-05
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-12
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-12
3ork_A311 Serine/threonine protein kinase; structural genomi 1e-12
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-04
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-12
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 5e-12
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 2e-12
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 4e-11
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 4e-12
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 4e-07
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 6e-12
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 3e-06
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 7e-12
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 1e-10
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 3e-11
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-04
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 3e-11
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-04
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 7e-11
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-04
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 7e-11
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 1e-05
3q4u_A301 Activin receptor type-1; structural genomics conso 7e-11
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 7e-11
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 2e-10
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 2e-05
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-10
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 5e-06
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 2e-10
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-07
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 3e-10
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 3e-10
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 5e-05
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 5e-10
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 6e-10
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-04
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 7e-10
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 9e-09
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 1e-09
3soc_A322 Activin receptor type-2A; structural genomics cons 2e-09
3lzb_A327 Epidermal growth factor receptor; epidermal growth 2e-09
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 3e-09
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 3e-09
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 3e-09
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 4e-09
3o0g_A292 Cell division protein kinase 5; kinase activator c 4e-09
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 4e-09
3niz_A311 Rhodanese family protein; structural genomics, str 5e-09
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 5e-09
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 5e-09
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 5e-09
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 5e-09
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 6e-09
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 6e-09
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 2e-04
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 6e-09
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 9e-09
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 2e-06
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-08
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-08
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-08
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-08
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-08
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 2e-08
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-08
3poz_A327 Epidermal growth factor receptor; kinase domain, a 3e-08
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 4e-08
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 4e-08
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 5e-08
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 5e-08
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 5e-08
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 5e-08
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 6e-08
3uqc_A286 Probable conserved transmembrane protein; structur 6e-08
3uqc_A286 Probable conserved transmembrane protein; structur 4e-06
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 6e-08
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 6e-08
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 6e-08
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 7e-08
3pls_A298 Macrophage-stimulating protein receptor; protein k 7e-08
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 7e-08
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 7e-08
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 9e-08
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 9e-08
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 9e-08
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-04
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 9e-08
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-07
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-07
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-07
3rp9_A458 Mitogen-activated protein kinase; structural genom 1e-07
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-07
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-07
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 2e-07
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 2e-07
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 2e-07
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-07
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 2e-07
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 2e-07
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 3e-07
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 3e-07
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 4e-07
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 4e-07
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 5e-07
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 5e-07
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 7e-07
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 7e-07
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 8e-07
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 9e-07
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 1e-06
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-06
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 1e-06
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 2e-06
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-06
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 2e-06
2fst_X367 Mitogen-activated protein kinase 14; active mutant 2e-06
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 2e-06
3eqc_A360 Dual specificity mitogen-activated protein kinase; 3e-06
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-06
2xir_A316 Vascular endothelial growth factor receptor 2; ang 5e-06
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 5e-06
2dyl_A318 Dual specificity mitogen-activated protein kinase 5e-06
2dyl_A318 Dual specificity mitogen-activated protein kinase 7e-06
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 5e-06
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 6e-06
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 6e-06
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 6e-06
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 7e-06
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 7e-06
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 8e-06
3aln_A327 Dual specificity mitogen-activated protein kinase; 9e-06
3aln_A327 Dual specificity mitogen-activated protein kinase; 4e-05
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 9e-06
3fme_A290 Dual specificity mitogen-activated protein kinase; 1e-05
3fme_A290 Dual specificity mitogen-activated protein kinase; 2e-05
3an0_A340 Dual specificity mitogen-activated protein kinase; 1e-05
3an0_A340 Dual specificity mitogen-activated protein kinase; 1e-05
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 1e-05
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 1e-05
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 2e-05
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 3e-05
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 3e-05
4aoj_A329 High affinity nerve growth factor receptor; transf 3e-05
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 3e-05
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 4e-05
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 6e-05
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 6e-05
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 6e-05
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-04
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 1e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 1e-04
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-04
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-04
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-04
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 2e-04
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-04
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-04
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 4e-04
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 9e-04
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
 Score =  165 bits (420), Expect = 8e-48
 Identities = 42/153 (27%), Positives = 74/153 (48%), Gaps = 19/153 (12%)

Query: 9   GEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQCLLR 68
           G+ Y G   DVWSCG++LY +LVG LPFDD+ +  L +KV   V+ +P F+ P  Q L+R
Sbjct: 181 GKLYAGPEVDVWSCGIVLYVMLVGRLPFDDEFIPNLFKKVNSCVYVMPDFLSPGAQSLIR 240

Query: 69  GMIEVNPEKRMTLADINSHPWVTAGGRGELELELPMMEVIQTHIIPSVEEIDPDVLQAIS 128
            MI  +P +R+T+ +I   PW              + + ++          D  ++  + 
Sbjct: 241 RMIVADPMQRITIQEIRRDPWFNVN----------LPDYLRPMEEVQGSYADSRIVSKLG 290

Query: 129 NLGCFKQKDLLIQELLNNQY--------LILEH 153
               F +   +++ L +++         L+ E+
Sbjct: 291 EAMGFSEDY-IVEALRSDENNEVKEAYNLLHEN 322


>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.97
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.97
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.97
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.97
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.97
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.97
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.97
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.97
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.96
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.95
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.95
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.95
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.95
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.95
4aoj_A329 High affinity nerve growth factor receptor; transf 99.95
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.95
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.94
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.94
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.94
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.91
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.9
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.9
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.9
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.9
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.89
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.89
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.89
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.89
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.89
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.89
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.89
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.89
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.89
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.89
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.89
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.89
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.89
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.89
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.89
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.89
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.89
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.88
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.88
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.88
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.88
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.88
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.88
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.88
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.88
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.88
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.88
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.88
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.87
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.87
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.87
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.87
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.87
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.87
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.87
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.87
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.87
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.87
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.87
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.87
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.87
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.87
3niz_A311 Rhodanese family protein; structural genomics, str 99.87
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.87
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.87
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.87
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.87
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.87
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.86
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.86
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.86
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.86
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.86
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.86
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.86
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.86
3ork_A311 Serine/threonine protein kinase; structural genomi 99.86
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.86
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.86
3soc_A322 Activin receptor type-2A; structural genomics cons 99.86
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.86
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.86
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.86
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.85
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.85
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.85
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.85
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.85
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.85
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.85
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.85
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.85
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.85
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.85
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.85
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.85
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.85
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.85
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.85
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.85
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.84
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.84
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.84
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.84
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.84
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.84
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.84
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.84
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.84
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.84
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.84
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.84
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.84
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.84
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.84
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.84
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.84
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.84
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.84
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.84
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.84
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.84
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.84
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.84
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.84
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.84
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.84
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.83
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.83
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.83
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.83
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.83
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.83
3bhy_A283 Death-associated protein kinase 3; death associate 99.83
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.83
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.83
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.83
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.83
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.83
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.83
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.83
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.83
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.83
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.83
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.83
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.83
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.83
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.82
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.82
3q4u_A301 Activin receptor type-1; structural genomics conso 99.82
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.82
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.82
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.82
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.82
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.82
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.82
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.82
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.82
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.82
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.82
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.82
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.82
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.82
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.82
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.81
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.81
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.81
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.81
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.81
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.81
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.81
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.81
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.81
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.81
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.81
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.81
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.81
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.81
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.81
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.81
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.81
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.81
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.81
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.81
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.81
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.81
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.81
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.81
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.81
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.81
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.8
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.8
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.8
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.8
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.8
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.8
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.8
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.8
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.8
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.8
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.8
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.8
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.8
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.8
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.8
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.8
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.8
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.8
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.8
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.8
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.8
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.8
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.79
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.79
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.79
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.79
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.79
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.79
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.79
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.79
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.79
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.79
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.79
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.79
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.79
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.78
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.78
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.78
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.78
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.78
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.78
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.78
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.78
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.77
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.77
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.77
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.77
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.77
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.77
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.77
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.76
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.76
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.76
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.76
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.76
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.76
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.76
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.75
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.75
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.74
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.74
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.72
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.72
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.71
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.7
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.69
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.68
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.67
3uqc_A286 Probable conserved transmembrane protein; structur 99.66
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.66
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 99.64
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.62
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.62
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.61
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.61
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.6
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.6
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.6
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.59
4aoj_A329 High affinity nerve growth factor receptor; transf 99.59
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.59
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.58
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.57
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.57
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.56
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.56
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.56
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.56
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.56
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.56
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.55
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.54
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.54
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.54
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.54
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.54
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.54
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.54
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.53
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.53
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.53
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.53
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.53
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.52
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.52
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.52
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.52
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.52
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.51
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.51
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.51
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.51
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.51
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.51
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.51
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.51
3niz_A311 Rhodanese family protein; structural genomics, str 99.5
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.5
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.5
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.5
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.5
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.5
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.5
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.5
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.49
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.49
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.49
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.49
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.49
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.49
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.48
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.48
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.48
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.48
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.48
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.48
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.48
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.48
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.48
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.47
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.47
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.47
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.47
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.47
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.47
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.47
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.47
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.47
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.46
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.46
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.46
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.46
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.46
3bhy_A283 Death-associated protein kinase 3; death associate 99.46
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.45
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.45
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.45
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.45
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.45
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.44
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.44
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.44
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.44
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.44
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.44
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.44
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.44
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.44
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.44
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.43
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.43
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.43
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.43
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.43
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.43
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.43
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.43
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.43
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.42
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.42
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.41
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.41
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.4
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.4
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.4
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.4
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.4
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.39
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.39
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.39
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.39
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.38
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.38
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.38
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.38
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.38
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.37
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.37
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.37
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.37
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.36
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.35
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.35
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.35
3ork_A311 Serine/threonine protein kinase; structural genomi 99.35
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.35
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.34
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.34
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.34
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.34
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.33
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.32
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.32
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.32
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.32
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.31
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.31
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.31
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.3
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.3
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.3
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.3
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.3
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.3
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.29
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.29
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.29
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.28
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.28
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.28
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.28
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.28
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.28
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.28
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.28
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.28
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.27
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.27
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.27
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.26
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.26
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.26
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.26
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.26
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.25
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.25
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.25
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.25
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.25
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.24
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.24
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.24
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.24
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.24
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.24
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.23
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.23
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.23
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.23
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.23
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.23
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.22
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.21
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.21
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.21
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.21
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.21
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.21
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.2
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.2
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.2
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.2
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.2
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.19
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.18
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.18
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.18
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.18
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.18
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.17
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.16
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.16
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.16
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.15
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.15
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.13
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.12
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.11
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.11
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.09
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.09
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.08
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.07
3soc_A322 Activin receptor type-2A; structural genomics cons 99.07
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.06
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.03
3q4u_A301 Activin receptor type-1; structural genomics conso 99.02
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.01
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 98.98
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 98.97
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 98.96
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 98.96
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 98.95
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 98.93
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 98.86
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 98.79
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=99.97  E-value=7.7e-34  Score=275.21  Aligned_cols=225  Identities=20%  Similarity=0.236  Sum_probs=169.4

