Diaphorina citri psyllid: psy6422


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MSPHYTTHRDLIALFLLELEPLTILQTFFYAISSSKSSNIIVLVLAQIMGMYFVSSVLLMRMNMPPEYRSIISKVLGDLQFNFYHRWFDVIFLLSALSSIVFLPFSYVHPNIFLQWTIEQGISRIGVIGVTVMALLSGFGAFFYAISSSKSSNIIVLVLAQIMGMYFVSSVDILREAAVQRL
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccEEHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccccEEEEEHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
*****TTHRDLIALFLLELEPLTILQTFFYAISSSKSSNIIVLVLAQIMGMYFVSSVLLMRMNMPPEYRSIISKVLGDLQFNFYHRWFDVIFLLSALSSIVFLPFSYVHPNIFLQWTIEQGISRIGVIGVTVMALLSGFGAFFYAISSSKSSNIIVLVLAQIMGMYFVSSVDILREAAV***
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPHYTTHRDLIALFLLELEPLTILQTFFYAISSSKSSNIIVLVLAQIMGMYFVSSVLLMRMNMPPEYRSIISKVLGDLQFNFYHRWFDVIFLLSALSSIVFLPFSYVHPNIFLQWTIEQGISRIGVIGVTVMALLSGFGAFFYAISSSKSSNIIVLVLAQIMGMYFVSSVDILREAAVQRL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative Golgi pH regulator C confidentA6NKF9
Golgi pH regulator Voltage dependent anion channel required for acidification and functions of the Golgi apparatus that may function in counter-ion conductance.confidentQ8BS95
Golgi pH regulator Voltage dependent anion channel required for acidification and functions of the Golgi apparatus that may function in counter-ion conductance.confidentQ5F448

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008308 [MF]voltage-gated anion channel activityprobableGO:0022891, GO:0005244, GO:0005215, GO:0005216, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0003674, GO:0022838, GO:0022892, GO:0022803, GO:0022839, GO:0005253, GO:0008509, GO:0022836
GO:0051452 [BP]intracellular pH reductionprobableGO:0019725, GO:0042592, GO:0044699, GO:0045851, GO:0008150, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0055080, GO:0030004, GO:0044763, GO:0055067, GO:0030003, GO:0051453, GO:0065007, GO:0055082, GO:0065008, GO:0030641
GO:0030660 [CC]Golgi-associated vesicle membraneprobableGO:0043229, GO:0005622, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031982, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0005794, GO:0005798, GO:0030659, GO:0012505, GO:0012506, GO:0031090, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0032580 [CC]Golgi cisterna membraneprobableGO:0043229, GO:0005622, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031985, GO:0031984, GO:0031090, GO:0016020, GO:0044431, GO:0005795, GO:0005794, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0044070 [BP]regulation of anion transportprobableGO:0051049, GO:0008150, GO:0065007, GO:0032879, GO:0050789, GO:0043269
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043123 [BP]positive regulation of I-kappaB kinase/NF-kappaB cascadeprobableGO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043122, GO:0048522
GO:0010427 [MF]abscisic acid bindingprobableGO:0043168, GO:0043178, GO:0019840, GO:0031406, GO:0008289, GO:0043167, GO:0036094, GO:0003674, GO:0005488, GO:0033293, GO:0042562
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0004871 [MF]signal transducer activityprobableGO:0060089, GO:0003674
GO:0043588 [BP]skin developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0048513, GO:0008150, GO:0048731, GO:0008544, GO:0007275, GO:0044699
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted