Query         psy6382
Match_columns 125
No_of_seqs    75 out of 77
Neff          2.5 
Searched_HMMs 46136
Date          Sat Aug 17 01:01:30 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6382.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6382hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3938|consensus              100.0 1.7E-36 3.7E-41  254.2   9.1   93   32-124     1-102 (334)
  2 PF00240 ubiquitin:  Ubiquitin   76.8     3.7 7.9E-05   25.5   3.1   29   90-118    11-39  (69)
  3 cd00196 UBQ Ubiquitin-like pro  74.5     4.5 9.7E-05   21.5   2.7   28   92-119    15-42  (69)
  4 PF14552 Tautomerase_2:  Tautom  71.2     3.6 7.7E-05   28.5   2.2   25   96-120    44-72  (82)
  5 COG4229 Predicted enolase-phos  70.5       3 6.5E-05   34.9   2.0   50   71-121   130-186 (229)
  6 cd03413 CbiK_C Anaerobic cobal  70.5     5.9 0.00013   28.0   3.2   33   82-121     6-39  (103)
  7 PF11543 UN_NPL4:  Nuclear pore  69.2     3.6 7.9E-05   28.2   1.8   26   90-115    19-44  (80)
  8 PF13419 HAD_2:  Haloacid dehal  67.0     5.7 0.00012   26.6   2.4   25   95-119   133-157 (176)
  9 cd01803 Ubiquitin Ubiquitin. U  65.3     6.8 0.00015   24.5   2.4   29   90-118    16-44  (76)
 10 cd01807 GDX_N ubiquitin-like d  63.5     5.3 0.00011   25.7   1.7   26   90-115    16-41  (74)
 11 PF01282 Ribosomal_S24e:  Ribos  62.5     9.4  0.0002   26.5   2.9   30   95-124    13-42  (84)
 12 KOG2630|consensus               62.5     5.5 0.00012   33.8   2.0   49   73-122   152-207 (254)
 13 cd06398 PB1_Joka2 The PB1 doma  59.1      11 0.00025   26.6   2.8   22   96-117    26-48  (91)
 14 cd01791 Ubl5 UBL5 ubiquitin-li  58.8       9  0.0002   25.5   2.2   29   90-118    17-45  (73)
 15 cd01806 Nedd8 Nebb8-like  ubiq  57.7      15 0.00033   22.8   3.0   29   90-118    16-44  (76)
 16 cd01793 Fubi Fubi ubiquitin-li  56.9     8.6 0.00019   24.8   1.8   26   90-115    14-39  (74)
 17 cd01808 hPLIC_N Ubiquitin-like  56.8     8.3 0.00018   24.6   1.7   25   91-115    16-40  (71)
 18 smart00760 Bac_DnaA_C Bacteria  54.7     4.5 9.7E-05   25.6   0.2   21   96-116     1-21  (60)
 19 cd01796 DDI1_N DNA damage indu  54.6     9.5 0.00021   24.7   1.7   25   90-114    15-39  (71)
 20 cd01804 midnolin_N Ubiquitin-l  54.5      13 0.00028   24.6   2.4   26   91-116    18-43  (78)
 21 cd01794 DC_UbP_C dendritic cel  54.4     8.4 0.00018   25.3   1.5   26   90-115    14-39  (70)
 22 cd01792 ISG15_repeat1 ISG15 ub  53.1     9.8 0.00021   25.0   1.6   27   91-117    19-45  (80)
 23 cd01810 ISG15_repeat2 ISG15 ub  53.0      15 0.00033   23.6   2.5   27   90-116    14-40  (74)
 24 cd01798 parkin_N amino-termina  51.8      14 0.00031   23.3   2.2   27   91-117    15-41  (70)
 25 PRK02220 4-oxalocrotonate taut  51.4      13 0.00028   22.8   1.9   22   99-121    23-44  (61)
 26 PF02071 NSF:  Aromatic-di-Alan  51.1     7.9 0.00017   19.0   0.7   10   99-108     3-12  (12)
 27 cd03072 PDI_b'_ERp44 PDIb' fam  50.7      12 0.00026   26.3   1.9   30   91-123    26-58  (111)
 28 cd02982 PDI_b'_family Protein   49.7      20 0.00044   23.0   2.7   28   93-123    26-53  (103)
 29 PRK01964 4-oxalocrotonate taut  49.6      14 0.00031   23.1   1.9   19   98-116    22-40  (64)
 30 cd01802 AN1_N ubiquitin-like d  49.4      13 0.00029   26.3   1.9   40   74-115    28-68  (103)
 31 cd01805 RAD23_N Ubiquitin-like  48.1      23 0.00049   22.4   2.7   26   91-116    17-44  (77)
 32 TIGR00013 taut 4-oxalocrotonat  46.7      20 0.00043   22.0   2.2   21   97-117    21-41  (63)
 33 TIGR01691 enolase-ppase 2,3-di  46.2      14  0.0003   29.1   1.8   25   95-119   152-176 (220)
 34 smart00213 UBQ Ubiquitin homol  45.4      24 0.00052   20.8   2.4   28   89-116    14-41  (64)
 35 PF13647 Glyco_hydro_80:  Glyco  44.3      12 0.00026   31.9   1.3   24   75-99    201-224 (308)
 36 cd03409 Chelatase_Class_II Cla  43.9      40 0.00088   21.9   3.5   37   82-121     5-41  (101)
 37 PF01337 Barstar:  Barstar (bar  43.1      19 0.00042   23.9   1.9   21   92-112     6-26  (90)
 38 cd06406 PB1_P67 A PB1 domain i  41.9      21 0.00046   25.4   2.0   23   95-117    21-43  (80)
 39 COG2411 Uncharacterized conser  41.6      19 0.00042   29.5   2.0   27   89-115    71-98  (188)
 40 KOG3889|consensus               41.2      19  0.0004   32.0   1.9   37   73-110   202-241 (371)
 41 cd01812 BAG1_N Ubiquitin-like   41.0      23  0.0005   21.9   1.9   24   91-114    16-39  (71)
 42 cd01769 UBL Ubiquitin-like dom  39.5      41 0.00089   20.0   2.8   26   92-117    15-40  (69)
 43 PF08299 Bac_DnaA_C:  Bacterial  38.4     9.9 0.00022   25.1  -0.1   21   96-116     1-21  (70)
 44 cd01763 Sumo Small ubiquitin-r  38.2      34 0.00074   23.0   2.5   45   72-118    10-55  (87)
 45 PRK11053 dihydropteridine redu  37.8      31 0.00067   26.1   2.5   37   83-124   156-193 (217)
 46 PF11976 Rad60-SLD:  Ubiquitin-  37.5      49  0.0011   20.7   3.0   29   90-118    16-45  (72)
 47 TIGR01493 HAD-SF-IA-v2 Haloaci  37.5      25 0.00055   24.7   1.8   25   95-119   139-163 (175)
 48 PF13443 HTH_26:  Cro/C1-type H  37.2     7.5 0.00016   23.8  -0.8   19   99-117    41-59  (63)
 49 COG1011 Predicted hydrolase (H  37.1      30 0.00065   25.1   2.2   22   97-118   156-177 (229)
 50 PF07027 DUF1318:  Protein of u  36.8      13 0.00027   26.8   0.2   18   98-115    50-67  (95)
 51 PF14338 Mrr_N:  Mrr N-terminal  36.7      16 0.00036   24.6   0.8   20   95-114    20-39  (92)
 52 cd00491 4Oxalocrotonate_Tautom  36.7      36 0.00078   20.3   2.2   22   98-120    21-42  (58)
 53 cd05875 Ig6_hNeurofascin_like   36.2      22 0.00049   22.8   1.3   21   76-97      1-21  (77)
 54 TIGR01509 HAD-SF-IA-v3 haloaci  35.5      40 0.00087   23.4   2.6   21   98-118   143-163 (183)
 55 cd00419 Ferrochelatase_C Ferro  35.3      43 0.00094   24.5   2.8   46   73-121    18-67  (135)
 56 PF12436 USP7_ICP0_bdg:  ICP0-b  35.2      38 0.00082   27.1   2.7   35   88-122   193-227 (249)
 57 cd06552 ASCH_yqfb_like ASC-1 h  34.1      60  0.0013   21.7   3.2   30   89-118    65-95  (100)
 58 PRK04635 histidinol-phosphate   34.0      27 0.00059   27.9   1.7   22   97-118    62-83  (354)
 59 PF14566 PTPlike_phytase:  Inos  33.9      17 0.00038   26.7   0.6   11   73-83    124-134 (149)
 60 PRK00745 4-oxalocrotonate taut  33.9      40 0.00086   20.6   2.1   25   97-122    17-45  (62)
 61 cd02984 TRX_PICOT TRX domain,   33.7      40 0.00088   21.3   2.2   30   72-105    68-97  (97)
 62 cd01809 Scythe_N Ubiquitin-lik  33.5      36 0.00078   20.9   1.9   24   91-114    17-40  (72)
 63 PRK05365 malonic semialdehyde   33.3      46 0.00099   24.8   2.7   37   83-124   137-173 (195)
 64 cd01797 NIRF_N amino-terminal   33.3      26 0.00056   23.4   1.3   24   91-114    19-42  (78)
 65 cd05140 Barstar_AU1054-like Ba  32.7      36 0.00077   23.7   1.9   22   91-112     5-26  (86)
 66 TIGR01428 HAD_type_II 2-haloal  32.4      42 0.00092   24.2   2.4   24   96-119   149-172 (198)
 67 cd05142 Barstar Barstar is an   32.1      37 0.00081   23.6   2.0   21   92-112     7-27  (87)
 68 cd05749 Ig2_Tyro3_like Second   32.0      31 0.00068   22.8   1.5   22   73-95     13-35  (81)
 69 cd03073 PDI_b'_ERp72_ERp57 PDI  31.2      34 0.00073   24.2   1.6   41   76-122    19-59  (111)
 70 PRK07908 hypothetical protein;  31.2      36 0.00077   27.0   1.9   23   97-119    60-82  (349)
 71 cd05141 Barstar_evA4336-like B  31.2      40 0.00088   22.6   2.0   21   91-111     5-25  (81)
 72 PF08769 Spo0A_C:  Sporulation   30.7      10 0.00022   27.4  -1.1   19   97-115    39-57  (106)
 73 PF12844 HTH_19:  Helix-turn-he  30.5      12 0.00026   22.9  -0.6   18   99-116    42-59  (64)
 74 PTZ00044 ubiquitin; Provisiona  30.4      55  0.0012   20.6   2.4   27   90-116    16-42  (76)
 75 PRK09456 ?-D-glucose-1-phospha  30.2      40 0.00086   24.7   1.9   23   96-118   142-164 (199)
 76 TIGR03235 DNA_S_dndA cysteine   30.1      51  0.0011   26.0   2.6   23   97-119    44-66  (353)
 77 cd06409 PB1_MUG70 The MUG70 pr  30.1      50  0.0011   23.5   2.3   28   86-113     7-39  (86)
 78 TIGR03402 FeS_nifS cysteine de  29.4      53  0.0011   26.2   2.6   24   96-119    43-66  (379)
 79 PHA01976 helix-turn-helix prot  29.2      17 0.00036   22.4  -0.2   19   99-117    45-63  (67)
 80 TIGR02006 IscS cysteine desulf  29.1      53  0.0012   26.8   2.7   24   96-119    48-71  (402)
 81 TIGR01656 Histidinol-ppas hist  29.0      45 0.00097   23.6   2.0   24   95-118   101-124 (147)
 82 cd02137 Nitroreductase_1 Nitro  28.8      60  0.0013   22.8   2.6   36   84-124    96-131 (148)
 83 TIGR01068 thioredoxin thioredo  27.2      92   0.002   19.2   3.0   33   72-107    68-100 (101)
 84 PF05402 PqqD:  Coenzyme PQQ sy  27.0      23 0.00049   22.1   0.2   25   91-115    26-50  (68)
 85 cd02138 Nitroreductase_2 Nitro  26.9      70  0.0015   23.4   2.7   36   84-124   118-153 (181)
 86 cd00489 Barstar_like Barstar i  26.5      53  0.0012   22.6   1.9   21   92-112     6-26  (85)
 87 PLN02651 cysteine desulfurase   26.4      66  0.0014   25.7   2.7   23   97-119    45-67  (364)
 88 cd02139 Nitroreductase_3 Nitro  25.8      98  0.0021   21.9   3.3   36   84-124   111-146 (164)
 89 cd02149 NfsB_like_nitroreducta  25.7      64  0.0014   22.9   2.3   36   84-124   104-140 (157)
 90 TIGR01662 HAD-SF-IIIA HAD-supe  25.4      62  0.0013   22.0   2.1   24   96-119    86-110 (132)
 91 PF12833 HTH_18:  Helix-turn-he  25.4      26 0.00057   22.1   0.2   25   91-115    54-78  (81)
 92 PF11784 DUF3320:  Protein of u  25.3      51  0.0011   20.9   1.5   21   92-112    24-44  (52)
 93 PF12872 OST-HTH:  OST-HTH/LOTU  25.2      41 0.00089   21.1   1.1   18   93-110    46-63  (74)
 94 cd02148 Nitroreductase_5 Nitro  24.8      83  0.0018   23.1   2.8   37   83-124   130-166 (185)
 95 PF08281 Sigma70_r4_2:  Sigma-7  24.7      17 0.00038   21.7  -0.7   15  100-114    28-42  (54)
 96 PF07736 CM_1:  Chorismate muta  24.7      74  0.0016   24.1   2.5   26   95-120    20-45  (118)
 97 cd02150 NADPH_oxidoreductase_1  23.9      95  0.0021   22.2   2.9   40   84-124   106-145 (166)
 98 TIGR03192 benz_CoA_bzdQ benzoy  23.9 1.1E+02  0.0023   26.1   3.6   44   75-124    53-96  (293)
 99 PF00564 PB1:  PB1 domain;  Int  23.9      97  0.0021   19.7   2.7   27   92-118    19-45  (84)
100 PRK14012 cysteine desulfurase;  23.5      76  0.0016   25.8   2.6   24   96-119    50-73  (404)
101 PRK05849 hypothetical protein;  23.4      40 0.00087   32.1   1.1   32   90-121   595-626 (783)
102 PF13844 Glyco_transf_41:  Glyc  23.1      54  0.0012   29.5   1.8   19  106-124   277-295 (468)
103 TIGR02253 CTE7 HAD superfamily  22.8      76  0.0016   23.1   2.3   22   97-118   152-173 (221)
104 TIGR01993 Pyr-5-nucltdase pyri  22.8      86  0.0019   22.4   2.5   23   96-118   142-164 (184)
105 PRK01533 histidinol-phosphate   22.5      65  0.0014   26.3   2.0   23   97-119    66-88  (366)
106 PRK05387 histidinol-phosphate   22.5      53  0.0012   25.7   1.5   21   98-118    63-83  (353)
107 PF14109 GldH_lipo:  GldH lipop  22.3      22 0.00049   26.1  -0.6   25   74-100    66-92  (131)
108 PRK02289 4-oxalocrotonate taut  22.2      77  0.0017   19.8   1.9   19   97-115    21-39  (60)
109 COG3384 Aromatic ring-opening   22.2      80  0.0017   27.0   2.6   36   80-116    12-48  (268)
110 KOG1175|consensus               22.2      59  0.0013   30.5   1.9   40   73-124   253-292 (626)
111 TIGR02512 Fe_only_hydrog hydro  22.2      33 0.00071   28.8   0.3   31   89-119   331-362 (374)
112 cd09216 GH64-LPHase-like glyco  22.1      34 0.00073   30.0   0.3   41   72-118   216-261 (353)
113 cd01799 Hoil1_N Ubiquitin-like  22.0      68  0.0015   21.4   1.7   26   90-115    18-43  (75)
114 cd02146 NfsA_FRP This family c  22.0 1.1E+02  0.0025   23.4   3.2   38   84-124   124-161 (229)
115 PF00881 Nitroreductase:  Nitro  21.9      27 0.00058   23.6  -0.2   38   83-124   128-165 (165)
116 smart00530 HTH_XRE Helix-turn-  21.9      64  0.0014   16.9   1.3   17   98-114    39-55  (56)
117 PRK10874 cysteine sulfinate de  21.9      88  0.0019   25.2   2.6   24   96-119    64-88  (401)
118 PRK01688 histidinol-phosphate   21.9      57  0.0012   26.2   1.6   21   98-118    60-80  (351)
119 cd02152 OAT Ornithine acetyltr  21.9      53  0.0011   29.1   1.5   28   92-119    75-102 (390)
120 TIGR02252 DREG-2 REG-2-like, H  21.6      71  0.0015   23.1   1.9   22   97-118   162-183 (203)
121 PF11000 DUF2840:  Protein of u  21.5      55  0.0012   26.0   1.4   26   90-115    87-114 (149)
122 cd02145 BluB Subfamily of the   21.4 1.2E+02  0.0026   22.4   3.1   36   84-124   135-170 (196)
123 PRK09105 putative aminotransfe  21.4      73  0.0016   26.0   2.1   21   97-117    80-100 (370)
124 cd02062 Nitro_FMN_reductase Pr  21.3 1.2E+02  0.0026   19.9   2.8   38   84-124    85-122 (122)
125 smart00666 PB1 PB1 domain. Pho  21.3 1.1E+02  0.0025   19.4   2.6   21   96-116    22-42  (81)
126 cd06452 SepCysS Sep-tRNA:Cys-t  21.2 1.1E+02  0.0025   24.2   3.1   36   73-118    30-65  (361)
127 cd03370 NADH_oxidase NADPH_oxi  20.9 1.2E+02  0.0026   21.6   3.0   35   85-124   106-141 (156)
128 COG2169 Ada Adenosine deaminas  20.9      46   0.001   26.9   0.9   35   80-114   140-177 (187)
129 PF13560 HTH_31:  Helix-turn-he  20.6      30 0.00066   21.5  -0.2   17   98-114    44-60  (64)
130 COG4031 Predicted metal-bindin  20.5      91   0.002   26.3   2.5   26   84-115    51-77  (227)
131 PF05099 TerB:  Tellurite resis  20.5      73  0.0016   22.0   1.7   20   96-115   116-135 (140)
132 PF11834 DUF3354:  Domain of un  20.4 1.3E+02  0.0029   20.5   2.9   38   78-115     9-46  (69)
133 cd01615 CIDE_N CIDE_N domain,   20.4 1.2E+02  0.0027   21.4   2.8   24   95-118    21-44  (78)
134 PRK14809 histidinol-phosphate   20.2      83  0.0018   25.0   2.1   22   97-118    67-88  (357)
135 PF12085 DUF3562:  Protein of u  20.2      42  0.0009   23.3   0.4   21   95-115     4-24  (66)
136 PTZ00397 macrophage migration   20.0      92   0.002   21.6   2.1   21   98-118    75-99  (116)

No 1  
>KOG3938|consensus
Probab=100.00  E-value=1.7e-36  Score=254.19  Aligned_cols=93  Identities=41%  Similarity=0.708  Sum_probs=81.0