Q ss_pred             cccccCCCCccccCCCCcccc--ccccchhcccccccccc----ccCccchhchhcccccccchhH----HHhhhcceeE
Q psy6359          80 TLADINSHPWVTAGGRGELEL--ELPMMEVIQTHIIPSVE----EIDPDVLQAISNLGCFKQKDLL----IQELLNNQYL  149 (413)
Q Consensus        80 s~~ell~h~~ig~g~~G~V~~--~~~~~~~VAvK~l~~~~----~~d~~il~el~~l~~~~~~~il----~~~l~~~~~l  149 (413)
                      ..+++.....+|.|+||.|++  ...+++.||+|++....    .....+.+|+..+..++|+|++    ..+..+.+||
T Consensus        30 ~~~dy~i~~~lG~G~fg~V~~a~~~~~~~~~AiK~i~k~~~~~~~~~~~~~~E~~il~~l~HpnIv~l~~~~~~~~~~yi  109 (311)
T 4aw0_A           30 RPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYF  109 (311)
T ss_dssp             CGGGEEEEEEEEEETTEEEEEEEETTTCCEEEEEEEEHHHHHHTTCHHHHHHHHHHHTTCCCTTBCCEEEEEECSSEEEE
T ss_pred             CccccEEEEEEecccCeEEEEEEECCCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHHHhCCCCCCCeEEEEEEeCCEEEE
Confidence            345677778899999999985  45788999999986432    2224577899999999999988    1122345899


