Query         psy6425
Match_columns 68
No_of_seqs    101 out of 194
Neff          5.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:40:45 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6425.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6425hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04597 Ribophorin_I:  Ribopho 100.0 4.2E-28 9.1E-33  181.9   9.1   67    2-68    161-227 (432)
  2 KOG2291|consensus               99.9 2.5E-28 5.4E-33  188.9   7.7   67    2-68    188-254 (602)
  3 PF15092 UPF0728:  Uncharacteri  39.0      16 0.00035   22.9   0.9   10    9-18      8-17  (88)
  4 cd06419 GH25_muramidase_2 Unch  38.7      15 0.00033   24.9   0.9   14   44-57      9-23  (190)
  5 PF04022 Staphylcoagulse:  Stap  27.1      36 0.00078   16.9   0.9   11    4-14     17-27  (27)
  6 cd06523 GH25_PlyB-like PlyB is  27.0      27 0.00057   23.1   0.5   13   44-56      1-14  (177)
  7 PF09544 DUF2381:  Protein of u  20.3 2.3E+02  0.0049   20.7   4.3   45    5-49     71-123 (289)
  8 TIGR02268 Myxococcus xanthus p  19.6 2.3E+02  0.0049   21.2   4.2   46    6-51     76-129 (295)
  9 PF01289 Thiol_cytolysin:  Thio  19.4      46   0.001   26.3   0.5   13   42-54    446-459 (467)
 10 cd06522 GH25_AtlA-like AtlA is  17.1      61  0.0013   21.6   0.7   10   45-54      3-13  (192)

No 1  
>PF04597 Ribophorin_I:  Ribophorin I;  InterPro: IPR007676 Ribophorin I is an essential subunit of oligosaccharyltransferase (OST), which is also known as dolichyl-diphosphooligosaccharide--protein glycosyltransferase, (2.4.1.119 from EC). OST catalyses the transfer of an oligosaccharide from dolichol pyrophosphate to selected asparagine residues of nascent polypeptides as they are translocated into the lumen of the rough endoplasmic reticulum. Ribophorin I and OST48 are thought to be responsible for OST catalytic activity []. Both yeast and mammalian proteins are glycosylated but the sites are not conserved. Glycosylation may contribute towards general solubility but is unlikely to be involved in a specific biochemical function []. Most family members are predicted to have a transmembrane helix at the C terminus of this region.; GO: 0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity, 0006486 protein glycosylation, 0005783 endoplasmic reticulum, 0016021 integral to membrane
Probab=99.95  E-value=4.2e-28  Score=181.89  Aligned_cols=67  Identities=49%  Similarity=0.900  Sum_probs=64.9

Q ss_pred             CceeecCeEEEcccCcCCCCCcccEEEEEecCCCceEEeEEEEEEEEeccccceeeeEEEeEEcccC
Q psy6425           2 PTTQVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWGNPKNPDNDSIESGFIR   68 (68)
Q Consensus         2 ~~~~~g~~i~yGP~~~v~p~t~~p~~VhYe~n~P~~~v~~L~R~IeVSHWgni~veE~y~l~n~~~~   68 (68)
                      |.+++|++|+||||+|++||+.+|++||||||.||++|++|+|+|||||||||||||+|+|+|.+|+
T Consensus       161 ~~~~~~~~i~yGP~~~v~p~~~~~~~vhye~n~P~~~v~~l~R~IeVSHWgni~veE~y~l~N~GA~  227 (432)
T PF04597_consen  161 PPKKKGNTITYGPYENVPPFSSQPLSVHYENNAPFLTVTSLERDIEVSHWGNIAVEEYYELRNDGAK  227 (432)
T ss_pred             CceecCCeEEeccccccCCCCcccEEEEEECCCCceEEEEEEEEEEEcCCccEEEEEEEEEEEcCcc
Confidence            6789999999999999999999999999999999999999999999999999999999999999874


No 2  
>KOG2291|consensus
Probab=99.95  E-value=2.5e-28  Score=188.87  Aligned_cols=67  Identities=40%  Similarity=0.847  Sum_probs=64.6

