BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy6372
         (88 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CW1|F Chain F, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|Z Chain Z, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|1 Chain 1, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|2 Chain 2, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|F Chain F, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|I Chain I, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|F Chain F, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|F Chain F, Macromolecular Machine 6
 pdb|4F7U|I Chain I, Macromolecular Machine 6
 pdb|1VU2|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|ZZ Chain z, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|4F77|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|4F77|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|4F77|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|4F77|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|4F77|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|4F77|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|4F77|ZZ Chain z, The 8s Snrnp Assembly Intermediate
          Length = 86

 Score =  115 bits (288), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 59/71 (83%)

Query: 5  LPCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEV 64
          LP NPKPFLN LTGK V+ KLKWG EYKG LVS DGYMN QLA+TEE IDG  +G LGEV
Sbjct: 3  LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEV 62

Query: 65 LIRCNNILYIR 75
          LIRCNN+LYIR
Sbjct: 63 LIRCNNVLYIR 73


>pdb|1N9R|A Chain A, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|B Chain B, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|C Chain C, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|D Chain D, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|E Chain E, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|F Chain F, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|G Chain G, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
          Length = 93

 Score = 82.0 bits (201), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 1  MSTPLPCNPKPFLNLLTGKSVICKLKWGH-EYKGILVSTDGYMNCQLASTEEIIDGHCTG 59
          +S   P NPKPFL  L    V  KLK+   EY+G LVSTD Y N QL   EE + G   G
Sbjct: 14 ISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHG 73

Query: 60 KLGEVLIRCNNILYIR 75
           LGE+ IRCNN+LYIR
Sbjct: 74 TLGEIFIRCNNVLYIR 89


>pdb|1N9S|A Chain A, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|B Chain B, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|C Chain C, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|D Chain D, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|E Chain E, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|F Chain F, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|G Chain G, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|H Chain H, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|I Chain I, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|J Chain J, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|K Chain K, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|L Chain L, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|M Chain M, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|N Chain N, Crystal Structure Of Yeast Smf In Spacegroup P43212
          Length = 93

 Score = 80.1 bits (196), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 1  MSTPLPCNPKPFLNLLTGKSVICKLKWGH-EYKGILVSTDGYMNCQLASTEEIIDGHCTG 59
          +S   P NPKPFL  L    V  KLK+   EY+G LVSTD Y N QL   EE + G   G
Sbjct: 14 ISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHG 73

Query: 60 KLGEVLIRCNNILYIR 75
           LGE+ IR NN+LYIR
Sbjct: 74 TLGEIFIRSNNVLYIR 89


>pdb|3SWN|B Chain B, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|E Chain E, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|Q Chain Q, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|T Chain T, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 77

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 43/70 (61%)

Query: 5  LPCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEV 64
          +  +P  FLN + GK V+ +L  G +YKGIL   DGYMN  L  TEE ++G  T   G+ 
Sbjct: 3  MDSSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYGDA 62

Query: 65 LIRCNNILYI 74
           IR NN+LY+
Sbjct: 63 FIRGNNVLYV 72


>pdb|4EMK|B Chain B, Crystal Structure Of Splsm567
          Length = 75

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 41/69 (59%)

Query: 6  PCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVL 65
            +P  FLN + GK V+ +L  G +YKGIL   DGY N  L  TEE ++G  T   G+  
Sbjct: 2  DSSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYXNLALERTEEYVNGKKTNVYGDAF 61

Query: 66 IRCNNILYI 74
          IR NN+LY+
Sbjct: 62 IRGNNVLYV 70


>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
          Length = 87

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 36/54 (66%)

Query: 21 VICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYI 74
          VI KLK   E++G+L S D +MN  L   EE+ DG  T +LG VLIR +NI+YI
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYI 79


>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
          Length = 86

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 36/54 (66%)

Query: 21 VICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYI 74
          VI KLK   E++G+L S D +MN  L   EE+ DG  T +LG VLIR +NI+YI
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYI 79


>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit
          Length = 85

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 36/54 (66%)

Query: 21 VICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYI 74
          VI KLK   E++G+L S D +MN  L   EE+ DG  T +LG VLIR +NI+YI
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYI 79


>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
          Length = 83

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 36/54 (66%)

Query: 21 VICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYI 74
          VI KLK   E++G+L S D +MN  L   EE+ DG  T +LG VLIR +NI+YI
Sbjct: 28 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYI 81


>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
          Length = 77

 Score = 52.0 bits (123), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 5  LPCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEV 64
          +P  P   LN      VI +LK G E++G L   D +MN  L   EEI +G    K+G V
Sbjct: 1  MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSV 60

Query: 65 LIRCNNILYI 74
          +IR + ++++
Sbjct: 61 VIRGDTVVFV 70


>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 52.0 bits (123), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 18 GKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYI 74
          GK V+ KL+  HE +GIL S D ++N  L   EEIIDG+   K G +++R  N+L+I
Sbjct: 21 GKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVY-KRGTMVVRGENVLFI 76


>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
          Length = 75

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 19 KSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYI 74
          K V+  LK G E++G L+  D ++N  LA  E I DG    + G+++IR +N+L I
Sbjct: 15 KDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAI 70


>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 19 KSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYI 74
          K V+  LK G E++G L+  D ++N  LA  E I DG    + G+++IR +N+L I
Sbjct: 17 KDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAI 72


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%)

Query: 21 VICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRCNNILYI 74
          V+ KLK   E +G+L S D +MN  L+ +EEI       KLG ++IR +N++ I
Sbjct: 22 VLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTIVIRGDNVILI 75