Q ss_pred             EEeeecCCChhhhhhhcCCCChhhhcc------------------cCCCCCcccccCCCCCEEEccCCCCCCCCCCCC--
Q psy6359         150 ILEHVSGGELFDYLVKKGRLTPKEARN------------------HRDLKPENLLLDEKTNIKIADFGMASLQPNGSN--  209 (413)
Q Consensus       150 v~E~~~~g~L~~~i~~~~~l~~~~~~~------------------HRDlKp~NILl~~~~~~Ki~DFGla~~~~~~~~--  209 (413)
                      |||||+||+|.++|.+.+.+++..++.                  ||||||+|||++.+|.+||+|||+|+.+.....  
T Consensus       110 vmEy~~gG~L~~~i~~~~~l~e~~~~~~~~qi~~al~ylH~~~IiHRDlKPeNILl~~~g~vKl~DFGla~~~~~~~~~~  189 (311)
T 4aw0_A          110 GLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQA  189 (311)
T ss_dssp             EECCCTTEEHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHTTEECSCCSGGGEEECTTSCEEECCCTTCEECCTTTTCC
T ss_pred             EEecCCCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCCccCCCCHHHeEEcCCCCEEEEEcCCceecCCCCCcc
Confidence            999999999999999988999887642                  999999999999999999999999997653321  


Q ss_pred             --CCccccCCCCCCcc---------ccccccceeeEeCCcceeeecccCCChhHHHHHHHHH----HHhHhHHHHHHhhh
Q psy6359         210 --GGGYSYSPQTSPEM---------SKKYWFGQLVVTDKEETITLLVKGKSLAAIKADLIHA----FLTVADLCHNVINP  274 (413)
Q Consensus       210 --~~~~~~~~~~aPE~---------~d~~sfG~~~~~~~~~~~~~~~~g~~l~~~~~~~~~~----~~~i~~~~~~li~~  274 (413)
                        .+..||+.|||||+         +|+||+|+++|....+..++  .+.....+...+...    ...++..+.+||.+
T Consensus       190 ~~~~~~GTp~YmAPEvl~~~~y~~~~DiWSlGvilyeml~G~~PF--~~~~~~~~~~~i~~~~~~~p~~~s~~~~dli~~  267 (311)
T 4aw0_A          190 RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPF--RAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEK  267 (311)
T ss_dssp             CBCCCCSCGGGCCHHHHHHSCBCHHHHHHHHHHHHHHHHHSSCSS--CCSSHHHHHHHHHHTCCCCCTTCCHHHHHHHHH
T ss_pred             cccCcccCcccCCHHHHcCCCCCcHHHHHHHHHHHHHHHhCCCCC--CCCCHHHHHHHHHcCCCCCCcccCHHHHHHHHH
Confidence              24468888999997         89999999977654443333  233333333333322    23578899999999


Q ss_pred             hcccCcccCCChhhh------hcCchhhhhccccccccc
Q psy6359         275 MSFKVEYQRNNARTL------LFQSQVKFQVDITSVKTS  307 (413)
Q Consensus       275 ~l~k~p~kR~s~~~~------l~~~~vk~q~di~~~~~~  307 (413)
                      ||.+||.+|+|+.++      +.|+||+ .+|+..+.++
T Consensus       268 lL~~dp~~R~t~~e~~~~~~i~~Hp~F~-~idw~~l~~~  305 (311)
T 4aw0_A          268 LLVLDATKRLGCEEMEGYGPLKAHPFFE-SVTWENLHQQ  305 (311)
T ss_dssp             HSCSSGGGSTTSGGGTCHHHHHTSGGGT-TCCCTTGGGS
T ss_pred             HccCCHhHCcChHHHcCCHHHHCCCCcC-CCCHHHhcCC
Confidence            999999999999885      4667765 3566666543