Q ss_pred             cccCCCCCCCCCcccccCCCCCCCC----cccCC-----CCCCCCCCCCCCCceEEeeecccCCCceeecCccchHHHHH
Q psy6382          32 MPLFTRKPKKDDHLLDNNNVGEHKS----KIYNG-----TKSPAPVTEDSKPKLIFHCQLAHGSPTGLISGFSNVRELYQ  102 (125)
Q Consensus        32 MPLGLr~kKK~~~Lvene~~~p~~~----~~~~~-----~ggl~p~~~~~~p~LvFh~QLAHGSptg~I~gFsnVkELY~  102 (125)
                      |||+.++.+|.++.+++..+.+..|    ++..+     ..++++.+++.+|+||||||||||||||+|+||+||+||||
T Consensus         1 M~~~~~~~~k~~~~~~~~~a~~~rs~e~~p~~~~~~~s~~~~s~s~~~~~~p~LvF~~QLAHGSptg~Ie~fsnv~ELY~   80 (334)
T KOG3938|consen    1 MPLQGRPSPKSRPRSEGRGAFNARSGETSPLQPGVPISPNEGSPSIPPAVRPRLVFHCQLAHGSPTGRIEGFSNVRELYQ   80 (334)
T ss_pred             CCCCCCCCCCCCCccccccccccCCCCCCCCCCCCCCCccCCCCCCCccCCCceeEeeeeccCCccceecccccHHHHHH
Confidence            8999999999999999988866322    22222     11568888999999999999999999999999999999999


Q ss_pred             hhhhhhccCCCceEEEEccCCC
Q psy6382         103 KIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus       103 kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      +|||||+|+++||||||||+|-
T Consensus        81 kIAe~F~Is~~dIlfcTlNshK  102 (334)
T KOG3938|consen   81 KIAEAFDISPDDILFCTLNSHK  102 (334)
T ss_pred             HHHHHhcCCccceEEEecCCCc
Confidence            9999999999999999999984


No 2  
>PF00240 ubiquitin:  Ubiquitin family;  InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade. There are many different E3 ligases, which are responsible for the type of ubiquitin chain formed, the specificity of the target protein, and the regulation of the ubiquitinylation process []. Ubiquitinylation is an important regulatory tool that controls the concentration of key signalling proteins, such as those involved in cell cycle control, as well as removing misfolded, damaged or mutant proteins that could be harmful to the cell. Several ubiquitin-like molecules have been discovered, such as Ufm1 (IPR005375 from INTERPRO), SUMO1 (IPR003653 from INTERPRO), NEDD8, Rad23 (IPR004806 from INTERPRO), Elongin B and Parkin (IPR003977 from INTERPRO), the latter being involved in Parkinson's disease []. Ubiquitin is a protein of 76 amino acid residues, found in all eukaryotic cells and whose sequence is extremely well conserved from protozoan to vertebrates. Ubiquitin acts through its post-translational attachment (ubiquitinylation) to other proteins, where these modifications alter the function, location or trafficking of the protein, or targets it for destruction by the 26S proteasome []. The terminal glycine in the C-terminal 4-residue tail of ubiquitin can form an isopeptide bond with a lysine residue in the target protein, or with a lysine in another ubiquitin molecule to form a ubiquitin chain that attaches itself to a target protein. Ubiquitin has seven lysine residues, any one of which can be used to link ubiquitin molecules together, resulting in different structures that alter the target protein in different ways. It appears that Lys(11)-, Lys(29) and Lys(48)-linked poly-ubiquitin chains target the protein to the proteasome for degradation, while mono-ubiquitinylated and Lys(6)- or Lys(63)-linked poly-ubiquitin chains signal reversible modifications in protein activity, location or trafficking []. For example, Lys(63)-linked poly-ubiquitinylation is known to be involved in DNA damage tolerance, inflammatory response, protein trafficking and signal transduction through kinase activation []. In addition, the length of the ubiquitin chain alters the fate of the target protein. Regulatory proteins such as transcription factors and histones are frequent targets of ubquitinylation [].; GO: 0005515 protein binding; PDB: 2DZI_A 2XEW_E 3NOB_E 2KWU_B 2Y5B_F 3PHD_G 2KWV_B 2KOX_A 2XK5_B 3NHE_B ....
Probab=76.78  E-value=3.7  Score=25.52  Aligned_cols=29  Identities=31%  Similarity=0.289  Sum_probs=25.5

Q ss_pred             eecCccchHHHHHhhhhhhccCCCceEEE
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      .|+...+|.+|-++|++..++|++++-++
T Consensus        11 ~v~~~~tV~~lK~~i~~~~~~~~~~~~L~   39 (69)
T PF00240_consen   11 EVDPDDTVADLKQKIAEETGIPPEQQRLI   39 (69)
T ss_dssp             EEETTSBHHHHHHHHHHHHTSTGGGEEEE
T ss_pred             EECCCCCHHHhhhhcccccccccccceee
Confidence            46678899999999999999999988765


No 3  
>cd00196 UBQ Ubiquitin-like proteins. Ubiquitin homologs; Includes ubiquitin and ubiquitin-like proteins. Ubiquitin-mediated proteolysis is part of the regulated turnover of proteins required for controlling cell cycle progression. Other family members are protein modifiers that perform a wide range of functions. Ubiquitination usually results in a covalent bond between the C-terminus of ubiquitin and the epsilon-amino group of a substrate lysine. The three-step mechanism requires an activating enzyme (E1) that forms a thiol ester with the C-terminal carboxy group, a conjugating enzyme (E2) that transiently carries the activated ubiquitin molecule as a thiol ester, and a ligase (E3) that transfers the activated ubiquitin from the E2 to the substrate lysine residue. In poly-ubiquitination, ubiquitin itself is the substrate.
Probab=74.45  E-value=4.5  Score=21.52  Aligned_cols=28  Identities=21%  Similarity=0.306  Sum_probs=23.7

Q ss_pred             cCccchHHHHHhhhhhhccCCCceEEEE
Q psy6382          92 SGFSNVRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        92 ~gFsnVkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      ..-.+++++.++|++.+++++++..++.
T Consensus        15 ~~~~tv~~l~~~i~~~~~~~~~~~~l~~   42 (69)
T cd00196          15 PSGTTVADLKEKLAKKLGLPPEQQRLLV   42 (69)
T ss_pred             CCCCcHHHHHHHHHHHHCcChHHeEEEE
Confidence            3468899999999999999888877764


No 4  
>PF14552 Tautomerase_2:  Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C.
Probab=71.19  E-value=3.6  Score=28.46  Aligned_cols=25  Identities=24%  Similarity=0.364  Sum_probs=16.2

Q ss_pred             chHHHHHhhh----hhhccCCCceEEEEc
Q psy6382          96 NVRELYQKIA----ECYEFPAEEVQFGAL  120 (125)
Q Consensus        96 nVkELY~kIA----e~f~i~~~eIlFCTL  120 (125)
                      --++||+.|+    +..+|+|+|||..-.
T Consensus        44 ~K~~ly~~l~~~L~~~~gi~p~Dv~I~l~   72 (82)
T PF14552_consen   44 QKKALYRALAERLAEKLGIRPEDVMIVLV   72 (82)
T ss_dssp             HHHHHHHHHHHHHHHHH---GGGEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHcCCCHHHEEEEEE
Confidence            3467888887    567899999987643


No 5  
>COG4229 Predicted enolase-phosphatase [Energy production and conversion]
Probab=70.55  E-value=3  Score=34.87  Aligned_cols=50  Identities=30%  Similarity=0.365  Sum_probs=36.9

Q ss_pred             CCCCceEEeeecccCCCceeecCccch-------HHHHHhhhhhhccCCCceEEEEcc
Q psy6382          71 DSKPKLIFHCQLAHGSPTGLISGFSNV-------RELYQKIAECYEFPAEEVQFGALL  121 (125)
Q Consensus        71 ~~~p~LvFh~QLAHGSptg~I~gFsnV-------kELY~kIAe~f~i~~~eIlFCTLN  121 (125)
                      ....+|.|-|--| |-=-+.++||-+.       ...|++||+..+++|.||||..=|
T Consensus       130 V~AQkL~Fghs~a-gdL~~lfsGyfDttiG~KrE~~SY~kIa~~iGl~p~eilFLSDn  186 (229)
T COG4229         130 VKAQKLFFGHSDA-GDLNSLFSGYFDTTIGKKRESQSYAKIAGDIGLPPAEILFLSDN  186 (229)
T ss_pred             chhHHHhhccccc-ccHHhhhcceeeccccccccchhHHHHHHhcCCCchheEEecCC
Confidence            3456788877632 4445567777543       568999999999999999997644


No 6  
>cd03413 CbiK_C Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), C-terminal domain. CbiK is part of the cobalt-early path for cobalamin biosynthesis. It catalyzes the insertion of cobalt into the oxidized form of precorrin-2, factor II (sirohydrochlorin), the second step of the anaerobic branch of vitamin B12 biosynthesis. CbiK belongs to the class II family of chelatases, and is a homomeric enzyme that does not require ATP for its enzymatic activity.
Probab=70.46  E-value=5.9  Score=27.98  Aligned_cols=33  Identities=18%  Similarity=0.310  Sum_probs=24.5

Q ss_pred             cccCCCceeecCccchHHHHHhhhhhhc-cCCCceEEEEcc
Q psy6382          82 LAHGSPTGLISGFSNVRELYQKIAECYE-FPAEEVQFGALL  121 (125)
Q Consensus        82 LAHGSptg~I~gFsnVkELY~kIAe~f~-i~~~eIlFCTLN  121 (125)
                      ++|||+--     +  .+.|+.+++.+. ..+..|..|++.
T Consensus         6 vgHGSr~~-----~--~~~~~~l~~~l~~~~~~~v~~~~lE   39 (103)
T cd03413           6 MGHGTDHP-----S--NAVYAALEYVLREEDPANVFVGTVE   39 (103)
T ss_pred             EECCCCch-----h--hhHHHHHHHHHHhcCCCcEEEEEEc
Confidence            78999875     2  267888887774 444778889987


No 7  
>PF11543 UN_NPL4:  Nuclear pore localisation protein NPL4;  InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway.  Npl4 has a N-terminal ubiquitin-like domain which has within its structure a beta-grasp fold with a helical insert []. This entry represents the ubiquitin-like domain.; PDB: 2PJH_A 1WF9_A.
Probab=69.20  E-value=3.6  Score=28.17  Aligned_cols=26  Identities=27%  Similarity=0.330  Sum_probs=17.6

Q ss_pred             eecCccchHHHHHhhhhhhccCCCce
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      .|+.=+++.+||++|++.++++...+
T Consensus        19 e~~~~~t~~~L~~kI~~~l~~~~~~~   44 (80)
T PF11543_consen   19 EVSPSSTLSDLKEKISEQLSIPDSSQ   44 (80)
T ss_dssp             EE-TTSBHHHHHHHHHHHS---TTT-
T ss_pred             EcCCcccHHHHHHHHHHHcCCCCcce
Confidence            35566789999999999999987654


No 8  
>PF13419 HAD_2:  Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A ....
Probab=66.99  E-value=5.7  Score=26.60  Aligned_cols=25  Identities=24%  Similarity=0.384  Sum_probs=21.5

Q ss_pred             cchHHHHHhhhhhhccCCCceEEEE
Q psy6382          95 SNVRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      ..-.+.|+.+.+.++++|++++|.-
T Consensus       133 Kp~~~~~~~~~~~~~~~p~~~~~vg  157 (176)
T PF13419_consen  133 KPDPDAYRRALEKLGIPPEEILFVG  157 (176)
T ss_dssp             TTSHHHHHHHHHHHTSSGGGEEEEE
T ss_pred             hhHHHHHHHHHHHcCCCcceEEEEe
Confidence            3347899999999999999999973


No 9  
>cd01803 Ubiquitin Ubiquitin. Ubiquitin  (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains)
Probab=65.33  E-value=6.8  Score=24.48  Aligned_cols=29  Identities=10%  Similarity=0.177  Sum_probs=23.4

Q ss_pred             eecCccchHHHHHhhhhhhccCCCceEEE
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      .++.-.+|.+|.++|++.+++|++++-+.
T Consensus        16 ~v~~~~tV~~lK~~i~~~~g~~~~~q~L~   44 (76)
T cd01803          16 EVEPSDTIENVKAKIQDKEGIPPDQQRLI   44 (76)
T ss_pred             EECCcCcHHHHHHHHHHHhCCCHHHeEEE
Confidence            35566789999999999999998766543


No 10 
>cd01807 GDX_N ubiquitin-like domain of GDX. GDX contains an N-terminal ubiquitin-like domain as well as an uncharacterized c-terminal domain.  The function of GDX is unknown.
Probab=63.53  E-value=5.3  Score=25.71  Aligned_cols=26  Identities=23%  Similarity=0.309  Sum_probs=23.0

Q ss_pred             eecCccchHHHHHhhhhhhccCCCce
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      .|+...+|++|-++|++.+++++++.
T Consensus        16 ~v~~~~tV~~lK~~i~~~~gi~~~~q   41 (74)
T cd01807          16 QVSEKESVSTLKKLVSEHLNVPEEQQ   41 (74)
T ss_pred             EECCCCcHHHHHHHHHHHHCCCHHHe
Confidence            46788999999999999999998863


No 11 
>PF01282 Ribosomal_S24e:  Ribosomal protein S24e;  InterPro: IPR001976 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the S24e ribosomal proteins from eukaryotes and archaebacteria. These proteins have 101 to 148 amino acids.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2V94_B 1YWX_A 2G1D_A 3IZ6_U 1XN9_A 2XZM_P 2XZN_P 3U5G_Y 3J16_D 3IZB_U ....
Probab=62.48  E-value=9.4  Score=26.53  Aligned_cols=30  Identities=10%  Similarity=0.223  Sum_probs=26.5

Q ss_pred             cchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          95 SNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      -+-+|+-.+||..++++++.|.-..+.|+|
T Consensus        13 psr~ei~~klA~~~~~~~~~ivv~~~~t~f   42 (84)
T PF01282_consen   13 PSRKEIREKLAAMLNVDPDLIVVFGIKTEF   42 (84)
T ss_dssp             --HHHHHHHHHHHHTSTGCCEEEEEEEESS
T ss_pred             CCHHHHHHHHHHHhCCCCCeEEEeccEecC
Confidence            357899999999999999999999999987


No 12 
>KOG2630|consensus
Probab=62.47  E-value=5.5  Score=33.82  Aligned_cols=49  Identities=24%  Similarity=0.314  Sum_probs=38.7

Q ss_pred             CCceEEeeecccCCCceeecCccc-------hHHHHHhhhhhhccCCCceEEEEccC
Q psy6382          73 KPKLIFHCQLAHGSPTGLISGFSN-------VRELYQKIAECYEFPAEEVQFGALLE  122 (125)
Q Consensus        73 ~p~LvFh~QLAHGSptg~I~gFsn-------VkELY~kIAe~f~i~~~eIlFCTLNT  122 (125)
                      ..+|.|--|. -|-=..+|+||-.       +-+.|.+|++-.+.++.||||.|=|+
T Consensus       152 AqKllfg~s~-~gdl~~y~~gyfDt~iG~K~e~~sy~~I~~~Ig~s~~eiLfLTd~~  207 (254)
T KOG2630|consen  152 AQKLLFGYSD-AGDLRKYISGYFDTTIGLKVESQSYKKIGHLIGKSPREILFLTDVP  207 (254)
T ss_pred             HHHHHHcccC-cchHHHHhhhhhhccccceehhHHHHHHHHHhCCChhheEEeccCh
Confidence            4578887773 3666677777754       56899999999999999999999665


No 13 
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=59.13  E-value=11  Score=26.56  Aligned_cols=22  Identities=18%  Similarity=0.475  Sum_probs=18.6

Q ss_pred             chHHHHHhhhhhhccCC-CceEE
Q psy6382          96 NVRELYQKIAECYEFPA-EEVQF  117 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~-~eIlF  117 (125)
                      +..+|++||++.|.|++ .++.+
T Consensus        26 ~~~~L~~kI~~~f~l~~~~~~~l   48 (91)
T cd06398          26 NMDGLREKVEELFSLSPDADLSL   48 (91)
T ss_pred             CHHHHHHHHHHHhCCCCCCcEEE
Confidence            66899999999999987 66665


No 14 
>cd01791 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also known as HUB1) is a ubiquitin-like modifier that is both widely expressed and highly phylogenetically conserved.  At the C-terminal end of the ubiquitin-like fold of UBL5 is a di-tyrosine motif followed by a single variable residue instead of the characteristic di-glycine found in all other ubiquitin-like modifiers.  ULB5 interacts with a cyclin-like kinase called CLK4 but not with other cyclin-like kinase family members.
Probab=58.79  E-value=9  Score=25.53  Aligned_cols=29  Identities=14%  Similarity=0.054  Sum_probs=23.8

Q ss_pred             eecCccchHHHHHhhhhhhccCCCceEEE
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      .++.=.+|.+|.++|++.++++++++-+.
T Consensus        17 ~v~~~~TV~~LK~~I~~~~~~~~~~qrLi   45 (73)
T cd01791          17 KCNPDDTIGDLKKLIAAQTGTRPEKIVLK   45 (73)
T ss_pred             EeCCCCcHHHHHHHHHHHhCCChHHEEEE
Confidence            44555789999999999999999987653


No 15 
>cd01806 Nedd8 Nebb8-like  ubiquitin protein. Nedd8 (also known as Rub1) has a single conserved ubiquitin-like domain that is part of a protein modification pathway similar to that of ubiquitin.  Nedd8 modifies a family of molecular scaffold proteins called cullins that are responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis.
Probab=57.68  E-value=15  Score=22.83  Aligned_cols=29  Identities=14%  Similarity=0.200  Sum_probs=23.9

Q ss_pred             eecCccchHHHHHhhhhhhccCCCceEEE
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      .|+.-.+|.+|-++|++.+++|+++.-+.
T Consensus        16 ~v~~~~tv~~lK~~i~~~~g~~~~~qrL~   44 (76)
T cd01806          16 DIEPTDKVERIKERVEEKEGIPPQQQRLI   44 (76)
T ss_pred             EECCCCCHHHHHHHHhHhhCCChhhEEEE
Confidence            36666889999999999999999975553


No 16 
>cd01793 Fubi Fubi ubiquitin-like protein. Fubi is a ubiquitin-like protein encoded by the fau gene which has an  N-terminal ubiquitin-like domain (also referred to as FUBI) fused to the ribosomal protein S30.  Fubi is thought to be a tumor suppressor protein and the FUBI domain may act as a substitute or an inhibitor of ubiquitin or one of ubiquitin's close relatives UCRP, FAT10, and Nedd8.
Probab=56.89  E-value=8.6  Score=24.80  Aligned_cols=26  Identities=15%  Similarity=0.238  Sum_probs=22.8

Q ss_pred             eecCccchHHHHHhhhhhhccCCCce
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      .|+.-.+|.++-++|++.++||+++.
T Consensus        14 ~v~~~~tV~~lK~~i~~~~gip~~~q   39 (74)
T cd01793          14 EVTGQETVSDIKAHVAGLEGIDVEDQ   39 (74)
T ss_pred             EECCcCcHHHHHHHHHhhhCCCHHHE
Confidence            46677899999999999999998875


No 17 
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2. hPLIC-1 and hPLIC-2 (human homologs of the yeast ubiquitin-like Dsk2 protein)  are type2 UBL's (ubiquitin-like) proteins that are thought to serve as adaptors that link the ubiquitination machinery to the proteasome.  The hPLIC's have an N-terminal UBL domain that binds the S5a subunit of the proteasome and a C-terminal UBA (ubiquitin-associated) domain that binds a ubiquitylated protein.
Probab=56.78  E-value=8.3  Score=24.59  Aligned_cols=25  Identities=12%  Similarity=0.327  Sum_probs=21.1

Q ss_pred             ecCccchHHHHHhhhhhhccCCCce
Q psy6382          91 ISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      |+.=.+|.+|.++||+.++++++++
T Consensus        16 v~~~~TV~~lK~~I~~~~~i~~~~~   40 (71)
T cd01808          16 IAEDASVKDFKEAVSKKFKANQEQL   40 (71)
T ss_pred             ECCCChHHHHHHHHHHHhCCCHHHE
Confidence            4555789999999999999988864