>pdb|4EMH|A Chain A, Crystal Structure Of Splsm4
 pdb|4EMH|B Chain B, Crystal Structure Of Splsm4
 pdb|4EMH|C Chain C, Crystal Structure Of Splsm4
 pdb|4EMH|D Chain D, Crystal Structure Of Splsm4
 pdb|4EMH|E Chain E, Crystal Structure Of Splsm4
 pdb|4EMH|F Chain F, Crystal Structure Of Splsm4
 pdb|4EMH|G Chain G, Crystal Structure Of Splsm4
 pdb|4EMH|H Chain H, Crystal Structure Of Splsm4
 pdb|4EMH|I Chain I, Crystal Structure Of Splsm4
 pdb|4EMH|J Chain J, Crystal Structure Of Splsm4
 pdb|4EMH|K Chain K, Crystal Structure Of Splsm4
 pdb|4EMH|L Chain L, Crystal Structure Of Splsm4
 pdb|4EMH|M Chain M, Crystal Structure Of Splsm4
 pdb|4EMH|N Chain N, Crystal Structure Of Splsm4
 pdb|4EMH|O Chain O, Crystal Structure Of Splsm4
 pdb|4EMH|P Chain P, Crystal Structure Of Splsm4
 pdb|4EMH|Q Chain Q, Crystal Structure Of Splsm4
 pdb|4EMH|R Chain R, Crystal Structure Of Splsm4
 pdb|4EMH|T Chain T, Crystal Structure Of Splsm4
 pdb|4EMH|U Chain U, Crystal Structure Of Splsm4
 pdb|4EMH|V Chain V, Crystal Structure Of Splsm4
 pdb|4EMH|W Chain W, Crystal Structure Of Splsm4
 pdb|4EMH|X Chain X, Crystal Structure Of Splsm4
 pdb|4EMH|Y Chain Y, Crystal Structure Of Splsm4
          Length = 105

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 6  PCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEII----DGHCTGKL 61
          P  P   LN   G+ ++ +LK G  + G L + D Y N  L    E+I    DG    +L
Sbjct: 14 PXLPLTLLNATQGRPILVELKNGETFNGHLENCDNYXNLTL---REVIRTXPDGDKFFRL 70

Query: 62 GEVLIRCNNILYIR 75
           E  IR NNI Y+R
Sbjct: 71 PECYIRGNNIKYLR 84


>pdb|3PGW|Z Chain Z, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|W Chain W, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
          Length = 126

 Score = 33.9 bits (76), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 9  PKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLAS-TEEIIDGHCTGKLGEVLIR 67
          P   L+   G  V C+   G  Y+G L+  +  MNCQ+++ T    DG    +L +V IR
Sbjct: 6  PIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVA-QLEQVYIR 64

Query: 68 CNNILYI 74
           + I ++
Sbjct: 65 GSKIRFL 71


>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|G Chain G, Macromolecular Machine 6
 pdb|4F7U|J Chain J, Macromolecular Machine 6
 pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
          Length = 76

 Score = 32.3 bits (72), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 1  MSTPLPCNPKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGK 60
          MS   P   K F++    K +  KL  G   +GIL   D +MN  +    E+        
Sbjct: 1  MSKAHPPELKKFMD----KKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNN 56

Query: 61 LGEVLIRCNNILYI 74
          +G V+IR N+I+ +
Sbjct: 57 IGMVVIRGNSIIML 70


>pdb|1D3B|A Chain A, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|C Chain C, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|E Chain E, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|G Chain G, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|I Chain I, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|K Chain K, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
          Length = 75

 Score = 32.0 bits (71), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 9  PKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIR 67
          P   L+   G  V C+   G  Y+G L+  +  MNCQ+++           +L +V IR
Sbjct: 6  PIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIR 64


>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From
          Archaeoglobus Fulgidus At 1.95a Resolution
          Length = 77

 Score = 32.0 bits (71), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 9  PKPFLNLLTGKSVICKLKWGHEYK--GILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLI 66
          P   +  + GK +  ++K G E +  G L   D YMN  L +  E         LGE+++
Sbjct: 6  PNQMVKSMVGKIIRVEMK-GEENQLVGKLEGVDDYMNLYLTNAMECKGEEKVRSLGEIVL 64

Query: 67 RCNNILYIR 75
          R NN++ I+
Sbjct: 65 RGNNVVLIQ 73


>pdb|3CW1|D Chain D, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|S Chain S, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|T Chain T, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|U Chain U, Crystal Structure Of Human Spliceosomal U1 Snrnp
          Length = 126

 Score = 31.6 bits (70), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%)

Query: 9  PKPFLNLLTGKSVICKLKWGHEYKGILVSTDGYMNCQLASTEEIIDGHCTGKLGEVLIRC 68
          P   L+   G  V C+   G  Y+G L+  +  MNCQ+++           +L +V IR 
Sbjct: 6  PIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRG 65

Query: 69 NNILYI 74
            I ++
Sbjct: 66 CKIRFL 71


>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
          Length = 117

 Score = 29.3 bits (64), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 7/63 (11%)

Query: 19  KSVICKLKWGHEYKGILVSTDGYMNCQLASTEEII----DGHCTG---KLGEVLIRCNNI 71
           + +      G +  GIL   D  MN  L   EE +    DG  TG   KLG V++R   +
Sbjct: 38  QRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTTL 97

Query: 72  LYI 74
           + I
Sbjct: 98  VLI 100


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.142    0.459 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,376,450
Number of Sequences: 62578
Number of extensions: 78237
Number of successful extensions: 211
Number of sequences better than 100.0: 22
Number of HSP's better than 100.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 190
Number of HSP's gapped (non-prelim): 22
length of query: 88
length of database: 14,973,337
effective HSP length: 56
effective length of query: 32
effective length of database: 11,468,969
effective search space: 367007008
effective search space used: 367007008
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)