>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 413
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-22
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-13
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 8e-20
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-12
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-19
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 9e-09
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 4e-19
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 8e-07
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 5e-19
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 4e-10
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 6e-19
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 5e-12
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 7e-19
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-12
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 8e-19
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 4e-09
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-18
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-09
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-18
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 9e-07
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 3e-18
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-07
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-18
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-14
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-18
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 4e-09
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-17
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 6e-13
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 8e-17
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 7e-06
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 9e-17
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 9e-12
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-16
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 3e-12
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-16
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 5e-08
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-16
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-10
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-16
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-06
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-15
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 6e-05
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-14
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-09
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-14
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 6e-11
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 6e-14
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-12
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-13
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-09
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-13
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-08
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-13
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 4e-06
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-13
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 5e-13
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 0.004
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-12
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-04
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-12
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 5e-07
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-12
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-07
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-12
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 1e-07
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-12
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 7e-06
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-12
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-04
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-12
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-09
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 4e-12
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-09
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-12
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-05
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 6e-12
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 3e-09
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-11
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-06
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 3e-11
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-07
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 3e-11
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-07
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-11
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-04
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-11
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-07
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 5e-11
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-04
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 6e-11
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-06
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 9e-11
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-07
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-10
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-08
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-10
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-06
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-10
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 5e-08
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 5e-10
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 0.003
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 5e-10
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 5e-08
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 6e-10
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-08
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-09
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-06
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-09
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-04
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-08
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 0.002
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 3e-08
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 8e-06
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 4e-08
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 9e-08
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 5e-06
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 1e-07
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 0.002
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-07
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 3e-07
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 7e-07
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 7e-04
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 0.001
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 93.9 bits (233), Expect = 2e-22
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 5   EHPHGEKYDGRRADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQ 64
           E   G  +D  + D+WS GV+ Y  LVG  PF+ +  ++  +++ R  F  P FV    +
Sbjct: 174 EMIEGRMHD-EKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGAR 232

Query: 65  CLLRGMIEVNPEKRMTLADINSHPWVTA 92
            L+  +++ NP +R  L ++  HPW+TA
Sbjct: 233 DLISRLLKHNPSQRPMLREVLEHPWITA 260


>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.97
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.97
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.96
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.96
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.96
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.95
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.95
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.95
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.95
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.95
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.95
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.95
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.95
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.95
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.95
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.94
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.94
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.94
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.94
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.94
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.94
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.94
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.94
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.93
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.93
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.93
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.93
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.93
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.92
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.92
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.92
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.92
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.92
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.92
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.92
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.91
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.91
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.91
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.91
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.91
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.91
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.91
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.91
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.9
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.9
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.9
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.9
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.89
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.89
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.89
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.89
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.89
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.89
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.88
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.88
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.88
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.84
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.81
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.79
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.78
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.76
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.75
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.74
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.73
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.73
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.72
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.72
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.71
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.7
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.69
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.69
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.69
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.69
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.68
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.67
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.66
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.65
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.65
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.64
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.64
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.63
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.63
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.61
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.61
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.61
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.59
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.58
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.58
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.58
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.55
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.55
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.54
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.54
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.53
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.53
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.53
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.53
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.53
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.53
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.51
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.5
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.5
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.49
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.49
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.49
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.46
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.45
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.45
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.45
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.43
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.43
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.39
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.38
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.34
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.32
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.26
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.13
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.02
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 98.99
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 80.06
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=3.4e-33  Score=263.08  Aligned_cols=219  Identities=19%  Similarity=0.238  Sum_probs=167.3

Q ss_pred             ccccccccCCCCccccCCCCccccc--cccchhccccccccc----cccCccchhchhcccccccchhH----HHhhhcc
Q psy6359          77 KRMTLADINSHPWVTAGGRGELELE--LPMMEVIQTHIIPSV----EEIDPDVLQAISNLGCFKQKDLL----IQELLNN  146 (413)
Q Consensus        77 kR~s~~ell~h~~ig~g~~G~V~~~--~~~~~~VAvK~l~~~----~~~d~~il~el~~l~~~~~~~il----~~~l~~~  146 (413)
                      ++++++++.....+|.|+||.|+..  ..+++.||+|++...    ......+.+|+..+..++|+|++    .....+.
T Consensus         1 r~~~l~dy~i~~~iG~G~fg~Vy~~~~~~~~~~vAiK~i~~~~~~~~~~~~~~~~E~~il~~l~hpnIv~~~~~~~~~~~   80 (263)
T d2j4za1           1 RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATR   80 (263)
T ss_dssp             CCCCGGGEEEEEEEEECSSEEEEEEEETTTCCEEEEEEEEHHHHHHTTCHHHHHHHHHHHHTCCCTTBCCEEEEEECSSE
T ss_pred             CCcchhHeEEEEEEecCCCcEEEEEEECCCCcEEEEEEEchHHccChHHHHHHHHHHHHHHhcCCCCCCeEEEEEEECCE
Confidence            3566777777788999999999854  567889999988532    22334577888888889999988    1122345