No 18 
>smart00760 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix domain. Could be involved in DNA-binding.
Probab=54.69  E-value=4.5  Score=25.63  Aligned_cols=21  Identities=19%  Similarity=0.529  Sum_probs=17.9

Q ss_pred             chHHHHHhhhhhhccCCCceE
Q psy6382          96 NVRELYQKIAECYEFPAEEVQ  116 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eIl  116 (125)
                      ++.++-+.+|+.|+|+++||+
T Consensus         1 ~~~~I~~~Va~~~~i~~~~i~   21 (60)
T smart00760        1 TIEEIIEAVAEYFGVKPEDLK   21 (60)
T ss_pred             CHHHHHHHHHHHhCCCHHHHh
Confidence            467888999999999999874


No 19 
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain. DDI1_N   DDI1 (DNA damage inducible protein 1) has an amino-terminal ubiquitin-like domain, an retroviral protease-like (RVP-like) domain, and a UBA (ubiquitin-associated) domain.  This CD represents the amino-terminal ubiquitin-like domain of DDI1.
Probab=54.60  E-value=9.5  Score=24.73  Aligned_cols=25  Identities=8%  Similarity=-0.009  Sum_probs=22.0

Q ss_pred             eecCccchHHHHHhhhhhhccCCCc
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEE  114 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~e  114 (125)
                      .|+.-.+|.+|-++|++.+++|+++
T Consensus        15 ~v~~~~TV~~lK~~I~~~~gip~~~   39 (71)
T cd01796          15 DVDPDLELENFKALCEAESGIPASQ   39 (71)
T ss_pred             EECCcCCHHHHHHHHHHHhCCCHHH
Confidence            4667789999999999999999885


No 20 
>cd01804 midnolin_N Ubiquitin-like domain of midnolin. midnolin_N   Midnolin (midbrain nucleolar protein) is expressed in the nucleolus and is thought to regulate genes involved in neurogenesis.  Midnolin contains an amino-terminal ubiquitin-like domain.
Probab=54.53  E-value=13  Score=24.59  Aligned_cols=26  Identities=19%  Similarity=0.333  Sum_probs=21.2

Q ss_pred             ecCccchHHHHHhhhhhhccCCCceE
Q psy6382          91 ISGFSNVRELYQKIAECYEFPAEEVQ  116 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~~eIl  116 (125)
                      ++.=.+|.||.++|++.+++++++.-
T Consensus        18 v~~~~TV~~LK~~I~~~~~~~~~~qr   43 (78)
T cd01804          18 VPPDETVEGLKKRISQRLKVPKERLA   43 (78)
T ss_pred             ECCcCHHHHHHHHHHHHhCCChHHEE
Confidence            34446899999999999999988653


No 21 
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein. DC_UbP (dendritic cell derived ubiquitin-like protein) is a ubiquitin-like protein from human dendritic cells that is expressed in the mitochondrion. The ubiquitin-like domain of this protein is found at the C-terminus and lacks the canonical gly-gly motif of ubiquitin required for ubiquitinization.  DC_UbP is expressed in tumor cells but not in normal human adult tissue suggesting a role for DC_UbP in tumorogenesis.
Probab=54.38  E-value=8.4  Score=25.27  Aligned_cols=26  Identities=12%  Similarity=0.029  Sum_probs=22.7

Q ss_pred             eecCccchHHHHHhhhhhhccCCCce
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      .|+...+|.++-++|++.+++|+++.
T Consensus        14 ~v~~~~TV~~lK~~I~~~~gi~~~~q   39 (70)
T cd01794          14 SVSSKDTVGQLKKQLQAAEGVDPCCQ   39 (70)
T ss_pred             EECCcChHHHHHHHHHHHhCCCHHHe
Confidence            56788999999999999999988853


No 22 
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains that becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=53.08  E-value=9.8  Score=25.05  Aligned_cols=27  Identities=30%  Similarity=0.318  Sum_probs=22.9

Q ss_pred             ecCccchHHHHHhhhhhhccCCCceEE
Q psy6382          91 ISGFSNVRELYQKIAECYEFPAEEVQF  117 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~~eIlF  117 (125)
                      |+.=.+|.||.++|++.+++++++.-+
T Consensus        19 v~~~~TV~~lK~~I~~~~~i~~~~qrL   45 (80)
T cd01792          19 LRDSMTVSELKQQIAQKIGVPAFQQRL   45 (80)
T ss_pred             cCCCCcHHHHHHHHHHHhCCCHHHEEE
Confidence            455678999999999999999987755


No 23 
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains and becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=52.99  E-value=15  Score=23.63  Aligned_cols=27  Identities=15%  Similarity=0.112  Sum_probs=22.7

Q ss_pred             eecCccchHHHHHhhhhhhccCCCceE
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEVQ  116 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eIl  116 (125)
                      .|+.-.+|++|-++|++..+||+++.-
T Consensus        14 ~v~~~~tV~~lK~~I~~~~gi~~~~q~   40 (74)
T cd01810          14 EVQLTQTVATLKQQVSQRERVQADQFW   40 (74)
T ss_pred             EECCcChHHHHHHHHHHHhCCCHHHeE
Confidence            466678999999999999999888643


No 24 
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein. parkin_N  parkin protein is a RING-type E3 ubiquitin ligase with an amino-terminal ubiquitin-like (Ubl) domain and an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.  Naturally occurring mutations in parkin are thought to cause the disease AR_JP (autosomal-recessive juvenile parkinsonism). Parkin binds the Rpn10 subunit of  26S proteasomes through its Ubl domain.
Probab=51.84  E-value=14  Score=23.34  Aligned_cols=27  Identities=11%  Similarity=0.352  Sum_probs=23.0

Q ss_pred             ecCccchHHHHHhhhhhhccCCCceEE
Q psy6382          91 ISGFSNVRELYQKIAECYEFPAEEVQF  117 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~~eIlF  117 (125)
                      |+.-.+|+++-+.|++..++|++++-.
T Consensus        15 v~~~~tV~~lK~~i~~~~gi~~~~q~L   41 (70)
T cd01798          15 VDPDTDIKQLKEVVAKRQGVPPDQLRV   41 (70)
T ss_pred             ECCCChHHHHHHHHHHHHCCCHHHeEE
Confidence            557789999999999999999887644


No 25 
>PRK02220 4-oxalocrotonate tautomerase; Provisional
Probab=51.36  E-value=13  Score=22.81  Aligned_cols=22  Identities=14%  Similarity=0.223  Sum_probs=14.4

Q ss_pred             HHHHhhhhhhccCCCceEEEEcc
Q psy6382          99 ELYQKIAECYEFPAEEVQFGALL  121 (125)
Q Consensus        99 ELY~kIAe~f~i~~~eIlFCTLN  121 (125)
                      ++++.+++++++|+++|. +.++
T Consensus        23 ~it~~l~~~~~~p~~~v~-V~i~   44 (61)
T PRK02220         23 DVTAAVSKNTGAPAEHIH-VIIN   44 (61)
T ss_pred             HHHHHHHHHhCcChhhEE-EEEE
Confidence            444455589999988875 4443


No 26 
>PF02071 NSF:  Aromatic-di-Alanine (AdAR) repeat ;  InterPro: IPR000744 Regulated exocytosis of neurotransmitters and hormones, as well as intracellular traffic, requires fusion of two lipid bilayers. SNARE proteins are thought to form a protein bridge, the SNARE complex, between an incoming vesicle and the acceptor compartment. SNARE proteins contribute to the specificity of membrane fusion, implying that the mechanisms by which SNAREs are targeted to subcellular compartments are important for specific docking and fusion of vesicles. This mechanism involves a family of conserved proteins, members of which appear to function at all sites of constitutive and regulated secretion in eukaryotes []. Among them are 2 types of cytosolic protein, NSF (N-ethyl-maleimide-sensitive protein) and the SNAPs (alpha-, beta- and gamma-soluble NSF attachment proteins). The yeast vesicular fusion protein, sec17, a cytoplasmic peripheral membrane protein involved in vesicular transport between the endoplasmic reticulum and the golgi apparatus, shows a high degree of sequence similarity to the alpha-SNAP family.  SNAP-25 and its non-neuronal homologue Syndet/SNAP-23 are synthesized as soluble proteins in the cytosol. Both SNAP-25 and Syndet/SNAP-23 are palmitoylated at cysteine residues clustered in a loop between two N- and C-terminal coils and palmitoylation is essential for membrane binding and plasma membrane targeting. The C-terminal and the N-terminal helices of SNAP-25, are each targeted to the plasma membrane by two distinct cysteine-rich domains and appear to regulate the availability of SNAP to form complexes with SNARE [].; GO: 0006886 intracellular protein transport
Probab=51.10  E-value=7.9  Score=18.97  Aligned_cols=10  Identities=60%  Similarity=1.228  Sum_probs=8.1

Q ss_pred             HHHHhhhhhh
Q psy6382          99 ELYQKIAECY  108 (125)
Q Consensus        99 ELY~kIAe~f  108 (125)
                      +-|+++|+||
T Consensus         3 ~~y~~Aa~~y   12 (12)
T PF02071_consen    3 KCYEKAAECY   12 (12)
T ss_pred             HHHHHHHhhC
Confidence            3589999987


No 27 
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. Through the formation of reversible mixed disulfides, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. ERp44 also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol. Similar to PDI, the b' domain of ERp44 is likely involved in substrate recognition and may be the primary binding site.
Probab=50.67  E-value=12  Score=26.29  Aligned_cols=30  Identities=13%  Similarity=0.183  Sum_probs=25.8

Q ss_pred             ecCccchHHHHHhhhhh---hccCCCceEEEEccCC
Q psy6382          91 ISGFSNVRELYQKIAEC---YEFPAEEVQFGALLEN  123 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~---f~i~~~eIlFCTLNT~  123 (125)
                      -+++..+++.++++|+.   |.   .+|+|+++|..
T Consensus        26 ~~~~~~~~~~~~~vAk~~~~~k---gki~Fv~~d~~   58 (111)
T cd03072          26 KDDLESLKEFKQAVARQLISEK---GAINFLTADGD   58 (111)
T ss_pred             chHHHHHHHHHHHHHHHHHhcC---ceEEEEEEech
Confidence            46788999999999999   86   67999999864


No 28 
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI, calsequestrin and other PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5 and PDIR. PDI, ERp57, ERp72, P5 and PDIR are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and one or more redox inactive TRX-like (b) domains. The molecular structure of PDI is abb'a'. Also included in this family is the PDI-related protein ERp27, w
Probab=49.70  E-value=20  Score=22.99  Aligned_cols=28  Identities=14%  Similarity=0.332  Sum_probs=24.2

Q ss_pred             CccchHHHHHhhhhhhccCCCceEEEEccCC
Q psy6382          93 GFSNVRELYQKIAECYEFPAEEVQFGALLEN  123 (125)
Q Consensus        93 gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~  123 (125)
                      ....+++.++++|+.|.   .+|.|+.+|..
T Consensus        26 ~~~~~~~~~~~vA~~~~---~~v~f~~vd~~   53 (103)
T cd02982          26 ESEELRERFKEVAKKFK---GKLLFVVVDAD   53 (103)
T ss_pred             hHHHHHHHHHHHHHHhC---CeEEEEEEchH
Confidence            66788999999999998   77999999864


No 29 
>PRK01964 4-oxalocrotonate tautomerase; Provisional
Probab=49.57  E-value=14  Score=23.13  Aligned_cols=19  Identities=32%  Similarity=0.580  Sum_probs=13.4

Q ss_pred             HHHHHhhhhhhccCCCceE
Q psy6382          98 RELYQKIAECYEFPAEEVQ  116 (125)
Q Consensus        98 kELY~kIAe~f~i~~~eIl  116 (125)
                      +++++.+++.+++|+++|.
T Consensus        22 ~~it~~l~~~lg~p~~~v~   40 (64)
T PRK01964         22 REVTEAISATLDVPKERVR   40 (64)
T ss_pred             HHHHHHHHHHhCcChhhEE
Confidence            3444555588999998875


No 30 
>cd01802 AN1_N ubiquitin-like domain of AN1. AN1 (also known as ANUBL1 and RSD-7) is ubiquitin-like protein with a testis-specific expression in rats that has an N-terminal ubiquitin-like domain and a C-terminal zinc-binding domain. Unlike ubiquitin polyproteins and most ubiquitin fusion proteins, the N-terminal ubiquitin-like domain of An1 does not undergo proteolytic processing.  The function of AN1 is unknown.
Probab=49.36  E-value=13  Score=26.29  Aligned_cols=40  Identities=20%  Similarity=0.188  Sum_probs=29.6

Q ss_pred             CceEEeeecccCCCc-eeecCccchHHHHHhhhhhhccCCCce
Q psy6382          74 PKLIFHCQLAHGSPT-GLISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        74 p~LvFh~QLAHGSpt-g~I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      -++.+-+.  .|... =.|+...+|.+|-++|++.++||+++.
T Consensus        28 M~I~Vk~l--~G~~~~leV~~~~TV~~lK~kI~~~~gip~~~Q   68 (103)
T cd01802          28 MELFIETL--TGTCFELRVSPFETVISVKAKIQRLEGIPVAQQ   68 (103)
T ss_pred             EEEEEEcC--CCCEEEEEeCCCCcHHHHHHHHHHHhCCChHHE
Confidence            34555444  35433 358899999999999999999998853


No 31 
>cd01805 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belongs to a family of adaptor molecules having affinity for both the proteasome and ubiquitinylated proteins and thought to shuttle these ubiquitinylated proteins to the proteasome for destruction. RAD23 interacts with ubiquitin through its C-terminal ubiquitin-associated domains (UBA) and with the proteasome through its N-terminal ubiquitin-like domain (UBL).
Probab=48.10  E-value=23  Score=22.44  Aligned_cols=26  Identities=31%  Similarity=0.332  Sum_probs=21.4

Q ss_pred             ecCccchHHHHHhhhhhhcc--CCCceE
Q psy6382          91 ISGFSNVRELYQKIAECYEF--PAEEVQ  116 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i--~~~eIl  116 (125)
                      ++.-.+|.+|-+.|++.+++  +++++-
T Consensus        17 v~~~~TV~~lK~~i~~~~~i~~~~~~q~   44 (77)
T cd01805          17 VDPDDTVAELKEKIEEEKGCDYPPEQQK   44 (77)
T ss_pred             ECCCCcHHHHHHHHHHhhCCCCChhHeE
Confidence            45567899999999999998  887653


No 32 
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme. 4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.
Probab=46.69  E-value=20  Score=22.00  Aligned_cols=21  Identities=14%  Similarity=0.196  Sum_probs=16.4

Q ss_pred             hHHHHHhhhhhhccCCCceEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQF  117 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlF  117 (125)
                      .+++++.+++++++++++|.-
T Consensus        21 ~~~it~~l~~~lg~~~~~v~V   41 (63)
T TIGR00013        21 IEGVTEAMAETLGANLESIVV   41 (63)
T ss_pred             HHHHHHHHHHHhCCCcccEEE
Confidence            466777888999999887753


No 33 
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase. This enzyme is the enolase-phosphatase of methionine salvage, a pathway that regenerates methionine from methylthioadenosine (MTA). Adenosylmethionine (AdoMet) is a donor of different moieties for various processes, including methylation reactions. Use of AdoMet for spermidine biosynthesis, which leads to polyamine biosynthesis, leaves MTA as a by-product that must be cleared. In Bacillus subtilis and related species, this single protein is replaced by separate enzymes with enolase and phosphatase activities.
Probab=46.20  E-value=14  Score=29.12  Aligned_cols=25  Identities=28%  Similarity=0.320  Sum_probs=22.3

Q ss_pred             cchHHHHHhhhhhhccCCCceEEEE
Q psy6382          95 SNVRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      -.-.+.|.+|++.++++|++++|..
T Consensus       152 KP~p~~y~~i~~~lgv~p~e~lfVg  176 (220)
T TIGR01691       152 KTEAQSYVKIAGQLGSPPREILFLS  176 (220)
T ss_pred             CCCHHHHHHHHHHhCcChhHEEEEe
Confidence            5567999999999999999999964


No 34 
>smart00213 UBQ Ubiquitin homologues. Ubiquitin-mediated proteolysis is involved in the regulated turnover of  proteins required for controlling cell cycle progression
Probab=45.37  E-value=24  Score=20.81  Aligned_cols=28  Identities=32%  Similarity=0.311  Sum_probs=22.6

Q ss_pred             eeecCccchHHHHHhhhhhhccCCCceE
Q psy6382          89 GLISGFSNVRELYQKIAECYEFPAEEVQ  116 (125)
Q Consensus        89 g~I~gFsnVkELY~kIAe~f~i~~~eIl  116 (125)
                      =.|+.=.+|.+|-++|++.+++|++++-
T Consensus        14 ~~v~~~~tv~~lk~~i~~~~~~~~~~~~   41 (64)
T smart00213       14 LEVKPSDTVSELKEKIAELTGIPVEQQR   41 (64)
T ss_pred             EEECCCCcHHHHHHHHHHHHCCCHHHEE
Confidence            3455567899999999999999988643


No 35 
>PF13647 Glyco_hydro_80:  Glycosyl hydrolase family 80 of chitosanase A
Probab=44.30  E-value=12  Score=31.94  Aligned_cols=24  Identities=46%  Similarity=0.695  Sum_probs=21.0

Q ss_pred             ceEEeeecccCCCceeecCccchHH
Q psy6382          75 KLIFHCQLAHGSPTGLISGFSNVRE   99 (125)
Q Consensus        75 ~LvFh~QLAHGSptg~I~gFsnVkE   99 (125)
                      -|-|+.|...|| .|.|+.|++||.
T Consensus       201 glafqvqvntgs-igsisafssvks  224 (308)
T PF13647_consen  201 GLAFQVQVNTGS-IGSISAFSSVKS  224 (308)
T ss_pred             eEEEEEEecccc-ccceehhhhccc
Confidence            478999999887 699999999974


No 36 
>cd03409 Chelatase_Class_II Class II Chelatase: a family of ATP-independent monomeric or homodimeric enzymes that catalyze the insertion of metal into protoporphyrin rings. This family includes protoporphyrin IX ferrochelatase (HemH), sirohydrochlorin ferrochelatase (SirB) and the cobaltochelatases, CbiK and CbiX. HemH and SirB are involved in heme and siroheme biosynthesis, respectively, while the cobaltochelatases are associated with cobalamin biosynthesis. Excluded from this family are the ATP-dependent heterotrimeric chelatases (class I) and the multifunctional homodimeric enzymes with dehydrogenase and chelatase activities (class III).
Probab=43.87  E-value=40  Score=21.88  Aligned_cols=37  Identities=22%  Similarity=0.222  Sum_probs=20.0

Q ss_pred             cccCCCceeecCccchHHHHHhhhhhhccCCCceEEEEcc
Q psy6382          82 LAHGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALL  121 (125)
Q Consensus        82 LAHGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLN  121 (125)
                      ++|||+... ..-.-+.++.+.+++.+  +..++..|.+.
T Consensus         5 v~HGs~~~s-~~~~~~~~~~~~l~~~~--~~~~v~~a~~~   41 (101)
T cd03409           5 VGHGSPYKD-PYKKDIEAQAHNLAESL--PDFPYYVGFQS   41 (101)
T ss_pred             EECCCCCCc-cHHHHHHHHHHHHHHHC--CCCCEEEEEEC
Confidence            589999651 11123445555555554  33556666654


No 37 
>PF01337 Barstar:  Barstar (barnase inhibitor);  InterPro: IPR000468 Barstar is a small single chain protein. Barnase is the extracellular ribonuclease IPR001887 from INTERPRO of Bacillus amyloliquefaciens, and barstar its specific intracellular inhibitor [, ]. Expression of barstar is necessary to counter the lethal effect of expressed active barnase. The structure of the barnase-barstar complex is known [].; PDB: 2CX6_A 1B2U_F 1A19_A 1X1U_F 1B27_E 1X1W_F 1BGS_E 1X1Y_D 1B3S_D 1B2S_D ....
Probab=43.09  E-value=19  Score=23.91  Aligned_cols=21  Identities=24%  Similarity=0.631  Sum_probs=16.1

Q ss_pred             cCccchHHHHHhhhhhhccCC
Q psy6382          92 SGFSNVRELYQKIAECYEFPA  112 (125)
Q Consensus        92 ~gFsnVkELY~kIAe~f~i~~  112 (125)
                      .+.++..++|+.|++++++|.
T Consensus         6 ~~i~~~~~~~~~l~~~l~fP~   26 (90)
T PF01337_consen    6 RKIRDKEDFYDALAEALDFPD   26 (90)
T ss_dssp             CC-SSHHHHHHHHHHHTT--T
T ss_pred             CCCCCHHHHHHHHHHHcCCCc
Confidence            568899999999999999873


No 38 
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of  NADPH oxidase during phagocytosis. PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes . A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The p67 proteins contain
Probab=41.91  E-value=21  Score=25.36  Aligned_cols=23  Identities=35%  Similarity=0.495  Sum_probs=19.6

Q ss_pred             cchHHHHHhhhhhhccCCCceEE
Q psy6382          95 SNVRELYQKIAECYEFPAEEVQF  117 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~eIlF  117 (125)
                      -+..+|++||++-+.+++++|.-
T Consensus        21 ~~y~~L~~ki~~kLkl~~e~i~L   43 (80)
T cd06406          21 LSYATLLQKISSKLELPAEHITL   43 (80)
T ss_pred             CCHHHHHHHHHHHhCCCchhcEE
Confidence            36789999999999999888753


No 39 
>COG2411 Uncharacterized conserved protein [Function unknown]
Probab=41.64  E-value=19  Score=29.46  Aligned_cols=27  Identities=22%  Similarity=0.532  Sum_probs=22.5

Q ss_pred             eeecCccchHHHHHhhhhhhc-cCCCce
Q psy6382          89 GLISGFSNVRELYQKIAECYE-FPAEEV  115 (125)
Q Consensus        89 g~I~gFsnVkELY~kIAe~f~-i~~~eI  115 (125)
                      .+.+||.|++||-..+.+.|+ +-++++
T Consensus        71 Ar~DGF~sreELi~~LkriYg~lr~ed~   98 (188)
T COG2411          71 ARLDGFRSREELIEELKRIYGELRDEDI   98 (188)
T ss_pred             HHhcccccHHHHHHHHHHHcCcCCCCce
Confidence            467899999999999999997 555554


No 40 
>KOG3889|consensus
Probab=41.23  E-value=19  Score=32.01  Aligned_cols=37  Identities=35%  Similarity=0.628  Sum_probs=29.6

Q ss_pred             CCceEEeeeccc---CCCceeecCccchHHHHHhhhhhhcc
Q psy6382          73 KPKLIFHCQLAH---GSPTGLISGFSNVRELYQKIAECYEF  110 (125)
Q Consensus        73 ~p~LvFh~QLAH---GSptg~I~gFsnVkELY~kIAe~f~i  110 (125)
                      ..--|||| |.|   |+-|=.|+||.-+.||-++--|.|+|
T Consensus       202 ~GiQvfHC-l~h~gtGG~t~lVDgfy~ae~l~~~~Pe~fei  241 (371)
T KOG3889|consen  202 PGIQVFHC-LTHAGTGGDTVLVDGFYCAEKLRNESPEDFEI  241 (371)
T ss_pred             CCceEEEe-ecccCCCCceEEEehHHHHHHHHhhChHhhhH
Confidence            34569999 456   45566799999999999999999985


No 41 
>cd01812 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N  N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein.  This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP).
Probab=41.03  E-value=23  Score=21.89  Aligned_cols=24  Identities=17%  Similarity=0.202  Sum_probs=20.5

Q ss_pred             ecCccchHHHHHhhhhhhccCCCc
Q psy6382          91 ISGFSNVRELYQKIAECYEFPAEE  114 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~~e  114 (125)
                      ++.=.+|.+|-++|++.+++|+++
T Consensus        16 v~~~~tv~~lK~~i~~~~gi~~~~   39 (71)
T cd01812          16 ISSQATFGDLKKMLAPVTGVEPRD   39 (71)
T ss_pred             ECCCCcHHHHHHHHHHhhCCChHH
Confidence            455678999999999999998864


No 42 
>cd01769 UBL Ubiquitin-like domain of UBL. UBLs function by remodeling the surface of their target proteins, changing their target's half-life, enzymatic activity, protein-protein interactions, subcellular localization or other properties. At least 10 different ubiquitin-like modifications exist in mammals, and attachment of different ubls to a target leads to different biological consequences. Ubl-conjugation cascades are initiated by activating enzymes, which also coordinate the ubls with their downstream pathways.
Probab=39.51  E-value=41  Score=20.00  Aligned_cols=26  Identities=35%  Similarity=0.307  Sum_probs=21.6

Q ss_pred             cCccchHHHHHhhhhhhccCCCceEE
Q psy6382          92 SGFSNVRELYQKIAECYEFPAEEVQF  117 (125)
Q Consensus        92 ~gFsnVkELY~kIAe~f~i~~~eIlF  117 (125)
                      ..-.++.+|-++|++.++++++++-+
T Consensus        15 ~~~~ti~~lK~~i~~~~~~~~~~~~l   40 (69)
T cd01769          15 SPDDTVAELKAKIAAKEGVPPEQQRL   40 (69)
T ss_pred             CCCChHHHHHHHHHHHHCcChHHEEE
Confidence            33467999999999999999987766


No 43 
>PF08299 Bac_DnaA_C:  Bacterial dnaA protein helix-turn-helix;  InterPro: IPR013159 This entry represents the C-terminal domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; GO: 0005524 ATP binding, 0043565 sequence-specific DNA binding, 0006270 DNA-dependent DNA replication initiation, 0006275 regulation of DNA replication; PDB: 2HCB_B 3R8F_C 1L8Q_A 3PVP_B 3PVV_A 1J1V_A.
Probab=38.36  E-value=9.9  Score=25.07  Aligned_cols=21  Identities=14%  Similarity=0.548  Sum_probs=15.5

Q ss_pred             chHHHHHhhhhhhccCCCceE
Q psy6382          96 NVRELYQKIAECYEFPAEEVQ  116 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eIl  116 (125)
                      +++++-+.+|+.|+++++||+
T Consensus         1 t~~~Ii~~Va~~~~v~~~~i~   21 (70)
T PF08299_consen    1 TIEDIIEAVAEYFGVSVEDIR   21 (70)
T ss_dssp             -HHHHHHHHHHHTT--HHHHH
T ss_pred             CHHHHHHHHHHHHCCCHHHHh
Confidence            467888999999999998873


No 44 
>cd01763 Sumo Small ubiquitin-related modifier (SUMO). Small ubiquitin-related modifier (SUMO) proteins are conjugated to numerous intracellular targets and serve to modulate protein interaction, localization, activity or stability.  SUMO (also known as "Smt3" and "sentrin" in other organisms) is linked to several different pathways, including nucleocytoplasmic transport. Attachment of SUMO to targets proteins is stimulated by PIAS (Protein inhibitor of activated STATs) proteins which serve as E3-like ligases.
Probab=38.21  E-value=34  Score=23.00  Aligned_cols=45  Identities=16%  Similarity=0.143  Sum_probs=33.4

Q ss_pred             CCCceEEeeecccCCC-ceeecCccchHHHHHhhhhhhccCCCceEEE
Q psy6382          72 SKPKLIFHCQLAHGSP-TGLISGFSNVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        72 ~~p~LvFh~QLAHGSp-tg~I~gFsnVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      ..-.+..++|  +|.. +=.|+-=+.+++|.+++++..+|+++++-|.
T Consensus        10 ~~i~I~v~~~--~g~~~~~~v~~~~~l~~l~~~y~~~~gi~~~~~rf~   55 (87)
T cd01763          10 EHINLKVKGQ--DGNEVFFKIKRSTPLKKLMEAYCQRQGLSMNSVRFL   55 (87)
T ss_pred             CeEEEEEECC--CCCEEEEEEcCCCHHHHHHHHHHHHhCCCccceEEE
Confidence            3445556666  4554 3456666788999999999999999999886


No 45 
>PRK11053 dihydropteridine reductase; Provisional
Probab=37.84  E-value=31  Score=26.05  Aligned_cols=37  Identities=16%  Similarity=0.146  Sum_probs=29.2

Q ss_pred             ccCCCceeecCccchHHHHHhhhhhhccCC-CceEEEEccCCC
Q psy6382          83 AHGSPTGLISGFSNVRELYQKIAECYEFPA-EEVQFGALLENY  124 (125)
Q Consensus        83 AHGSptg~I~gFsnVkELY~kIAe~f~i~~-~eIlFCTLNT~~  124 (125)
                      ++|=.+..|.||.     .+++.+.|+||. ...+.|.+.-||
T Consensus       156 ~~Glgs~~i~g~~-----~~~v~~~l~ip~~~~~~~~~i~lGy  193 (217)
T PRK11053        156 ALGIDATPIEGFD-----AAILDAEFGLREKGLTSSVVVPLGY  193 (217)
T ss_pred             HcCCCCCCcCCcC-----HHHHHHHhCCCCcCcceEEEEEeec
Confidence            4677788899994     378899999996 576778888777


No 46 
>PF11976 Rad60-SLD:  Ubiquitin-2 like Rad60 SUMO-like;  InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair []. Unlike ubiquitin, they are not involved in protein degradation.  This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain.; PDB: 3RD2_A 2JXX_A 3RCZ_A 3GOE_A 3A4S_D 3A4R_B 2IO1_D 1U4A_A 2K1F_A 1WZ0_A ....
Probab=37.50  E-value=49  Score=20.68  Aligned_cols=29  Identities=21%  Similarity=0.282  Sum_probs=24.9

Q ss_pred             eecCccchHHHHHhhhhhhccCC-CceEEE
Q psy6382          90 LISGFSNVRELYQKIAECYEFPA-EEVQFG  118 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~-~eIlFC  118 (125)
                      .|.--+.+++|.+++++..++++ .++-|.
T Consensus        16 ~v~~~~~~~~l~~~~~~~~~i~~~~~~~l~   45 (72)
T PF11976_consen   16 KVKPTTTVSKLIEKYCEKKGIPPEESIRLI   45 (72)
T ss_dssp             EEETTSCCHHHHHHHHHHHTTTT-TTEEEE
T ss_pred             EECCCCcHHHHHHHHHHhhCCCccceEEEE
Confidence            45677899999999999999999 888774


No 47 
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase. The Subfamily IA and IB capping domains are predicted by PSI-PRED to consist of an alpha helical bundle. Subfamily I encompasses such a wide region of sequence space (the sequences are highly divergent) that modelling it with a single alignment is impossible, resulting in an overly broad description which allows in many unrelated sequences. Subfamily IA and IB are separated based on an aparrent phylogenetic bifurcation. Subfamily IA is still too broad to model, but cannot be further subdivided into large chunks based on phylogenetic trees. Of the three motifs defining the HAD superfamily, the third has three variant forms : (1) hhhhsDxxx(x)D, (2) hhhhssxxx(x)D and (3) hhhhDDxxx(x)s where _s_ refers to a small amino acid and _h_ to a hydrophobic one. All three of these variants are found in subfamily IA. Individual models were made based on seeds exhibiting only o
Probab=37.49  E-value=25  Score=24.71  Aligned_cols=25  Identities=16%  Similarity=0.259  Sum_probs=21.5

Q ss_pred             cchHHHHHhhhhhhccCCCceEEEE
Q psy6382          95 SNVRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      .--.+.|+.+++.++++|+|++|.-
T Consensus       139 KP~p~~f~~~~~~~~~~p~~~l~vg  163 (175)
T TIGR01493       139 KPDPVVYELVFDTVGLPPDRVLMVA  163 (175)
T ss_pred             CCCHHHHHHHHHHHCCCHHHeEeEe
Confidence            4467899999999999999999863


No 48 
>PF13443 HTH_26:  Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A.
Probab=37.18  E-value=7.5  Score=23.78  Aligned_cols=19  Identities=26%  Similarity=0.312  Sum_probs=13.6

Q ss_pred             HHHHhhhhhhccCCCceEE
Q psy6382          99 ELYQKIAECYEFPAEEVQF  117 (125)
Q Consensus        99 ELY~kIAe~f~i~~~eIlF  117 (125)
                      +.-.+||++|+++++|++-
T Consensus        41 ~~l~~ia~~l~~~~~el~~   59 (63)
T PF13443_consen   41 DTLEKIAKALNCSPEELFE   59 (63)
T ss_dssp             HHHHHHHHHHT--HHHCTE
T ss_pred             HHHHHHHHHcCCCHHHHhh
Confidence            3457899999999999864


No 49 
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only]
Probab=37.13  E-value=30  Score=25.07  Aligned_cols=22  Identities=27%  Similarity=0.345  Sum_probs=20.0

Q ss_pred             hHHHHHhhhhhhccCCCceEEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlFC  118 (125)
                      -.+.|+...+.++++|++++|+
T Consensus       156 ~~~~f~~~~~~~g~~p~~~l~V  177 (229)
T COG1011         156 DPEIFEYALEKLGVPPEEALFV  177 (229)
T ss_pred             CcHHHHHHHHHcCCCcceEEEE
Confidence            4589999999999999999996


No 50 
>PF07027 DUF1318:  Protein of unknown function (DUF1318);  InterPro: IPR008309 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=36.85  E-value=13  Score=26.79  Aligned_cols=18  Identities=44%  Similarity=0.610  Sum_probs=15.6

Q ss_pred             HHHHHhhhhhhccCCCce
Q psy6382          98 RELYQKIAECYEFPAEEV  115 (125)
Q Consensus        98 kELY~kIAe~f~i~~~eI  115 (125)
                      +.+|+.||+.-++++++|
T Consensus        50 ~~~Y~~iA~~ng~t~~~V   67 (95)
T PF07027_consen   50 RALYQEIAKKNGITVEQV   67 (95)
T ss_pred             HHHHHHHHHHcCCCHHHH
Confidence            579999999999988765


No 51 
>PF14338 Mrr_N:  Mrr N-terminal domain
Probab=36.66  E-value=16  Score=24.64  Aligned_cols=20  Identities=30%  Similarity=0.697  Sum_probs=17.6

Q ss_pred             cchHHHHHhhhhhhccCCCc
Q psy6382          95 SNVRELYQKIAECYEFPAEE  114 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~e  114 (125)
                      .+.+|+|+.|++.|+++.+|
T Consensus        20 ~~~~ei~~~v~~~~~ls~e~   39 (92)
T PF14338_consen   20 ASRKEIYERVAERFGLSDEE   39 (92)
T ss_pred             cCHHHHHHHHHHHhCCCHHH
Confidence            57899999999999998765


No 52 
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one dimer and the third from a neighboring monomer.  Each monomer is a beta-alpha-beta fold with two small beta strands at the C-terminus that fold back on themselves. A pair of monomers form a dimer with two-fold symmetry, consisting of a 4-stranded beta sheet with two helices on one side and two additional small beta strands at each end. The dimers are assembled around a 3-fold axis of rotation to form a hexamer, with the short beta strands from each dimer contacting the neighboring dimers.
Probab=36.65  E-value=36  Score=20.33  Aligned_cols=22  Identities=9%  Similarity=0.205  Sum_probs=13.9

Q ss_pred             HHHHHhhhhhhccCCCceEEEEc
Q psy6382          98 RELYQKIAECYEFPAEEVQFGAL  120 (125)
Q Consensus        98 kELY~kIAe~f~i~~~eIlFCTL  120 (125)
                      +++++.+++.+++++++|. ..+
T Consensus        21 ~~i~~~l~~~~g~~~~~v~-V~i   42 (58)
T cd00491          21 ERVTEAVSEILGAPEATIV-VII   42 (58)
T ss_pred             HHHHHHHHHHhCcCcccEE-EEE
Confidence            4455555688889877654 444


No 53 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=36.23  E-value=22  Score=22.77  Aligned_cols=21  Identities=29%  Similarity=0.507  Sum_probs=14.1

Q ss_pred             eEEeeecccCCCceeecCccch
Q psy6382          76 LIFHCQLAHGSPTGLISGFSNV   97 (125)
Q Consensus        76 LvFh~QLAHGSptg~I~gFsnV   97 (125)
                      ++|+|+ |.|+|+-.|.=+.+-
T Consensus         1 ~~l~C~-~~G~P~P~v~W~k~g   21 (77)
T cd05875           1 IIIECE-AKGNPVPTFQWTRNG   21 (77)
T ss_pred             CEEEEe-ccccCCCEEEEEECC
Confidence            467887 568887777655543


No 54 
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED. HAD subfamilies caused by an overly broad single model.
Probab=35.54  E-value=40  Score=23.35  Aligned_cols=21  Identities=19%  Similarity=0.245  Sum_probs=19.4

Q ss_pred             HHHHHhhhhhhccCCCceEEE
Q psy6382          98 RELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        98 kELY~kIAe~f~i~~~eIlFC  118 (125)
                      .+.|+.+++.++++|++++|+
T Consensus       143 ~~~~~~~~~~~~~~~~~~~~v  163 (183)
T TIGR01509       143 PDIYLLALKKLGLKPEECLFV  163 (183)
T ss_pred             HHHHHHHHHHcCCCcceEEEE
Confidence            489999999999999999986


No 55 
>cd00419 Ferrochelatase_C Ferrochelatase, C-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is ubiquitous in nature and widely distributed in bacteria and eukaryotes. Recently, some archaeal members have been identified. The oligomeric state of these enzymes varies depending on the presence of a dimerization motif at the C-terminus.
Probab=35.35  E-value=43  Score=24.51  Aligned_cols=46  Identities=28%  Similarity=0.351  Sum_probs=33.5

Q ss_pred             CCceEEeeecccCCCceeecCcc----chHHHHHhhhhhhccCCCceEEEEcc
Q psy6382          73 KPKLIFHCQLAHGSPTGLISGFS----NVRELYQKIAECYEFPAEEVQFGALL  121 (125)
Q Consensus        73 ~p~LvFh~QLAHGSptg~I~gFs----nVkELY~kIAe~f~i~~~eIlFCTLN  121 (125)
                      ...|+|   .|||.|...++...    -+.+..+.|++..+++..++..|=.|
T Consensus        18 ~~~llf---saHgiP~~~~~~gd~Y~~~~~~~~~~v~~~l~~~~~~~~~~fqS   67 (135)
T cd00419          18 KDRLLF---SAHGLPVRDIKKGDPYPDQCEETARLVAERLGLPFDEYELAYQS   67 (135)
T ss_pred             CCEEEE---EcCCCHHHHhhCCCCHHHHHHHHHHHHHHHhCCCCCCEEEEecC
Confidence            456888   58999999886433    24456677889988877778777655


No 56 
>PF12436 USP7_ICP0_bdg:  ICP0-binding domain of Ubiquitin-specific protease 7;  InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length. It is found in proteins of the peptidase C19 family, which contains contains ubiquitinyl hydrolases like ubiquitin-specific protease 7 (USP7). USP7 regulates the turnover of p53 [].; PDB: 2KVR_A 2YLM_A.
Probab=35.20  E-value=38  Score=27.12  Aligned_cols=35  Identities=23%  Similarity=0.197  Sum_probs=24.6

Q ss_pred             ceeecCccchHHHHHhhhhhhccCCCceEEEEccC
Q psy6382          88 TGLISGFSNVRELYQKIAECYEFPAEEVQFGALLE  122 (125)
Q Consensus        88 tg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT  122 (125)
                      +-.++-=.+-.||-++||+..+++|+.|.|-+.|.
T Consensus       193 ~l~ls~~~tY~~la~~Va~~l~~dP~~lr~~~~~~  227 (249)
T PF12436_consen  193 TLWLSKKMTYDQLAEKVAEHLNVDPEHLRFFTVNP  227 (249)
T ss_dssp             EEEEETT--HHHHHHHHHHHHTS-GGGEEEE---T
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCChHHEEEEEecc
Confidence            44455556889999999999999999999999976


No 57 
>cd06552 ASCH_yqfb_like ASC-1 homology domain, subfamily similar to Escherichia coli Yqfb. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.
Probab=34.10  E-value=60  Score=21.71  Aligned_cols=30  Identities=20%  Similarity=0.419  Sum_probs=23.6

Q ss_pred             eeecCccchHHHHHhhhhhhc-cCCCceEEE
Q psy6382          89 GLISGFSNVRELYQKIAECYE-FPAEEVQFG  118 (125)
Q Consensus        89 g~I~gFsnVkELY~kIAe~f~-i~~~eIlFC  118 (125)
                      ++-+||.|+.|+-+.+.+.|+ .++++.+++
T Consensus        65 A~~eG~~s~~~~~~~l~~~Y~~~~~~~~v~v   95 (100)
T cd06552          65 ARQEGFPSLEELKEALKEIYPGLKDDDEVYV   95 (100)
T ss_pred             HHhcCCccHHHHHHHHHHHcCCCCCCCEEEE
Confidence            456799999999999999987 456666654


No 58 
>PRK04635 histidinol-phosphate aminotransferase; Provisional
Probab=33.98  E-value=27  Score=27.86  Aligned_cols=22  Identities=14%  Similarity=0.110  Sum_probs=20.0

Q ss_pred             hHHHHHhhhhhhccCCCceEEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlFC  118 (125)
                      -.+|.+.||+.+++++++|+++
T Consensus        62 ~~~Lr~aia~~~~~~~~~I~it   83 (354)
T PRK04635         62 PPELINAYSAYAGVAPEQILTS   83 (354)
T ss_pred             HHHHHHHHHHHhCcCHHHEEEe
Confidence            5789999999999999999875


No 59 
>PF14566 PTPlike_phytase:  Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B ....
Probab=33.92  E-value=17  Score=26.73  Aligned_cols=11  Identities=45%  Similarity=0.770  Sum_probs=7.5

Q ss_pred             CCceEEeeecc
Q psy6382          73 KPKLIFHCQLA   83 (125)
Q Consensus        73 ~p~LvFh~QLA   83 (125)
                      ..-|+||||.-
T Consensus       124 ~~~l~fhC~~G  134 (149)
T PF14566_consen  124 DTWLHFHCQAG  134 (149)
T ss_dssp             T-EEEEE-SSS
T ss_pred             CCeEEEECCCC
Confidence            66899999973


No 60 
>PRK00745 4-oxalocrotonate tautomerase; Provisional
Probab=33.88  E-value=40  Score=20.64  Aligned_cols=25  Identities=28%  Similarity=0.343  Sum_probs=17.2

Q ss_pred             hHHHHHhhh----hhhccCCCceEEEEccC
Q psy6382          97 VRELYQKIA----ECYEFPAEEVQFGALLE  122 (125)
Q Consensus        97 VkELY~kIA----e~f~i~~~eIlFCTLNT  122 (125)
                      .++||+.|.    +.|++++++| |..++.
T Consensus        17 k~~l~~~it~~l~~~~~~p~~~v-~V~i~e   45 (62)
T PRK00745         17 KRKLVEEITRVTVETLGCPPESV-DIIITD   45 (62)
T ss_pred             HHHHHHHHHHHHHHHcCCChhHE-EEEEEE
Confidence            355666665    7789999887 666553


No 61 
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT contains an N-terminal TRX-like domain, which does not contain the catalytic CXXC motif, followed by one to three glutaredoxin domains. The TRX-like domain is required for interaction with PKC theta. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli.
Probab=33.69  E-value=40  Score=21.31  Aligned_cols=30  Identities=27%  Similarity=0.522  Sum_probs=23.1

Q ss_pred             CCCceEEeeecccCCCceeecCccchHHHHHhhh
Q psy6382          72 SKPKLIFHCQLAHGSPTGLISGFSNVRELYQKIA  105 (125)
Q Consensus        72 ~~p~LvFh~QLAHGSptg~I~gFsnVkELY~kIA  105 (125)
                      .-|.++|.-+   |...+++.|+ +.++|.++|+
T Consensus        68 ~~Pt~~~~~~---g~~~~~~~g~-~~~~l~~~~~   97 (97)
T cd02984          68 AVPTFVFFRN---GTIVDRVSGA-DPKELAKKVE   97 (97)
T ss_pred             cccEEEEEEC---CEEEEEEeCC-CHHHHHHhhC
Confidence            3566777754   9999999997 6788888774


No 62 
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein. Scythe protein (also known as Bat3) is an apoptotic regulator that is highly conserved in eukaryotes and contains a ubiquitin-like domain near its N-terminus.  Scythe binds reaper, a potent apoptotic inducer, and Scythe/Reaper are thought to signal apoptosis, in part through regulating the folding and activity of apoptotic signaling molecules.
Probab=33.45  E-value=36  Score=20.92  Aligned_cols=24  Identities=33%  Similarity=0.378  Sum_probs=20.0

Q ss_pred             ecCccchHHHHHhhhhhhccCCCc
Q psy6382          91 ISGFSNVRELYQKIAECYEFPAEE  114 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~~e  114 (125)
                      ++.-.+|.+|-++|++..++|+++
T Consensus        17 v~~~~tv~~lK~~i~~~~gi~~~~   40 (72)
T cd01809          17 VEEEITVLDLKEKIAEEVGIPVEQ   40 (72)
T ss_pred             ECCCCcHHHHHHHHHHHHCcCHHH
Confidence            344578999999999999998875


No 63 
>PRK05365 malonic semialdehyde reductase; Provisional
Probab=33.34  E-value=46  Score=24.78  Aligned_cols=37  Identities=19%  Similarity=0.126  Sum_probs=30.6

Q ss_pred             ccCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          83 AHGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        83 AHGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      ++|=.++-|.||..     +++.+.++||....+.|.+--||
T Consensus       137 ~~Glgs~~~~g~~~-----~~v~~~l~ip~~~~~v~~ialGy  173 (195)
T PRK05365        137 ALGLDAGPMSGFDA-----AAVDAEFFAGTTWKSNFLVNIGY  173 (195)
T ss_pred             HcCCccCCccccCH-----HHHHHHhCCCCCeeEEEEEEeCC
Confidence            57888888999943     67888999998888889888777


No 64 
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of  Np95 and NIRF. NIRF_N    This CD represents the amino-terminal ubiquitin-like domain of a family of nuclear proteins that includes Np95 and NIRF (Np95/ICBP90-like RING finger) protein.  Both Np95 and NIRF have a domain architecture consisting of a ubiquitin-like domain, a PHD finger, a YDG/SRA domain, Rb-binding motifs and a RING finger domain. Both Np95 and NIRF are ubiquitin ligases that ubiquitinate PCNP (PEST-containing nuclear proteins). While Np95 is capable of binding histones, NIRF is involved in cell cycle regulation.
Probab=33.27  E-value=26  Score=23.39  Aligned_cols=24  Identities=33%  Similarity=0.490  Sum_probs=20.2

Q ss_pred             ecCccchHHHHHhhhhhhccCCCc
Q psy6382          91 ISGFSNVRELYQKIAECYEFPAEE  114 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~~e  114 (125)
                      ++.-.+|.++-++|++.+++|+++
T Consensus        19 v~~~~TV~~lK~~i~~~~gi~~~~   42 (78)
T cd01797          19 LSRLTKVEELREKIQELFNVEPEC   42 (78)
T ss_pred             cCCcCcHHHHHHHHHHHhCCCHHH
Confidence            344578999999999999998874


No 65 
>cd05140 Barstar_AU1054-like Barstar_AU1054-like contains uncharacterized sequences similar to the uncharacterized, predicted RNAase inhibitor AU1054 found in Burkholderia cenocepacia. This is a subfamily of the Barstar family of RNAase inhibitors. Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs to the same enzyme family as does barnase.
Probab=32.66  E-value=36  Score=23.68  Aligned_cols=22  Identities=36%  Similarity=0.729  Sum_probs=18.2

Q ss_pred             ecCccchHHHHHhhhhhhccCC
Q psy6382          91 ISGFSNVRELYQKIAECYEFPA  112 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~  112 (125)
                      .++.++-.++|+.+|++|++|.
T Consensus         5 ~~~i~~~~~l~~~l~~~l~fP~   26 (86)
T cd05140           5 LSDITSERELHELLKECLGFPG   26 (86)
T ss_pred             cccCCCHHHHHHHHHHHcCCch
Confidence            3567888999999999998873


No 66 
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.
Probab=32.36  E-value=42  Score=24.22  Aligned_cols=24  Identities=33%  Similarity=0.469  Sum_probs=21.0

Q ss_pred             chHHHHHhhhhhhccCCCceEEEE
Q psy6382          96 NVRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      --.+.|+.+++.++++|++++|.-
T Consensus       149 P~~~~~~~~~~~~~~~p~~~~~vg  172 (198)
T TIGR01428       149 PAPQVYQLALEALGVPPDEVLFVA  172 (198)
T ss_pred             CCHHHHHHHHHHhCCChhhEEEEe
Confidence            357899999999999999999864


No 67 
>cd05142 Barstar Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs to the same enzyme family as does barnase.
Probab=32.11  E-value=37  Score=23.58  Aligned_cols=21  Identities=14%  Similarity=0.317  Sum_probs=17.7

Q ss_pred             cCccchHHHHHhhhhhhccCC
Q psy6382          92 SGFSNVRELYQKIAECYEFPA  112 (125)
Q Consensus        92 ~gFsnVkELY~kIAe~f~i~~  112 (125)
                      +.+++..++|+.++++|++|.
T Consensus         7 ~~i~~~~~f~~~l~~~~~~p~   27 (87)
T cd05142           7 EEIRSIEDLHQILKKELALPE   27 (87)
T ss_pred             ccCCCHHHHHHHHHHHhCCch
Confidence            457888999999999998874


No 68 
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=31.99  E-value=31  Score=22.80  Aligned_cols=22  Identities=27%  Similarity=0.419  Sum_probs=16.0

Q ss_pred             CCceEEeeecccCCCce-eecCcc
Q psy6382          73 KPKLIFHCQLAHGSPTG-LISGFS   95 (125)
Q Consensus        73 ~p~LvFh~QLAHGSptg-~I~gFs   95 (125)
                      .-...|+|+ |+|.|.- .|.=+-
T Consensus        13 G~~v~l~C~-a~G~P~P~~I~W~k   35 (81)
T cd05749          13 NTPFNLTCQ-AVGPPEPVEILWWQ   35 (81)
T ss_pred             CCCEEEEEE-eeeecCCeEEEEEE
Confidence            346899999 8999977 464333


No 69 
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI. They exhibit both disulfide oxidase and reductase functions, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides and acting as isomerases to correct any non-native disulfide bonds. They also display chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp57 contains two redox-active TRX (a) domains and two redox inactive TRX-like (b) domains.  It shares the same domain arrangement of abb'a' as PDI, but lacks the C-terminal acid-rich region (c domain) that is present in PDI. ERp72 contains one additional redox-active TRX (a) domain at the N-terminus with a molecular structure of a"abb'a'. ERp57 interacts with the lectin chaperones, calnexin and calreticulin, and specifically promotes the oxidative folding of glycoprotei
Probab=31.23  E-value=34  Score=24.23  Aligned_cols=41  Identities=12%  Similarity=0.067  Sum_probs=29.9

Q ss_pred             eEEeeecccCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccC
Q psy6382          76 LIFHCQLAHGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLE  122 (125)
Q Consensus        76 LvFh~QLAHGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT  122 (125)
                      ++|.|.-.-.+    -+++...++.+.++|+.|.=  .+|+|+++|.
T Consensus        19 ~~~~~~~~~~~----~~~~~~~~~~~~~vAk~fk~--gki~Fv~~D~   59 (111)
T cd03073          19 VAYYNVDYSKN----PKGTNYWRNRVLKVAKDFPD--RKLNFAVADK   59 (111)
T ss_pred             EEEEeccccCC----hhHHHHHHHHHHHHHHHCcC--CeEEEEEEcH
Confidence            55556532222    37788899999999999963  5799999875


No 70 
>PRK07908 hypothetical protein; Provisional
Probab=31.22  E-value=36  Score=26.97  Aligned_cols=23  Identities=22%  Similarity=0.078  Sum_probs=20.2

Q ss_pred             hHHHHHhhhhhhccCCCceEEEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      ..+|.+.||+-+++++++|+++.
T Consensus        60 ~~~lr~aia~~~~~~~~~I~it~   82 (349)
T PRK07908         60 ERRARAAVAARHGRTPDEVLLLA   82 (349)
T ss_pred             hHHHHHHHHHHhCcChhhEEECC
Confidence            57899999999999999999863


No 71 
>cd05141 Barstar_evA4336-like Barstar_evA4336-like contains uncharacterized sequences similar to the uncharacterized, predicted RNAase inhibitor evA4336 found in Azoarcus sp. EvN1. This is a subfamily of the Barstar family of RNAase inhibitors. Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs to the same enzyme family as does barnase.
Probab=31.21  E-value=40  Score=22.61  Aligned_cols=21  Identities=29%  Similarity=0.653  Sum_probs=17.8

Q ss_pred             ecCccchHHHHHhhhhhhccC
Q psy6382          91 ISGFSNVRELYQKIAECYEFP  111 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~  111 (125)
                      .++.++..++|+.+|++|++|
T Consensus         5 g~~i~~~~~~~~~l~~~l~fP   25 (81)
T cd05141           5 LSGIADKAALLDALAAALDFP   25 (81)
T ss_pred             cccCCCHHHHHHHHHHHcCCC
Confidence            356788899999999999887


No 72 
>PF08769 Spo0A_C:  Sporulation initiation factor Spo0A C terminal;  InterPro: IPR014879 The response regulator Spo0A is comprised of a phophoacceptor domain and a transcription activation domain. This domain corresponds to the transcription activation domain and forms an alpha helical structure comprising of 6 alpha helices. The structure contains a helix-turn-helix and binds DNA [, ]. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0005509 calcium ion binding, 0006355 regulation of transcription, DNA-dependent, 0042173 regulation of sporulation resulting in formation of a cellular spore, 0005737 cytoplasm; PDB: 1FC3_C 1LQ1_D.
Probab=30.65  E-value=10  Score=27.36  Aligned_cols=19  Identities=37%  Similarity=0.569  Sum_probs=14.5

Q ss_pred             hHHHHHhhhhhhccCCCce
Q psy6382          97 VRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eI  115 (125)
                      .|+||-.||+.|+.+++.|
T Consensus        39 tK~LYp~IA~k~~TT~s~V   57 (106)
T PF08769_consen   39 TKELYPDIAKKYGTTPSRV   57 (106)
T ss_dssp             TTTHHHHHHHHTTS-HHHH
T ss_pred             hhhHHHHHHHHHCCCHHHH
Confidence            3679999999999876543


No 73 
>PF12844 HTH_19:  Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B.
Probab=30.55  E-value=12  Score=22.88  Aligned_cols=18  Identities=28%  Similarity=0.337  Sum_probs=13.8

Q ss_pred             HHHHhhhhhhccCCCceE
Q psy6382          99 ELYQKIAECYEFPAEEVQ  116 (125)
Q Consensus        99 ELY~kIAe~f~i~~~eIl  116 (125)
                      +.-.+||++|++++++++
T Consensus        42 ~~l~~i~~~~~v~~~~l~   59 (64)
T PF12844_consen   42 STLKKIAEALGVSLDELF   59 (64)
T ss_dssp             HHHHHHHHHHTS-HHHHC
T ss_pred             HHHHHHHHHhCCCHHHHh
Confidence            455899999999988764


No 74 
>PTZ00044 ubiquitin; Provisional
Probab=30.44  E-value=55  Score=20.65  Aligned_cols=27  Identities=7%  Similarity=0.079  Sum_probs=22.5

Q ss_pred             eecCccchHHHHHhhhhhhccCCCceE
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEVQ  116 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eIl  116 (125)
                      .++.-.+|++|=++|++..++|+++.-
T Consensus        16 ~v~~~~tv~~lK~~i~~~~gi~~~~q~   42 (76)
T PTZ00044         16 NFEPDNTVQQVKMALQEKEGIDVKQIR   42 (76)
T ss_pred             EECCCCcHHHHHHHHHHHHCCCHHHeE
Confidence            456678899999999999999988643


No 75 
>PRK09456 ?-D-glucose-1-phosphatase; Provisional
Probab=30.20  E-value=40  Score=24.71  Aligned_cols=23  Identities=22%  Similarity=0.355  Sum_probs=20.4

Q ss_pred             chHHHHHhhhhhhccCCCceEEE
Q psy6382          96 NVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      --.+.|+.+++.++++|+|++|.
T Consensus       142 P~p~~~~~~~~~~~~~p~~~l~v  164 (199)
T PRK09456        142 PEARIYQHVLQAEGFSAADAVFF  164 (199)
T ss_pred             CCHHHHHHHHHHcCCChhHeEEe
Confidence            44789999999999999999985


No 76 
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA. This model describes DndA, a protein related to IscS and part of a larger family of cysteine desulfurases. It is encoded, typically, divergently from a conserved, sparsely distributed operon for sulfur modification of DNA. This modification system is designated dnd, after the phenotype of DNA degradation during electrophoresis. The system is sporadically distributed in bacteria, much like some restriction enzyme operons. DndB is described as a putative ATPase.
Probab=30.14  E-value=51  Score=25.97  Aligned_cols=23  Identities=30%  Similarity=0.382  Sum_probs=20.3

Q ss_pred             hHHHHHhhhhhhccCCCceEEEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      ++++-++||+.++.++++|+|+.
T Consensus        44 ~~~~r~~la~~~g~~~~~v~~~~   66 (353)
T TIGR03235        44 VERARKQVAEALGADTEEVIFTS   66 (353)
T ss_pred             HHHHHHHHHHHhCCCCCeEEEeC
Confidence            67888999999999999999873


No 77 
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=30.11  E-value=50  Score=23.50  Aligned_cols=28  Identities=21%  Similarity=0.269  Sum_probs=20.4

Q ss_pred             CCceeecCcc-----chHHHHHhhhhhhccCCC
Q psy6382          86 SPTGLISGFS-----NVRELYQKIAECYEFPAE  113 (125)
Q Consensus        86 Sptg~I~gFs-----nVkELY~kIAe~f~i~~~  113 (125)
                      +|-|++.-|+     ++.||.+.||+-|++...
T Consensus         7 ~~~GrvhRf~~~~s~~~~~L~~~I~~Rl~~d~~   39 (86)
T cd06409           7 DPKGRVHRFRLRPSESLEELRTLISQRLGDDDF   39 (86)
T ss_pred             CCCCCEEEEEecCCCCHHHHHHHHHHHhCCccc
Confidence            3445554443     679999999999998753


No 78 
>TIGR03402 FeS_nifS cysteine desulfurase NifS. Members of this protein family are NifS, one of several related families of cysteine desulfurase involved in iron-sulfur (FeS) cluster biosynthesis. NifS is part of the NIF system, usually associated with other nif genes involved in nitrogenase expression and nitrogen fixation. The protein family is given a fairly broad interpretation here. It includes a clade nearly always found in extended nitrogen fixation genomic regions, plus a second clade more closely related to the first than to IscS and also part of NifS-like/NifU-like systems. This model does not extend to a more distantly clade found in the epsilon proteobacteria such as Helicobacter pylori, also named NifS in the literature, built instead in TIGR03403.
Probab=29.42  E-value=53  Score=26.15  Aligned_cols=24  Identities=21%  Similarity=0.331  Sum_probs=21.0

Q ss_pred             chHHHHHhhhhhhccCCCceEEEE
Q psy6382          96 NVRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      -++|+.+.||+.++.++++|+|+.
T Consensus        43 ~~~~~r~~la~~~g~~~~~i~~t~   66 (379)
T TIGR03402        43 AVEEAREQVAKLLGAEPDEIIFTS   66 (379)
T ss_pred             HHHHHHHHHHHHhCCCCCeEEEeC
Confidence            477888999999999999999973


No 79 
>PHA01976 helix-turn-helix protein
Probab=29.21  E-value=17  Score=22.45  Aligned_cols=19  Identities=5%  Similarity=0.006  Sum_probs=15.0

Q ss_pred             HHHHhhhhhhccCCCceEE
Q psy6382          99 ELYQKIAECYEFPAEEVQF  117 (125)
Q Consensus        99 ELY~kIAe~f~i~~~eIlF  117 (125)
                      +...+||++|+++++++++
T Consensus        45 ~~l~~ia~~l~v~~~~l~~   63 (67)
T PHA01976         45 KTLLRLADALGVTLDWLCG   63 (67)
T ss_pred             HHHHHHHHHHCcCHHHHhc
Confidence            3457999999999987753


No 80 
>TIGR02006 IscS cysteine desulfurase IscS. This model represents IscS, one of several cysteine desulfurases from a larger protein family designated (misleadingly, in this case) class V aminotransferases. IscS is one of at least 6 enzymes characteristic of the IscSUA-hscAB-fsx system of iron-sulfur cluster assembly. Scoring almost as well as proteobacterial sequences included in the model are mitochondrial cysteine desulfurases, apparently from an analogous system in eukaryotes. The sulfur, taken from cysteine, may be used in other systems as well, such as tRNA base modification and biosynthesis of other cofactors.
Probab=29.13  E-value=53  Score=26.76  Aligned_cols=24  Identities=21%  Similarity=0.285  Sum_probs=20.6

Q ss_pred             chHHHHHhhhhhhccCCCceEEEE
Q psy6382          96 NVRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      -++++-+.||+.++.++++|+|+.
T Consensus        48 ~~~~~r~~la~~~g~~~~~v~~~~   71 (402)
T TIGR02006        48 AVENARNQVAELIGADSREIVFTS   71 (402)
T ss_pred             HHHHHHHHHHHHhCCCCCeEEEeC
Confidence            367778999999999999999983


No 81 
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain. This domain is a member of the haloacid-dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. This superfamily is distinguished by the presence of three motifs: an N-terminal motif containing the nucleophilic aspartate, a central motif containing an conserved serine or threonine, and a C-terminal motif containing a conserved lysine (or arginine) and conserved aspartates. More specifically, the domian modelled here is a member of subfamily III of the HAD-superfamily by virtue of lacking a "capping" domain in either of the two common positions, between motifs 1 and 2, or between motifs 2 and 3.
Probab=28.98  E-value=45  Score=23.64  Aligned_cols=24  Identities=8%  Similarity=-0.115  Sum_probs=21.4

Q ss_pred             cchHHHHHhhhhhhccCCCceEEE
Q psy6382          95 SNVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      ..-.+.|+.+.+.++++++|++|+
T Consensus       101 KP~~~~~~~~~~~~~~~~~e~i~I  124 (147)
T TIGR01656       101 KPKPGLILEALKRLGVDASRSLVV  124 (147)
T ss_pred             CCCHHHHHHHHHHcCCChHHEEEE
Confidence            456789999999999999999987


No 82 
>cd02137 Nitroreductase_1 Nitroreductase-like family 1. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor.  The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.
Probab=28.76  E-value=60  Score=22.77  Aligned_cols=36  Identities=28%  Similarity=0.331  Sum_probs=28.7

Q ss_pred             cCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          84 HGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        84 HGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      +|=.+.-|.+|..     +.|.+.++++..+.+.|.+--+|
T Consensus        96 ~Glgs~~~~~~~~-----~~i~~~l~l~~~~~~~~~i~iGy  131 (148)
T cd02137          96 YGYDTCPMGGFDA-----EKVAELLNLPARYVPVMLIAIGK  131 (148)
T ss_pred             cCCCcCcCcCcCH-----HHHHHHhCcCCCceeEEEEEecc
Confidence            5666667778742     77899999999999999987776


No 83 
>TIGR01068 thioredoxin thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model.
Probab=27.19  E-value=92  Score=19.23  Aligned_cols=33  Identities=24%  Similarity=0.255  Sum_probs=25.8

Q ss_pred             CCCceEEeeecccCCCceeecCccchHHHHHhhhhh
Q psy6382          72 SKPKLIFHCQLAHGSPTGLISGFSNVRELYQKIAEC  107 (125)
Q Consensus        72 ~~p~LvFh~QLAHGSptg~I~gFsnVkELY~kIAe~  107 (125)
                      .-|.++|. +  .|....++.|+.+.+++-+.|.+.
T Consensus        68 ~~P~~~~~-~--~g~~~~~~~g~~~~~~l~~~l~~~  100 (101)
T TIGR01068        68 SIPTLLLF-K--NGKEVDRSVGALPKAALKQLINKN  100 (101)
T ss_pred             cCCEEEEE-e--CCcEeeeecCCCCHHHHHHHHHhh
Confidence            45678887 3  588889999999989988877653


No 84 
>PF05402 PqqD:  Coenzyme PQQ synthesis protein D (PqqD);  InterPro: IPR008792 This family contains several bacterial coenzyme PQQ synthesis protein D (PqqD) sequences. This protein is required for coenzyme pyrrolo-quinoline-quinone (PQQ) biosynthesis.; PDB: 3G2B_A.
Probab=27.02  E-value=23  Score=22.06  Aligned_cols=25  Identities=32%  Similarity=0.525  Sum_probs=17.1

Q ss_pred             ecCccchHHHHHhhhhhhccCCCce
Q psy6382          91 ISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      ++|=.++.|+-+++++.|+++++++
T Consensus        26 ~~g~~t~~ei~~~l~~~y~~~~~~~   50 (68)
T PF05402_consen   26 LDGPRTVEEIVDALAEEYDVDPEEA   50 (68)
T ss_dssp             --SSS-HHHHHHHHHHHTT--HHHH
T ss_pred             ccCCCCHHHHHHHHHHHcCCCHHHH
Confidence            4555789999999999999988753


No 85 
>cd02138 Nitroreductase_2 Nitroreductase-like family 2. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor.  The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.
Probab=26.91  E-value=70  Score=23.44  Aligned_cols=36  Identities=22%  Similarity=0.292  Sum_probs=29.0

Q ss_pred             cCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          84 HGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        84 HGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      .|=.++-|.||.     ++.+.+.++++..+.+.|.+--+|
T Consensus       118 lGlgt~~~~~~~-----~~~l~~~l~l~~~~~~~~~laiG~  153 (181)
T cd02138         118 MGLAAHQMGGFD-----ADKAREELNIPEDYEVEAAIAIGY  153 (181)
T ss_pred             cCcccceecCcC-----HHHHHHHhCCCCCceEEEEEEeec
Confidence            466677788884     577999999999999999887776


No 86 
>cd00489 Barstar_like Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it, thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs  to the same enzyme family as does barnase.
Probab=26.53  E-value=53  Score=22.59  Aligned_cols=21  Identities=10%  Similarity=0.346  Sum_probs=17.2

Q ss_pred             cCccchHHHHHhhhhhhccCC
Q psy6382          92 SGFSNVRELYQKIAECYEFPA  112 (125)
Q Consensus        92 ~gFsnVkELY~kIAe~f~i~~  112 (125)
                      +..++..++|+.+|++|++|.
T Consensus         6 ~~i~~~~~f~~~~~~~l~fp~   26 (85)
T cd00489           6 EDIADWEDFHARLKKKLGFPD   26 (85)
T ss_pred             ccCCCHHHHHHHHHHHhCCcc
Confidence            456788899999999998873


No 87 
>PLN02651 cysteine desulfurase
Probab=26.44  E-value=66  Score=25.70  Aligned_cols=23  Identities=17%  Similarity=0.235  Sum_probs=20.5

Q ss_pred             hHHHHHhhhhhhccCCCceEEEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      ++++.++||+.++.++++|+|+.
T Consensus        45 ~~~~r~~la~~~g~~~~~v~~t~   67 (364)
T PLN02651         45 VEKARAQVAALIGADPKEIIFTS   67 (364)
T ss_pred             HHHHHHHHHHHhCCCCCeEEEeC
Confidence            77888999999999999999963


No 88 
>cd02139 Nitroreductase_3 Nitroreductase-like family 3. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor.  The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.
Probab=25.84  E-value=98  Score=21.94  Aligned_cols=36  Identities=28%  Similarity=0.368  Sum_probs=29.2

Q ss_pred             cCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          84 HGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        84 HGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      +|=.+..+++|.     .+++.+.++++.++.+.|.+--+|
T Consensus       111 ~Glgt~~~~~~~-----~~~~~~~l~l~~~~~~~~~i~iG~  146 (164)
T cd02139         111 LGLGTCWIGAFD-----EDEIKEALDIPENEEVVAILPLGY  146 (164)
T ss_pred             cCCceeeeeccC-----HHHHHHHhCcCCCeEEEEEEeecC
Confidence            577777788884     478999999999999999887776


No 89 
>cd02149 NfsB_like_nitroreductase NAD(P)H:FMN oxidoreductase family. This domain catalyzes the reduction of flavin, nitrocompound, quinones and azo compounds using NADH or NADPH as an electron donor. The enzyme is a homodimer, and each monomer binds a FMN as co-factor. This family includes FRase I in Vibrio fischeri, wihich reduces FMN into FMNH2 as part of the bioluminescent reaction. The family also includes oxygen-insensitive nitroreductases that use NADH or NADPH as an electron donor in the ping pong bi bi mechanism. This type of nitroreductase can be used in cancer chemotherapy to activate a range of prodrugs.
Probab=25.67  E-value=64  Score=22.95  Aligned_cols=36  Identities=19%  Similarity=0.204  Sum_probs=27.0

Q ss_pred             cCCCceeecCccchHHHHHhhhhhhccCCCce-EEEEccCCC
Q psy6382          84 HGSPTGLISGFSNVRELYQKIAECYEFPAEEV-QFGALLENY  124 (125)
Q Consensus        84 HGSptg~I~gFsnVkELY~kIAe~f~i~~~eI-lFCTLNT~~  124 (125)
                      +|=.|.-|.+|.     .+++.+.++++..+. +.|.+--+|
T Consensus       104 lGlgs~~i~~~~-----~~~v~~~l~l~~~~~~~~~~i~iGy  140 (157)
T cd02149         104 LGIDSCPIEGFD-----PAKLDEILGLDEKGYGSSVMVALGY  140 (157)
T ss_pred             cCCCcCcccCcC-----HHHHHHHhCCCcccCceEEEEEeec
Confidence            566777788884     378999999998655 778776555


No 90 
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA. In the case of histidinol phosphatase and PNK-3'-phosphatase, this model represents a domain of a bifunctional system. In the histidinol phosphatase HisB, a C-terminal domain is an imidazoleglycerol-phosphate dehydratase which catalyzes a related step in histidine biosynthesis. In PNK-3'-phosphatase, N- and C-terminal domains constitute the polynucleotide kinase and DNA-binding components of the enzyme.
Probab=25.44  E-value=62  Score=21.96  Aligned_cols=24  Identities=13%  Similarity=0.231  Sum_probs=20.6

Q ss_pred             chHHHHHhhhhhh-ccCCCceEEEE
Q psy6382          96 NVRELYQKIAECY-EFPAEEVQFGA  119 (125)
Q Consensus        96 nVkELY~kIAe~f-~i~~~eIlFCT  119 (125)
                      .-.|.|+.+.+.+ +++++|++|+-
T Consensus        86 P~~~~~~~~~~~~~~~~~~~~v~IG  110 (132)
T TIGR01662        86 PKPGMFLEALKRFNEIDPEESVYVG  110 (132)
T ss_pred             CChHHHHHHHHHcCCCChhheEEEc
Confidence            4568999999999 59999999863


No 91 
>PF12833 HTH_18:  Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B ....
Probab=25.44  E-value=26  Score=22.12  Aligned_cols=25  Identities=16%  Similarity=0.315  Sum_probs=19.5

Q ss_pred             ecCccchHHHHHhhhhhhccCCCce
Q psy6382          91 ISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        91 I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      .-||+|...++...-+.||++|.|+
T Consensus        54 ~~Gf~~~~~f~~~fk~~~g~tP~~~   78 (81)
T PF12833_consen   54 ECGFSSQSHFSRAFKRYFGMTPSEY   78 (81)
T ss_dssp             HTT-SSHHHHHHHHHHHHSS-HHHH
T ss_pred             HcCCCCHHHHHHHHHHHHCcCHHHH
Confidence            3589999999999999999998764


No 92 
>PF11784 DUF3320:  Protein of unknown function (DUF3320);  InterPro: IPR021754  This family is conserved in Proteobacteria and Chlorobi families. Many members are annotated as being putative DNA helicase-related proteins. 
Probab=25.26  E-value=51  Score=20.91  Aligned_cols=21  Identities=24%  Similarity=0.354  Sum_probs=16.1

Q ss_pred             cCccchHHHHHhhhhhhccCC
Q psy6382          92 SGFSNVRELYQKIAECYEFPA  112 (125)
Q Consensus        92 ~gFsnVkELY~kIAe~f~i~~  112 (125)
                      ||==...+|+++|++++|++-
T Consensus        24 EgPI~~~~L~~Ri~~a~G~~R   44 (52)
T PF11784_consen   24 EGPIHEDELARRIARAWGLSR   44 (52)
T ss_pred             cCCccHHHHHHHHHHHcCccc
Confidence            333456889999999999863


No 93 
>PF12872 OST-HTH:  OST-HTH/LOTUS domain; PDB: 2KPM_A 3S93_B 3RCO_A 2KZV_A.
Probab=25.22  E-value=41  Score=21.07  Aligned_cols=18  Identities=33%  Similarity=0.685  Sum_probs=14.9

Q ss_pred             CccchHHHHHhhhhhhcc
Q psy6382          93 GFSNVRELYQKIAECYEF  110 (125)
Q Consensus        93 gFsnVkELY~kIAe~f~i  110 (125)
                      ||++.++|-+++.+.+.|
T Consensus        46 G~~~l~~ll~~~~~~~~i   63 (74)
T PF12872_consen   46 GFSSLSELLESLPDVVEI   63 (74)
T ss_dssp             TSSSHHHHHHT-TTTEEE
T ss_pred             CCCcHHHHHHhCCCeEEE
Confidence            999999999988887766


No 94 
>cd02148 Nitroreductase_5 Nitroreductase-like family 5.  A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor.  The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.
Probab=24.84  E-value=83  Score=23.13  Aligned_cols=37  Identities=19%  Similarity=0.147  Sum_probs=28.7

Q ss_pred             ccCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          83 AHGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        83 AHGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      ++|=.++-|.||..     +++.+.+++|......|.+--||
T Consensus       130 ~lGlgs~~~~g~d~-----~~~~~~L~lp~~~~~v~~iavGy  166 (185)
T cd02148         130 ALGLDAGPMSGFDA-----AAVDAEFFADTRWRSNFVVNIGY  166 (185)
T ss_pred             HcCCCcCCCcccCH-----HHHHHHhCCCCCeEEEEEEEcCC
Confidence            56777888999953     67889999998877777766665


No 95 
>PF08281 Sigma70_r4_2:  Sigma-70, region 4;  InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif [].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2LFW_A 1OR7_B 2H27_D 2O8X_B.
Probab=24.73  E-value=17  Score=21.67  Aligned_cols=15  Identities=27%  Similarity=0.364  Sum_probs=11.0

Q ss_pred             HHHhhhhhhccCCCc
Q psy6382         100 LYQKIAECYEFPAEE  114 (125)
Q Consensus       100 LY~kIAe~f~i~~~e  114 (125)
                      -|+.||+.++++++.
T Consensus        28 s~~eIa~~l~~s~~~   42 (54)
T PF08281_consen   28 SYAEIAEILGISEST   42 (54)
T ss_dssp             -HHHHHHHCTS-HHH
T ss_pred             CHHHHHHHHCcCHHH
Confidence            688999999998754


No 96 
>PF07736 CM_1:  Chorismate mutase type I;  InterPro: IPR008243 Chorismate mutase (CM; 5.4.99.5 from EC) catalyses the reaction at the branch point of the biosynthetic pathway leading to the three aromatic amino acids, phenylalanine, tryptophan and tyrosine (chorismic acid is the last common intermediate, and CM leads to the L-phenylalanine/L-tyrosine branch). It is part of the shikimate pathway, which is present only in bacteria, fungi and plants.  This entry represents a family of monofunctional (non-fused) chorismate mutases from Gram-positive bacteria (Firmicutes) and cyanobacteria. Trusted members of the family are found in operons with other enzymes of the chorismate pathways, both up- and downstream of CM (Listeria, Bacillus, Oceanobacillus) or are the sole CM in the genome where the other members of the chorismate pathways are found elsewhere in the genome (Nostoc, Thermosynechococcus). They are monofunctional, homotrimeric, nonallosteric enzymes and are not regulated by the end-product aromatic amino acids. The three types of CM are AroQ class, Prokaryotic type (e.g., IPR008239 from INTERPRO amongst others); AroQ class, Eukaryotic type (IPR008238 from INTERPRO); and AroH class. They fall into two structural folds (AroQ class and AroH class) which are completely unrelated []. The two types of the AroQ structural class (the Escherichia coli CM dimer and the yeast CM monomer) can be structurally superimposed, and the topology of the four-helix bundle forming the active site is conserved []. For additional information please see [, , , , , , ].; PDB: 2CHS_K 2CHT_L 1COM_J 1FNJ_A 1FNK_A 1DBF_C 1UI9_A 1ODE_A 1UFY_A 1XHO_C ....
Probab=24.67  E-value=74  Score=24.13  Aligned_cols=26  Identities=27%  Similarity=0.335  Sum_probs=20.9

Q ss_pred             cchHHHHHhhhhhhccCCCceEEEEc
Q psy6382          95 SNVRELYQKIAECYEFPAEEVQFGAL  120 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~eIlFCTL  120 (125)
                      ..++||++.|-+.=+|.++||....+
T Consensus        20 ~at~eLl~~i~~~N~l~~~dIvSi~F   45 (118)
T PF07736_consen   20 EATRELLEEILERNELSPEDIVSIIF   45 (118)
T ss_dssp             HHHHHHHHHHHHHTT--GGGEEEEEE
T ss_pred             HHHHHHHHHHHHHcCCCHHHEEEEEE
Confidence            46899999999999999999987665


No 97 
>cd02150 NADPH_oxidoreductase_1 NAD(P)H:flavin oxidoreductase-like family 1.  A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor.  The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.
Probab=23.94  E-value=95  Score=22.20  Aligned_cols=40  Identities=15%  Similarity=0.183  Sum_probs=30.0

Q ss_pred             cCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          84 HGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        84 HGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      .|=.+.-+.||.+- +...+|.+.++++..+.+.|.+-=+|
T Consensus       106 ~Glgt~~~~~~~~~-~~~~~~~~~l~l~~~~~~~~~l~iG~  145 (166)
T cd02150         106 LGLGAVWLGVYPFE-ERVEKVRELLGLPENVEPMAVIPIGY  145 (166)
T ss_pred             cCCceEEEeccccc-chHHHHHHHhCCCCCcEEEEEEEEEc
Confidence            57777888888653 45678999999999888877664443


No 98 
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit. Members of this family are the Q subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Probab=23.94  E-value=1.1e+02  Score=26.12  Aligned_cols=44  Identities=14%  Similarity=0.169  Sum_probs=34.0

Q ss_pred             ceEEeeecccCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          75 KLIFHCQLAHGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        75 ~LvFh~QLAHGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      +++.+-.+-||.+...     +++++++++-+.+++..++|-++.. |+|
T Consensus        53 ~i~~~~~~~tg~~~~~-----~a~~~l~~~l~~~g~~~~~v~~~~~-TGy   96 (293)
T TIGR03192        53 ELYGYNSMRTGNNSPD-----SAKNALQGIMDKIGMKLEDINYVVG-TGY   96 (293)
T ss_pred             EEEEEEeecCCCCHHH-----HHHHHHHHHHHHcCCcccceEEEEE-ECc
Confidence            4666666666654433     6899999999999998889998865 887


No 99 
>PF00564 PB1:  PB1 domain;  InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.; GO: 0005515 protein binding; PDB: 1IPG_A 1IP9_A 2KFK_A 1WMH_A 1VD2_A 1WI0_A 1OEY_C 1PQS_A 1Q1O_A 1TZ1_A ....
Probab=23.86  E-value=97  Score=19.68  Aligned_cols=27  Identities=22%  Similarity=0.276  Sum_probs=20.9

Q ss_pred             cCccchHHHHHhhhhhhccCCCceEEE
Q psy6382          92 SGFSNVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        92 ~gFsnVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      ..=.+..+|+++|++.|+++..++.+.
T Consensus        19 ~~~~s~~~L~~~i~~~~~~~~~~~~l~   45 (84)
T PF00564_consen   19 PSDVSFDDLRSKIREKFGLLDEDFQLK   45 (84)
T ss_dssp             CSTSHHHHHHHHHHHHHTTSTSSEEEE
T ss_pred             CCCCCHHHHHHHHHHHhCCCCccEEEE
Confidence            333578999999999999986666554


No 100
>PRK14012 cysteine desulfurase; Provisional
Probab=23.50  E-value=76  Score=25.82  Aligned_cols=24  Identities=21%  Similarity=0.214  Sum_probs=20.7

Q ss_pred             chHHHHHhhhhhhccCCCceEEEE
Q psy6382          96 NVRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      -++++-+.||+.++.++++|+||.
T Consensus        50 ~~~~~r~~ia~~~g~~~~~v~~~~   73 (404)
T PRK14012         50 AVDIARNQIADLIGADPREIVFTS   73 (404)
T ss_pred             HHHHHHHHHHHHcCcCcCeEEEeC
Confidence            467788999999999999999983


No 101
>PRK05849 hypothetical protein; Provisional
Probab=23.35  E-value=40  Score=32.12  Aligned_cols=32  Identities=16%  Similarity=0.265  Sum_probs=27.9

Q ss_pred             eecCccchHHHHHhhhhhhccCCCceEEEEcc
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEVQFGALL  121 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLN  121 (125)
                      ....|+-+++++..+++.++++++||.|||+.
T Consensus       595 ~tr~l~~~r~~l~~lG~~Lg~~~dDvf~L~~~  626 (783)
T PRK05849        595 FTRNLSDALELIALLGAYYGISREDLSHLDIK  626 (783)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCChhheeeecHH
Confidence            35568889999999999999999999999974


No 102
>PF13844 Glyco_transf_41:  Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A.
Probab=23.09  E-value=54  Score=29.55  Aligned_cols=19  Identities=26%  Similarity=0.623  Sum_probs=13.3

Q ss_pred             hhhccCCCceEEEEccCCC
Q psy6382         106 ECYEFPAEEVQFGALLENY  124 (125)
Q Consensus       106 e~f~i~~~eIlFCTLNT~~  124 (125)
                      ..|+||.+.|.||.+|.-|
T Consensus       277 ~~~gLp~d~vvF~~fn~~~  295 (468)
T PF13844_consen  277 AQYGLPEDAVVFGSFNNLF  295 (468)
T ss_dssp             GGGT--SSSEEEEE-S-GG
T ss_pred             HHcCCCCCceEEEecCccc
Confidence            6899999999999999754


No 103
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549).
Probab=22.84  E-value=76  Score=23.09  Aligned_cols=22  Identities=9%  Similarity=0.066  Sum_probs=19.3

Q ss_pred             hHHHHHhhhhhhccCCCceEEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlFC  118 (125)
                      -.+.|+.+++.+++++++++|.
T Consensus       152 ~~~~~~~~~~~~~~~~~~~~~i  173 (221)
T TIGR02253       152 HPKIFYAALKRLGVKPEEAVMV  173 (221)
T ss_pred             CHHHHHHHHHHcCCChhhEEEE
Confidence            4579999999999999998875


No 104
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These enzymes are members of the haloacid dehalogenase (HAD) superfamily of hydrolases, specifically the IA subfamily (variant 3, TIGR01509).
Probab=22.79  E-value=86  Score=22.42  Aligned_cols=23  Identities=17%  Similarity=0.096  Sum_probs=20.0

Q ss_pred             chHHHHHhhhhhhccCCCceEEE
Q psy6382          96 NVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      --.+.|+.+.+.+++.|+|++|.
T Consensus       142 P~p~~~~~~~~~~~~~~~~~l~v  164 (184)
T TIGR01993       142 PSPQAYEKALREAGVDPERAIFF  164 (184)
T ss_pred             CCHHHHHHHHHHhCCCccceEEE
Confidence            35689999999999999998875


No 105
>PRK01533 histidinol-phosphate aminotransferase; Validated
Probab=22.51  E-value=65  Score=26.30  Aligned_cols=23  Identities=30%  Similarity=0.328  Sum_probs=20.3

Q ss_pred             hHHHHHhhhhhhccCCCceEEEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      ..+|.+.||+-+++++++|+++.
T Consensus        66 ~~~Lr~aia~~~~~~~~~I~vt~   88 (366)
T PRK01533         66 ATTLRQTIANKLHVKMEQVLCGS   88 (366)
T ss_pred             HHHHHHHHHHHhCCCcceEEECC
Confidence            47899999999999999999863


No 106
>PRK05387 histidinol-phosphate aminotransferase; Provisional
Probab=22.48  E-value=53  Score=25.70  Aligned_cols=21  Identities=38%  Similarity=0.501  Sum_probs=19.1

Q ss_pred             HHHHHhhhhhhccCCCceEEE
Q psy6382          98 RELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        98 kELY~kIAe~f~i~~~eIlFC  118 (125)
                      .+|.+.||+-+++++++|++.
T Consensus        63 ~~lr~aia~~~~~~~~~I~it   83 (353)
T PRK05387         63 DALRQAIAAYYGLDPEQVFVG   83 (353)
T ss_pred             HHHHHHHHHHhCCCHHHEEEc
Confidence            689999999999999999864


No 107
>PF14109 GldH_lipo:  GldH lipoprotein
Probab=22.33  E-value=22  Score=26.09  Aligned_cols=25  Identities=28%  Similarity=0.494  Sum_probs=18.4

Q ss_pred             CceEEeeeccc--CCCceeecCccchHHH
Q psy6382          74 PKLIFHCQLAH--GSPTGLISGFSNVREL  100 (125)
Q Consensus        74 p~LvFh~QLAH--GSptg~I~gFsnVkEL  100 (125)
                      -+=..+|+||.  |.+.|  +||++++|.
T Consensus        66 ~~dtl~~~Lad~~G~w~G--~G~~~~~e~   92 (131)
T PF14109_consen   66 VTDTLECELADPDGKWLG--KGIGDLYEY   92 (131)
T ss_pred             EeeeEEEEEECCCCcEee--eeEeEeEEE
Confidence            34578999999  66666  788876653


No 108
>PRK02289 4-oxalocrotonate tautomerase; Provisional
Probab=22.25  E-value=77  Score=19.84  Aligned_cols=19  Identities=21%  Similarity=0.394  Sum_probs=14.8

Q ss_pred             hHHHHHhhhhhhccCCCce
Q psy6382          97 VRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eI  115 (125)
                      ++++++.++++|++|++.|
T Consensus        21 ~~~it~a~~~~~~~p~~~v   39 (60)
T PRK02289         21 AREVTEVVSRIAKAPKEAI   39 (60)
T ss_pred             HHHHHHHHHHHhCcCcceE
Confidence            3567788889999987765


No 109
>COG3384 Aromatic ring-opening dioxygenase, catalytic LigB subunit related    enzyme [Amino acid transport and metabolism]
Probab=22.22  E-value=80  Score=26.99  Aligned_cols=36  Identities=19%  Similarity=0.285  Sum_probs=25.9

Q ss_pred             eecccCCCceeecCccchHHHHHhhh-hhhccCCCceE
Q psy6382          80 CQLAHGSPTGLISGFSNVRELYQKIA-ECYEFPAEEVQ  116 (125)
Q Consensus        80 ~QLAHGSptg~I~gFsnVkELY~kIA-e~f~i~~~eIl  116 (125)
                      -=|+||||+=.++. +...+..+.|+ +|-++-|+-|+
T Consensus        12 LflshgsP~~~~~~-n~~~~~l~~lG~~~~e~rp~tIi   48 (268)
T COG3384          12 LFLSHGSPMLALED-NAATRGLRELGRELPELRPDTII   48 (268)
T ss_pred             eeecCCCcccccCc-cHHHHHHHHHHHhhhhcCCCEEE
Confidence            34899999988887 66777777887 34445566665


No 110
>KOG1175|consensus
Probab=22.22  E-value=59  Score=30.48  Aligned_cols=40  Identities=20%  Similarity=0.228  Sum_probs=31.6

Q ss_pred             CCceEEeeecccCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          73 KPKLIFHCQLAHGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        73 ~p~LvFh~QLAHGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      .|+.+-|+|  +|.+.+.+..+          ...|++.++||++|+-+.++
T Consensus       253 ~PK~v~ht~--~g~ll~~~~~~----------~~~~d~q~~dv~~~~~d~GW  292 (626)
T KOG1175|consen  253 KPKGVIHTT--GGYLLGAALTS----------RYHFDLQPSDVLWCASDLGW  292 (626)
T ss_pred             CCCceeecc--CcchHHHhhhc----------ceeccCCCcceEEEecccCe
Confidence            788888888  47776654443          57899999999999988764


No 111
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only. This model describes iron-only hydrogenases of anaerobic and microaerophilic bacteria and protozoa. This model is narrower, and covers a longer stretch of sequence, than Pfam model pfam02906. This family represents a division among families that belong to pfam02906, which also includes proteins such as nuclear prelamin A recognition factor in animals. Note that this family shows some heterogeneity in terms of periplasmic, cytosolic, or hydrogenosome location, NAD or NADP dependence, and overal protein protein length.
Probab=22.18  E-value=33  Score=28.83  Aligned_cols=31  Identities=19%  Similarity=0.289  Sum_probs=24.4

Q ss_pred             eeecCccchHHHHHhhhh-hhccCCCceEEEE
Q psy6382          89 GLISGFSNVRELYQKIAE-CYEFPAEEVQFGA  119 (125)
Q Consensus        89 g~I~gFsnVkELY~kIAe-~f~i~~~eIlFCT  119 (125)
                      ..++||.|++++.++|.. -....--|||.|-
T Consensus       331 ~~~~G~~~~~~~l~~~~~g~~~~~fiE~maC~  362 (374)
T TIGR02512       331 AVAHGLGNARKLLDDVKAGEADYHFIEVMACP  362 (374)
T ss_pred             EEEeCHHHHHHHHHHHHcCCCCccEEEECCCC
Confidence            458999999999999963 2355677899984


No 112
>cd09216 GH64-LPHase-like glycoside hydrolase family 64: laminaripentaose-producing, beta-1,3-glucanase (LPHase)-like. This subfamily is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cel
Probab=22.05  E-value=34  Score=29.96  Aligned_cols=41  Identities=22%  Similarity=0.294  Sum_probs=30.2

Q ss_pred             CCCceEEeeecccCCCceeecC----ccchHHHHHhhhhhhcc-CCCceEEE
Q psy6382          72 SKPKLIFHCQLAHGSPTGLISG----FSNVRELYQKIAECYEF-PAEEVQFG  118 (125)
Q Consensus        72 ~~p~LvFh~QLAHGSptg~I~g----FsnVkELY~kIAe~f~i-~~~eIlFC  118 (125)
                      ....|+|++|-..|--+|||+|    |+.-      -++.|.= +..||++|
T Consensus       216 ~~~~L~v~tq~~~g~~~GrV~g~~l~f~~~------~~~~f~kPst~dIf~C  261 (353)
T cd09216         216 RTTDLTVTTFSDGGTFTGRVSGDWLRFTGG------NVAAFAKPSTRDVLFC  261 (353)
T ss_pred             cCCceEEecCCCcceEEEEEeCCeeEEeCC------CcceeCCCChHHHhcc
Confidence            4567999999889999999988    4321      1344543 67899999


No 113
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N   HOIL-1 (heme-oxidized IRP2 ubiquitin ligase-1) is an E3 ubiquitin-protein ligase that recognizes heme-oxidized IRP2 (iron regulatory protein2) and is thought to affect the turnover of oxidatively damaged proteins.  Hoil-1 has an amino-terminal ubiquitin-like domain as well as an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.
Probab=22.00  E-value=68  Score=21.39  Aligned_cols=26  Identities=23%  Similarity=0.238  Sum_probs=21.6

Q ss_pred             eecCccchHHHHHhhhhhhccCCCce
Q psy6382          90 LISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        90 ~I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      .|+.-.+|.+|-++|.+.++||+++.
T Consensus        18 ~v~~~~TV~~lK~kI~~~~gip~~~Q   43 (75)
T cd01799          18 TVRPDMTVAQLKDKVFLDYGFPPAVQ   43 (75)
T ss_pred             EECCCCcHHHHHHHHHHHHCcCHHHE
Confidence            45566789999999999999998753


No 114
>cd02146 NfsA_FRP This family contains NADPH-dependent flavin reductase and oxygen-insensitive nitroreductase. These enzymes are homodimeric flavoproteins that contain one FMN per monomer as a cofactor. Flavin reductase catalyzes the reduction of flavin by using NADPH as an electron donor. Oxygen-insensitive nitroreductase, such as NfsA protein in Escherichia coli, catalyzes reduction of nitrocompounds using NADPH as electron donor.
Probab=21.96  E-value=1.1e+02  Score=23.38  Aligned_cols=38  Identities=21%  Similarity=0.201  Sum_probs=29.6

Q ss_pred             cCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          84 HGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        84 HGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      .|=.|+-|.||.+-   ..++.+.++||....+.|.|--+|
T Consensus       124 lGLgtc~ig~~~~~---~~~v~~~L~lp~~~~~~~~ialGy  161 (229)
T cd02146         124 LGLGIVYIGGIRND---PEAVIELLNLPEYVFPVFGLAVGY  161 (229)
T ss_pred             cCCCEEEEcccccC---HHHHHHHhCCCCCceEEEEEEeec
Confidence            46677888898642   367899999999888888887766


No 115
>PF00881 Nitroreductase:  Nitroreductase family;  InterPro: IPR000415 This entry represents a family of proteins consisting of nitroreductase enzymes and related oxidoreductases. Members of this family utilise FMN as a cofactor and are often found to be homodimers. Possible characteristics include Oxygen-insensitive NAD(P)H nitroreductase (FMN-dependent nitroreductase) (Dihydropteridine reductase) (1.6.99.7 from EC) and NADH dehydrogenase (1.6.99.3 from EC). A number of the proteins are described as oxidoreductases. They are primarily found in bacterial lineages though a number of eukaryotic homologs have been identified: Caenorhabditis elegans P34273 from SWISSPROT, Drosophila melanogaster (Fruit fly) Q8T3Q0 from SWISSPROT Q9VTE7 from SWISSPROT, Mus musculus (Mouse) Q9DCX8 from SWISSPROT and Homo sapiens (Human) O75989 from SWISSPROT. This protein is not found in photosynthetic eukaryotes. The sequences containing this entry in photosynthetic organisms are possible false positives. ; GO: 0016491 oxidoreductase activity; PDB: 1BKJ_A 2BKJ_B 3OF4_C 3E39_B 3GBH_B 2R01_A 1YWQ_A 2WZW_B 2WZV_B 2ISL_H ....
Probab=21.93  E-value=27  Score=23.63  Aligned_cols=38  Identities=24%  Similarity=0.420  Sum_probs=28.3

Q ss_pred             ccCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          83 AHGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        83 AHGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      |+|=.+.-+.+|...++    +.+.|++|.++-+.|.+--+|
T Consensus       128 a~Gl~~~~~~~~~~~~~----~~~~lgl~~~~~~~~~i~vGy  165 (165)
T PF00881_consen  128 ALGLGSCPMGGFDDDKE----LKELLGLPDNEEPLALIAVGY  165 (165)
T ss_dssp             HTTEEEEEEGGSGHHHH----HHHHHTHHTTEEEEEEEEEEE
T ss_pred             hcCceEEEecCcchHHH----HHHHhCcCCCCEEEEEEEecC
Confidence            34556777889977666    899999998777777775554


No 116
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins.
Probab=21.93  E-value=64  Score=16.91  Aligned_cols=17  Identities=24%  Similarity=0.325  Sum_probs=12.7

Q ss_pred             HHHHHhhhhhhccCCCc
Q psy6382          98 RELYQKIAECYEFPAEE  114 (125)
Q Consensus        98 kELY~kIAe~f~i~~~e  114 (125)
                      .+...+|++.|++++++
T Consensus        39 ~~~~~~i~~~~~~~~~~   55 (56)
T smart00530       39 LETLKKLAKALGVSLDE   55 (56)
T ss_pred             HHHHHHHHHHhCCChhh
Confidence            34457889999998765


No 117
>PRK10874 cysteine sulfinate desulfinase; Provisional
Probab=21.91  E-value=88  Score=25.21  Aligned_cols=24  Identities=8%  Similarity=0.160  Sum_probs=20.4

Q ss_pred             chHHHHHhhhhhhcc-CCCceEEEE
Q psy6382          96 NVRELYQKIAECYEF-PAEEVQFGA  119 (125)
Q Consensus        96 nVkELY~kIAe~f~i-~~~eIlFCT  119 (125)
                      -++++-++||+.++. ++++|+|+.
T Consensus        64 ~~~~~r~~la~~~g~~~~~~i~~~~   88 (401)
T PRK10874         64 RYEAAREQVAQLLNAPDAKNIVWTR   88 (401)
T ss_pred             HHHHHHHHHHHHcCCCCCCEEEEEC
Confidence            467888899999999 899999874