Q ss_pred             CceeecCeEEEcccCcCCCCCcccEEEEEecCCCceEEeEEEEEEEEeccccceeeeEEEeEEcccC
Q psy6425           2 PTTQVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWGNPKNPDNDSIESGFIR   68 (68)
Q Consensus         2 ~~~~~g~~i~yGP~~~v~p~t~~p~~VhYe~n~P~~~v~~L~R~IeVSHWgni~veE~y~l~n~~~~   68 (68)
                      |.+++|+.|+||||+|+++|+++|+.||||||.||+++++|+|+|||||||||||||+|+|+|++|+
T Consensus       188 ~~k~~gn~l~yGPyeni~afs~~pl~VhYEnnaPf~~v~~L~R~IevSHWgnIqVeE~~~lth~gAk  254 (602)
T KOG2291|consen  188 PSKRSGNELKYGPYENIPAFSQEPLVVHYENNAPFVTVENLEREIEVSHWGNIQVEENYELTHKGAK  254 (602)
T ss_pred             cccccCceeeecCccccccccCCceEEEEecCCCcceeeeEEEEEEeecceeeEEEEEEEEEeccee
Confidence            4578999999999999999999999999999999999999999999999999999999999999874


No 3  
>PF15092 UPF0728:  Uncharacterised protein family UPF0728
Probab=38.97  E-value=16  Score=22.92  Aligned_cols=10  Identities=60%  Similarity=1.198  Sum_probs=7.9

Q ss_pred             eEEEcccCcC
Q psy6425           9 TITYGPYENV   18 (68)
Q Consensus         9 ~i~yGP~~~v   18 (68)
                      +|.||||+..
T Consensus         8 ~iryGPY~a~   17 (88)
T PF15092_consen    8 TIRYGPYSAC   17 (88)
T ss_pred             EEEecCchhh
Confidence            5899999743


No 4  
>cd06419 GH25_muramidase_2 Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain.  Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
Probab=38.72  E-value=15  Score=24.95  Aligned_cols=14  Identities=14%  Similarity=0.019  Sum_probs=10.6

Q ss_pred             EEEEEecc-ccceee
Q psy6425          44 RQIEVSHW-GNPKNP   57 (68)
Q Consensus        44 R~IeVSHW-gni~ve   57 (68)
                      +-|.|||| |+|..+
T Consensus         9 ~GIDVS~~qg~IDw~   23 (190)
T cd06419           9 LGVQLSQDDGYIDFN   23 (190)
T ss_pred             cCEEeCCCCCccCHH
Confidence            67999999 676543


No 5  
>PF04022 Staphylcoagulse:  Staphylocoagulase repeat;  InterPro: IPR001443 Staphylocoagulase is an extracellular protein produced by several strains of Staphylococcus aureus and which specifically forms a complex with prothrombin [, ]. This complex named staphylothrombin can clot fibrinogen without any proteolytic cleavage of prothrombin. The C terminus of staphylocoagulase contains the tandem repeat which does not seem to be required for the procoagulant activity.
Probab=27.14  E-value=36  Score=16.91  Aligned_cols=11  Identities=36%  Similarity=0.764  Sum_probs=8.1

Q ss_pred             eeecCeEEEcc
Q psy6425           4 TQVEQTITYGP   14 (68)
Q Consensus         4 ~~~g~~i~yGP   14 (68)
                      +.++++++||+
T Consensus        17 t~~dgtvsyga   27 (27)
T PF04022_consen   17 TNQDGTVSYGA   27 (27)
T ss_pred             eccCceEecCC
Confidence            35677899986


No 6  
>cd06523 GH25_PlyB-like PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis.  PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b.  Both domains are required for effective catalytic activity.  Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny.  Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
Probab=26.96  E-value=27  Score=23.15  Aligned_cols=13  Identities=23%  Similarity=0.603  Sum_probs=9.8

Q ss_pred             EEEEEecc-cccee
Q psy6425          44 RQIEVSHW-GNPKN   56 (68)
Q Consensus        44 R~IeVSHW-gni~v   56 (68)
                      |.|.|||| |+|..
T Consensus         1 ~viDVS~~qg~id~   14 (177)
T cd06523           1 AIVDISEWQGPINW   14 (177)
T ss_pred             CceeecccCCCCCH
Confidence            46899999 56654


No 7  
>PF09544 DUF2381:  Protein of unknown function (DUF2381);  InterPro: IPR011754 This family consists of at least 8 paralogs in Myxococcus xanthus, a member of the Deltaproteobacteria. The function is unknown.
Probab=20.30  E-value=2.3e+02  Score=20.74  Aligned_cols=45  Identities=27%  Similarity=0.476  Sum_probs=34.7