Q ss_pred             eeEEEeeecCCChhhhhhhcCCCChhhhcc------------------cCCCCCcccccCCCCCEEEccCCCCCCCCCCC
Q psy6359         147 QYLILEHVSGGELFDYLVKKGRLTPKEARN------------------HRDLKPENLLLDEKTNIKIADFGMASLQPNGS  208 (413)
Q Consensus       147 ~~lv~E~~~~g~L~~~i~~~~~l~~~~~~~------------------HRDlKp~NILl~~~~~~Ki~DFGla~~~~~~~  208 (413)
                      +||||||+++|+|.+++...+.+++..+..                  ||||||+|||++.+|.+||+|||+|+......
T Consensus        81 ~~ivmEy~~~g~L~~~l~~~~~l~e~~~~~i~~qi~~al~~lH~~~ivHrDiKp~Nill~~~~~~kl~DFG~a~~~~~~~  160 (263)
T d2j4za1          81 VYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSR  160 (263)
T ss_dssp             EEEEEECCTTCBHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHTTCCCCCCCGGGEEECTTSCEEECCCCSCSCCCCCC
T ss_pred             EEEEEeecCCCcHHHHHhhcCCCCHHHHHHHHHHHHHHHHHHHHCCeeeeeeccccceecCCCCEeecccceeeecCCCc
Confidence            899999999999999999888888876632                  99999999999999999999999999876655


Q ss_pred             CCCccccCCCCCCcc---------ccccccceeeEeCCcceeeecccCCChhHHHHHHHHH----HHhHhHHHHHHhhhh
Q psy6359         209 NGGGYSYSPQTSPEM---------SKKYWFGQLVVTDKEETITLLVKGKSLAAIKADLIHA----FLTVADLCHNVINPM  275 (413)
Q Consensus       209 ~~~~~~~~~~~aPE~---------~d~~sfG~~~~~~~~~~~~~~~~g~~l~~~~~~~~~~----~~~i~~~~~~li~~~  275 (413)
                      .....|++.|||||+         +|+||+|+++|....+..++  .+.........+...    ...++..+.+|+.+|
T Consensus       161 ~~~~~Gt~~Y~APE~~~~~~~~~~~DiwSlGvilyell~G~~Pf--~~~~~~~~~~~i~~~~~~~p~~~s~~~~~li~~~  238 (263)
T d2j4za1         161 RTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPF--EANTYQETYKRISRVEFTFPDFVTEGARDLISRL  238 (263)
T ss_dssp             CEETTEEGGGCCHHHHTTCCCCTTHHHHHHHHHHHHHHHSSCTT--CCSSHHHHHHHHHTTCCCCCTTSCHHHHHHHHHH
T ss_pred             ccccCCCCcccCHHHHcCCCCCchhhhhhHhHHHHHHhcCCCCC--CCCCHHHHHHHHHcCCCCCCccCCHHHHHHHHHH
Confidence            555678888999997         89999999976433322222  233322222222211    124678899999999


Q ss_pred             cccCcccCCChhhhhcCchhhh
Q psy6359         276 SFKVEYQRNNARTLLFQSQVKF  297 (413)
Q Consensus       276 l~k~p~kR~s~~~~l~~~~vk~  297 (413)
                      |.+||.+|||+.+++.|+|+..
T Consensus       239 L~~dp~~R~t~~eil~hp~~~~  260 (263)
T d2j4za1         239 LKHNPSQRPMLREVLEHPWITA  260 (263)
T ss_dssp             TCSSGGGSCCHHHHHTCHHHHH
T ss_pred             ccCCHhHCcCHHHHHcCcCcCC
Confidence            9999999999999999999864



>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure