Diaphorina citri psyllid: psy6361

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MSGTMNVEQAMLLDLIPMHSRYNYTNLPQSRNPGQVIKRYLKDLLYVTRNGSFVINNIAEKDTNVYTCTVSNAAGSTSKTIQMNVLVPPFFKDEQQESVAIVVNHPMNISCSHYGVPTPDFSWYKDGSLLRIQSHYITFFLFFQRLLL
cccEEEcEEEEEEccCEEEEEEEECccccccccccEEEcccccEEEEccccEEEEccccccccCEEEEEEEcccccCEEEEEEEEEcccCECccccEEEEEEccccEEEEEEEEECcccEEEEEEccCEECccccEEEEEEcccEEEc
*****N*EQAMLLDLIPMHSRYNYTNLPQSRNPGQVIKRYLKDLLYVTRNGSFVINNIAEKDTNVYTCTVSNAAGSTSKTIQMNVLVPPFFKDEQQESVAIVVNHPMNISCSHYGVPTPDFSWYKDGSLLRIQSHYITFFLFFQRLLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGTMNVEQAMLLDLIPMHSRYNYTNLPQSRNPGQVIKRYLKDLLYVTRNGSFVINNIAEKDTNVYTCTVSNAAGSTSKTIQMNVLVPPFFKDEQQESVAIVVNHPMNISCSHYGVPTPDFSWYKDGSLLRIQSHYITFFLFFQRLLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0005488 [MF]bindingprobableGO:0003674
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0031672 [CC]A bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0004872 [MF]receptor activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 8-137
View the alignment between query and template
View the model in PyMOL