Diaphorina citri psyllid: psy6388

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480

MAKSGTLYSWPDNFRTYQILIAAEYSSFKVNIPKDFVFGKSNKNADFVSKFSSPKVPAFESSDGTILTSSSAITYFVANEQLKGKTEAEKSKIFDYVCFAQDELLPNACRWVFPILEIYPYNKQTVDSAKDGLKRNLAKLDKHLLTRTYLVGDYITLADICNACTLLQVYQHAMDLTFRKPYVNVNRWFTTIVNQPEFKKIVGEVKLCEKQVNEAALASQSGNVPAAKEEKPKKEKKEAPKKEKEPEPEADDPMDDILAAEPKSKDPFDLLPKGTFNMEDFKRFYSNNDEAKSIPYFWEKFDKENYSIWFGEYKYPEELQKVFMSCNLITGMFQRLDKMRKQTFASVCLFGTDNDSTISGVWVWRGQELAFNPDELQKVFMSCNLITGMFQRLDKMRKQAFASVCLFGTDNDSTISGVWVWRGQELAFNLSPDWKVDYESYDWKKLDPEAKETKNLVAQYFSWDGTDSKGRKFNQGKIFK

cccccEEEcccccccHHHHHHHHHHccccEEEccccccccccccHHHHHHcccccccEEEcccccEEEcHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccEEEcccccHHHHHccccccccccccccccccccccHHccccccccccccccccccccHHHccccccccccccccccccccccHHcccccccccccccHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccEEEEEEEEccccccccccHHHHHHcccccccccEEccccHHHHHHEEEEcccccccccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccc

*AKSGTLYSWPDNFRTYQILIAAEYSSFKVNIPKDFVFGKSNKNADFVSKFSSPKVPAFESSDGTILTSSSAITYFVANEQLKGKTEAEKSKIFDYVCFAQDELLPNACRWVFPILEIYPYNKQTVDSAKDGLKRNLAKLDKHLLTRTYLVGDYITLADICNACTLLQVYQHAMDLTFRKPYVNVNRWFTTIVNQPEFKKIVGEVKLCEKQV***********************************************************PKGTFNMEDFKRFYSNNDEAKSIPYFWEKFDKENYSIWFGEYKYPEELQKVFMSCNLITGMFQRLDKMRKQTFASVCLFGTDNDSTISGVWVWRGQELAFNPDELQKVFMSCNLITGMFQRLDKMRKQAFASVCLFGTDNDSTISGVWVWRGQELAFNLSPDWKVDYESYDWKKLDPEAKETKNLVAQYFSWDGTDSKGRKFNQGKIFK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Elongation factor 1-gamma	Probably plays a role in anchoring the complex to other cellular components.	confident	Q9NJH0
Elongation factor 1-gamma	Probably plays a role in anchoring the complex to other cellular components.	confident	P29694
Elongation factor 1-gamma	Probably plays a role in anchoring the complex to other cellular components.	confident	Q6PE25

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0035071 [BP]	salivary gland cell autophagic cell death	probable	GO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0006412 [BP]	translation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PBU, chain A
Confidence level:very confident
Coverage over the Query: 264-331,389-480
View the alignment between query and template
View the model in PyMOL

Template: 1NHY, chain A
Confidence level:very confident
Coverage over the Query: 3-215
View the alignment between query and template
View the model in PyMOL

Template: 1PBU, chain A
Confidence level:very confident
Coverage over the Query: 258-375
View the alignment between query and template
View the model in PyMOL