No 118
>PRK01688 histidinol-phosphate aminotransferase; Provisional
Probab=21.89  E-value=57  Score=26.15  Aligned_cols=21  Identities=14%  Similarity=0.191  Sum_probs=19.0

Q ss_pred             HHHHHhhhhhhccCCCceEEE
Q psy6382          98 RELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        98 kELY~kIAe~f~i~~~eIlFC  118 (125)
                      .+|.++||+.+++++++|++.
T Consensus        60 ~~l~~~~a~~~g~~~~~I~~~   80 (351)
T PRK01688         60 KAVIENYAAYAGVKPEQVLVS   80 (351)
T ss_pred             HHHHHHHHHHhCCCHHHEEEc
Confidence            689999999999999999864


No 119
>cd02152 OAT Ornithine acetyltransferase (OAT) family; also referred to as ArgJ. OAT catalyzes the first and fifth steps in arginine biosynthesis, coupling acetylation of glutamate with deacetylation of N-acetylornithine, which allows recycling of the acetyl group in the arginine biosynthetic pathway. Members of this family may experience feedback inhibition by L-arginine. The active enzyme is a heterotetramer of two alpha and two beta chains, where the alpha and beta chains are the result of autocatalytic cleavage. OATs found in the clavulanic acid biosynthesis gene cluster catalyze the fifth step only, and may utilize acetyl acceptors other than glutamate.
Probab=21.87  E-value=53  Score=29.14  Aligned_cols=28  Identities=32%  Similarity=0.547  Sum_probs=25.9

Q ss_pred             cCccchHHHHHhhhhhhccCCCceEEEE
Q psy6382          92 SGFSNVRELYQKIAECYEFPAEEVQFGA  119 (125)
Q Consensus        92 ~gFsnVkELY~kIAe~f~i~~~eIlFCT  119 (125)
                      .|+.+.++.-+..|+.+++++++||.|-
T Consensus        75 ~G~~da~~~~~~~A~~l~i~~~~VlvaS  102 (390)
T cd02152          75 QGLEDAREMAELVAELLGIPEEEVLVAS  102 (390)
T ss_pred             HHHHHHHHHHHHHHHHhCCCcccEEEeC
Confidence            6888999999999999999999999883


No 120
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase. Most likely, these sequences, like the vast majority of HAD sequences, represent phosphatase enzymes.
Probab=21.63  E-value=71  Score=23.06  Aligned_cols=22  Identities=18%  Similarity=0.129  Sum_probs=19.4

Q ss_pred             hHHHHHhhhhhhccCCCceEEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlFC  118 (125)
                      -.++|..+++.++++|++++|.
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~I  183 (203)
T TIGR02252       162 DPKIFQEALERAGISPEEALHI  183 (203)
T ss_pred             CHHHHHHHHHHcCCChhHEEEE
Confidence            4589999999999999999875


No 121
>PF11000 DUF2840:  Protein of unknown function (DUF2840);  InterPro: IPR021263  This bacterial family of proteins have no known function. 
Probab=21.48  E-value=55  Score=25.97  Aligned_cols=26  Identities=27%  Similarity=0.455  Sum_probs=23.2

Q ss_pred             eecCccchHHHHHhhh--hhhccCCCce
Q psy6382          90 LISGFSNVRELYQKIA--ECYEFPAEEV  115 (125)
Q Consensus        90 ~I~gFsnVkELY~kIA--e~f~i~~~eI  115 (125)
                      +++|+..|+...+.|-  |+.||+|.|+
T Consensus        87 r~~Gw~kV~~VL~~IDaiEalGidp~dv  114 (149)
T PF11000_consen   87 RIEGWPKVERVLQAIDAIEALGIDPADV  114 (149)
T ss_pred             cccCcHHHHHHHHHHhHHHHcCCChhhc
Confidence            5789999999999997  8999998875


No 122
>cd02145 BluB Subfamily of the nitroreductase family that includes BluB protein in Rhodobacter capsulatus is involved in the conversion of cobinamide to cobalamin in Cobalamin (vitamin B12) biosynthesis. Nitroreductases typically reduce their substrates by using NAD(P)H as electron donor and often use FMN as a cofactor.
Probab=21.41  E-value=1.2e+02  Score=22.38  Aligned_cols=36  Identities=19%  Similarity=0.235  Sum_probs=28.8

Q ss_pred             cCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          84 HGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        84 HGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      .|=.++-+.+|.     .+++.+.++||..+.+.|.+--+|
T Consensus       135 ~Glgt~~~~~~~-----~~~v~~~l~lp~~~~~~~~l~lGy  170 (196)
T cd02145         135 EGLGVGWVSILD-----PEALARLLGIPEDWEPVAYLCLGY  170 (196)
T ss_pred             cCCceEEecccC-----hHHHHHHcCcCCCcEEEEEEEEec
Confidence            455677788884     478889999999999999887766


No 123
>PRK09105 putative aminotransferase; Provisional
Probab=21.38  E-value=73  Score=25.98  Aligned_cols=21  Identities=24%  Similarity=0.213  Sum_probs=19.4

Q ss_pred             hHHHHHhhhhhhccCCCceEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQF  117 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlF  117 (125)
                      ..||.+.||+.+++++++|++
T Consensus        80 ~~~Lr~aia~~~~v~~e~I~i  100 (370)
T PRK09105         80 EDDLRTLFAAQEGLPADHVMA  100 (370)
T ss_pred             HHHHHHHHHHHhCcChhhEEE
Confidence            778999999999999999986


No 124
>cd02062 Nitro_FMN_reductase Proteins of this family catalyze the reduction of flavin or nitrocompounds using NAD(P)H as electron donor in a obligatory two-electron transfer,  utilizing FMN or FAD as cofactor. They are often found to be homodimers. Enzymes of this family are described as NAD(P)H:FMN oxidoreductases, oxygen-insensitive nitroreductase, flavin reductase P, dihydropteridine reductase, NADH oxidase or NADH dehydrogenase.
Probab=21.30  E-value=1.2e+02  Score=19.86  Aligned_cols=38  Identities=16%  Similarity=0.244  Sum_probs=27.5

Q ss_pred             cCCCceeecCccchHHHHHhhhhhhccCCCceEEEEccCCC
Q psy6382          84 HGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFGALLENY  124 (125)
Q Consensus        84 HGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFCTLNT~~  124 (125)
                      +|=.+.-+.+|..   ..+++++.+++|.++.+.|.+-=+|
T Consensus        85 ~Glg~~~~~~~~~---~~~~~~~~l~l~~~~~~~~~l~~G~  122 (122)
T cd02062          85 LGLGSCWIGGLDL---VEEELRELLGIPEGYEILAVIAVGY  122 (122)
T ss_pred             cCCCchhcCCccc---chHHHHHHhCcCCCcEEEEEEEeeC
Confidence            5666666777754   2467788899999888888875443


No 125
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=21.26  E-value=1.1e+02  Score=19.40  Aligned_cols=21  Identities=14%  Similarity=0.343  Sum_probs=16.8

Q ss_pred             chHHHHHhhhhhhccCCCceE
Q psy6382          96 NVRELYQKIAECYEFPAEEVQ  116 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eIl  116 (125)
                      +-.+|+++|++.|+++...+.
T Consensus        22 s~~dL~~~i~~~~~~~~~~~~   42 (81)
T smart00666       22 SFEDLRSKVAKRFGLDNQSFT   42 (81)
T ss_pred             CHHHHHHHHHHHhCCCCCCeE
Confidence            579999999999998754443


No 126
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Cys-tRNA(Cys) is produced by O-phosphoseryl-tRNA synthetase which ligates O-phosphoserine (Sep) to tRNA(Cys), and Sep-tRNA:Cys-tRNA synthase (SepCysS) converts Sep-tRNA(Cys) to Cys-tRNA(Cys), in methanogenic archaea. SepCysS forms a dimer, each monomer is composed of a large and small domain; the larger, a typical pyridoxal 5'-phosphate (PLP)-dependent-like enzyme fold.  In the active site of each monomer, PLP is covalently bound to a conserved Lys residue near the dimer interface.
Probab=21.20  E-value=1.1e+02  Score=24.25  Aligned_cols=36  Identities=11%  Similarity=0.129  Sum_probs=25.7

Q ss_pred             CCceEEeeecccCCCceeecCccchHHHHHhhhhhhccCCCceEEE
Q psy6382          73 KPKLIFHCQLAHGSPTGLISGFSNVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        73 ~p~LvFh~QLAHGSptg~I~gFsnVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      .|++..|.+-.+++|        .++||-+++|+.+++  ++|+++
T Consensus        30 ~~~~~~~~~~~~~~~--------~~~~l~~~la~~~g~--~~i~~~   65 (361)
T cd06452          30 VCDFCRGRLDEIEKP--------PIKDFHHDLAEFLGM--DEARVT   65 (361)
T ss_pred             CccccccccccccCc--------hHHHHHHHHHHHcCC--ceEEEe
Confidence            445555655555555        589999999999998  778764


No 127
>cd03370 NADH_oxidase NADPH_oxidase. Nitroreductase family containing NADH oxidase and other, uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor.  The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.
Probab=20.94  E-value=1.2e+02  Score=21.57  Aligned_cols=35  Identities=23%  Similarity=0.425  Sum_probs=26.9

Q ss_pred             CCCceeecCccchHHHHHhhhhhhccCC-CceEEEEccCCC
Q psy6382          85 GSPTGLISGFSNVRELYQKIAECYEFPA-EEVQFGALLENY  124 (125)
Q Consensus        85 GSptg~I~gFsnVkELY~kIAe~f~i~~-~eIlFCTLNT~~  124 (125)
                      |=.++-|.||.     ..++.+.++++. .+.+.|.+--+|
T Consensus       106 Glgs~~i~~~~-----~~~v~~~l~l~~~~~~~~~~i~iG~  141 (156)
T cd03370         106 GLATSPMTGFD-----EEKVKEALGLPGRDRAIAVVVAVGY  141 (156)
T ss_pred             CCCcccCcCcC-----HHHHHHHhCcCCcCceEEEEEEeec
Confidence            55666678885     467889999998 788888876665


No 128
>COG2169 Ada Adenosine deaminase [Nucleotide transport and metabolism]
Probab=20.90  E-value=46  Score=26.92  Aligned_cols=35  Identities=17%  Similarity=0.325  Sum_probs=29.6

Q ss_pred             eecccCCCceee---cCccchHHHHHhhhhhhccCCCc
Q psy6382          80 CQLAHGSPTGLI---SGFSNVRELYQKIAECYEFPAEE  114 (125)
Q Consensus        80 ~QLAHGSptg~I---~gFsnVkELY~kIAe~f~i~~~e  114 (125)
                      .||.||.+.+.+   .||.|.+-.|....+.++.+|.+
T Consensus       140 ~~L~~g~sv~~a~~daGf~s~s~F~~af~~~~G~~P~~  177 (187)
T COG2169         140 KQLRMGASVTDAQIDAGFESSSRFYDAFSKILGMTPTK  177 (187)
T ss_pred             HHHhCCCchhHHHHHhCCCChHHHHHHHHHHcCCChHH
Confidence            588899866544   69999999999999999998864


No 129
>PF13560 HTH_31:  Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A.
Probab=20.62  E-value=30  Score=21.46  Aligned_cols=17  Identities=24%  Similarity=0.501  Sum_probs=12.2

Q ss_pred             HHHHHhhhhhhccCCCc
Q psy6382          98 RELYQKIAECYEFPAEE  114 (125)
Q Consensus        98 kELY~kIAe~f~i~~~e  114 (125)
                      .+.+.+|+++|++++++
T Consensus        44 ~~~l~~l~~~l~~~~~~   60 (64)
T PF13560_consen   44 PDTLQRLARALGVPPDE   60 (64)
T ss_dssp             HHHHHHHHHHTT--HHH
T ss_pred             HHHHHHHHHHHCcCHHH
Confidence            45789999999998765


No 130
>COG4031 Predicted metal-binding protein [General function prediction only]
Probab=20.46  E-value=91  Score=26.26  Aligned_cols=26  Identities=35%  Similarity=0.824  Sum_probs=19.2

Q ss_pred             cCCCceeecCccchHHHHHhhhhh-hccCCCce
Q psy6382          84 HGSPTGLISGFSNVRELYQKIAEC-YEFPAEEV  115 (125)
Q Consensus        84 HGSptg~I~gFsnVkELY~kIAe~-f~i~~~eI  115 (125)
                      .|-++|      ++|+||..|||- +.--|..|
T Consensus        51 ~gDedg------~lRNl~erlae~i~s~rpe~~   77 (227)
T COG4031          51 RGDEDG------SLRNLYERLAERIYSYRPESI   77 (227)
T ss_pred             cCCCcc------hHHHHHHHHHHHHHhcCccce
Confidence            499998      778899999954 44555555


No 131
>PF05099 TerB:  Tellurite resistance protein TerB;  InterPro: IPR007791 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein []. Structurally, the DnaJ protein consists of an N-terminal conserved domain (called 'J' domain) of about 70 amino acids, a glycine-rich region ('G' domain') of about 30 residues, a central domain containing four repeats of a CXXCXGXG motif ('CRR' domain) and a C-terminal region of 120 to 170 residues. Direct interaction between DnaK and djlA is needed for the induction of the wcaABCDE operon which is involved in the synthesis of a colanic acid polysaccharide capsule. The colanic acid capsule may help the bacterium survive conditions outside the host [, ]; PDB: 2H5N_D 2JXU_A.
Probab=20.46  E-value=73  Score=21.98  Aligned_cols=20  Identities=25%  Similarity=0.464  Sum_probs=14.8

Q ss_pred             chHHHHHhhhhhhccCCCce
Q psy6382          96 NVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        96 nVkELY~kIAe~f~i~~~eI  115 (125)
                      .-+++..+||+.++|+.+++
T Consensus       116 ~E~~~l~~ia~~L~i~~~~~  135 (140)
T PF05099_consen  116 EEQEFLRRIAEALGISEEDF  135 (140)
T ss_dssp             CHHHHHHHHHHHCTS-SS--
T ss_pred             HHHHHHHHHHHHcCCCHHHH
Confidence            45778999999999999875


No 132
>PF11834 DUF3354:  Domain of unknown function (DUF3354);  InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement. Inward rectifying potassium (K(+)in) channels play an important role in turgor regulation and ion uptake in higher plants. All of them comprise, from their N-terminal to their C-terminal ends: a short hydrophilic region, a hydrophobic region structurally analogous and partially homologous to the transmembrane domain of voltage-gated animal channels from the Shaker superfamily, a putative cyclic nucleotide-binding domain, and a conserved C-terminal KHA domain. Between these last two regions, some of them (AKT1, AKT2 and SKT1) contain an ankyrin-repeat domain with six repeats homologous to those of human erythrocyte ankyrin.  This entry represents the KHA domain which is unique to plant K(+)in channels. The KHA domain contains two high-homology blocks enriched for hydrophobic and acidic residues, respectively. The KHA domain is essential for interaction of plant K(+)in channels. The KHA domain mediates tetramerization and/or stabilisation of the heteromers [, , ]. 
Probab=20.45  E-value=1.3e+02  Score=20.45  Aligned_cols=38  Identities=21%  Similarity=0.147  Sum_probs=25.0

Q ss_pred             EeeecccCCCceeecCccchHHHHHhhhhhhccCCCce
Q psy6382          78 FHCQLAHGSPTGLISGFSNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        78 Fh~QLAHGSptg~I~gFsnVkELY~kIAe~f~i~~~eI  115 (125)
                      +||+.....+..-|-==.++.||-+-.++-|++++..|
T Consensus         9 ~~~~~~~~~~GKvi~lP~SleeLl~ia~~kfg~~~~~v   46 (69)
T PF11834_consen    9 NHPPEKGRRAGKVIWLPDSLEELLKIASEKFGFSATKV   46 (69)
T ss_pred             CCCCcccCcCCEEEEcCccHHHHHHHHHHHhCCCceEE
Confidence            34655533333333333689999999999999986655


No 133
>cd01615 CIDE_N CIDE_N domain, found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins, as well as CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD(DFF45). These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of ICAD/DFF45, and the CAD/DFF40 and CIDE nucleases during apoptosis. The CIDE-N domain is also found in the FSP27/CIDE-C protein.
Probab=20.44  E-value=1.2e+02  Score=21.36  Aligned_cols=24  Identities=29%  Similarity=0.422  Sum_probs=19.8

Q ss_pred             cchHHHHHhhhhhhccCCCceEEE
Q psy6382          95 SNVRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~eIlFC  118 (125)
                      +|.+||-.|..+.|.++..++-.|
T Consensus        21 ~sL~eL~~K~~~~l~l~~~~~~lv   44 (78)
T cd01615          21 SSLEELLSKACEKLKLPSAPVTLV   44 (78)
T ss_pred             CCHHHHHHHHHHHcCCCCCCeEEE
Confidence            588999999999999976666554


No 134
>PRK14809 histidinol-phosphate aminotransferase; Provisional
Probab=20.15  E-value=83  Score=24.99  Aligned_cols=22  Identities=18%  Similarity=0.356  Sum_probs=19.8

Q ss_pred             hHHHHHhhhhhhccCCCceEEE
Q psy6382          97 VRELYQKIAECYEFPAEEVQFG  118 (125)
Q Consensus        97 VkELY~kIAe~f~i~~~eIlFC  118 (125)
                      ..+|.+.||+-+++++++|+.+
T Consensus        67 ~~~lr~~ia~~~~~~~~~I~it   88 (357)
T PRK14809         67 HADLTAALADRWDVSPEQVWLA   88 (357)
T ss_pred             HHHHHHHHHHHhCCCcceEEEC
Confidence            5789999999999999999865


No 135
>PF12085 DUF3562:  Protein of unknown function (DUF3562);  InterPro: IPR021945  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 62 to 84 amino acids in length. This protein has two completely conserved residues (A and Y) that may be functionally important. 
Probab=20.15  E-value=42  Score=23.32  Aligned_cols=21  Identities=48%  Similarity=0.520  Sum_probs=18.6

Q ss_pred             cchHHHHHhhhhhhccCCCce
Q psy6382          95 SNVRELYQKIAECYEFPAEEV  115 (125)
Q Consensus        95 snVkELY~kIAe~f~i~~~eI  115 (125)
                      .|+.|+-++||+..++|.+++
T Consensus         4 ~~~~e~i~~iA~~t~~P~e~V   24 (66)
T PF12085_consen    4 DNVDEVIRSIAEETGTPAETV   24 (66)
T ss_pred             ccHHHHHHHHHHHHCCCHHHH
Confidence            588999999999999998765


No 136
>PTZ00397 macrophage migration inhibition factor-like protein; Provisional
Probab=20.04  E-value=92  Score=21.64  Aligned_cols=21  Identities=14%  Similarity=0.180  Sum_probs=15.8

Q ss_pred             HHHHHhhh----hhhccCCCceEEE
Q psy6382          98 RELYQKIA----ECYEFPAEEVQFG  118 (125)
Q Consensus        98 kELY~kIA----e~f~i~~~eIlFC  118 (125)
                      +++|+.|+    +..+|++++|.-.
T Consensus        75 ~~l~~~i~~~l~~~lgi~~~rv~I~   99 (116)
T PTZ00397         75 SSIAAAITKILASHLKVKSERVYIE   99 (116)
T ss_pred             HHHHHHHHHHHHHHhCcCcccEEEE
Confidence            46666666    7789999998754


Done!