Q ss_pred             eecCeEEEcccCcCCCCCcccEEEEEecCC-----CceEEe---EEEEEEEEe
Q psy6425           5 QVEQTITYGPYENVPPYTKANITIHYENNS-----PFLVVT---RLVRQIEVS   49 (68)
Q Consensus         5 ~~g~~i~yGP~~~v~p~t~~p~~VhYe~n~-----P~~~v~---~L~R~IeVS   49 (68)
                      ..+++++.-|-.++.+-+..+|+|.|-..+     .|.-++   ..++.|+|+
T Consensus        71 ~g~~~l~L~P~~~l~~ger~~L~V~f~dg~aP~~a~f~Lv~~p~~vD~qVeV~  123 (289)
T PF09544_consen   71 VGERSLILVPSEDLPEGERLPLTVRFADGAAPARAVFVLVTHPAEVDRQVEVF  123 (289)
T ss_pred             ccCCEEEEEECccCCCCCceEEEEEECCCCCccceEEEEEcChhhcccEEEEE
Confidence            457889999999999999999999998876     333333   466777775


No 8  
>TIGR02268 Myxococcus xanthus paralogous family TIGR02268. This family consists of at least 8 paralogs in Myxococcus xanthus, a member of the Deltaproteobacteria. The function is unknown.
Probab=19.63  E-value=2.3e+02  Score=21.22  Aligned_cols=46  Identities=26%  Similarity=0.458  Sum_probs=36.1

Q ss_pred             ecCeEEEcccCcCCCCCcccEEEEEecCC-CceEE-------eEEEEEEEEecc
Q psy6425           6 VEQTITYGPYENVPPYTKANITIHYENNS-PFLVV-------TRLVRQIEVSHW   51 (68)
Q Consensus         6 ~g~~i~yGP~~~v~p~t~~p~~VhYe~n~-P~~~v-------~~L~R~IeVSHW   51 (68)
                      .+++|..-|-+++.+-..-+++|+|-.-+ |.--+       ...++.|+|+-=
T Consensus        76 g~~~l~L~P~~~L~~gERl~L~V~F~DGa~P~~a~f~LV~~p~~vD~~VeV~R~  129 (295)
T TIGR02268        76 TETHLILVPSEALPEGERLPLTVRFADGAVPQRAVLELVTDPARVERQVEVRRH  129 (295)
T ss_pred             CCcEEEEEEccccCCCCceEEEEEEcCCCCCcceEEEEEeCCcccceEEEEEcC
Confidence            46678899999999999999999999888 76322       456778888743


No 9  
>PF01289 Thiol_cytolysin:  Thiol-activated cytolysin;  InterPro: IPR001869 Thiol-activated cytolysins [] are toxins produced by a variety of Gram-positive bacteria and are characterised by their ability to lyse cholesterol-containing membranes, their reversible inactivation by oxidation and their capacity to bind to cholesterol. All these proteins contain a single cysteine residue, located in their C-terminal section, which has been shown [] to be essential for the binding to cholesterol.; GO: 0015485 cholesterol binding, 0009405 pathogenesis; PDB: 1S3R_A 1M3I_A 1PFO_A 1M3J_B 3CQF_A 3HVN_A.
Probab=19.38  E-value=46  Score=26.27  Aligned_cols=13  Identities=38%  Similarity=0.805  Sum_probs=9.3

Q ss_pred             EEEEEEEeccc-cc
Q psy6425          42 LVRQIEVSHWG-NP   54 (68)
Q Consensus        42 L~R~IeVSHWg-ni   54 (68)
                      |.+++.||+|| +|
T Consensus       446 l~~~~~~~~~gttl  459 (467)
T PF01289_consen  446 LVKERTISIWGTTL  459 (467)
T ss_dssp             --SEEEEEEEEESS
T ss_pred             cccceEEEEeCcEe
Confidence            46788999999 55


No 10 
>cd06522 GH25_AtlA-like AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.  This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain.  Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.
Probab=17.11  E-value=61  Score=21.62  Aligned_cols=10  Identities=30%  Similarity=0.252  Sum_probs=8.1

Q ss_pred             EEEEecc-ccc
Q psy6425          45 QIEVSHW-GNP   54 (68)
Q Consensus        45 ~IeVSHW-gni   54 (68)
                      .|.|||| |+|
T Consensus         3 ~IDVS~~Qg~i   13 (192)
T cd06522           3 VVDVSSNNGIM   13 (192)
T ss_pred             eEEccCCCCCc
Confidence            5899999 576


Done!