Query psy6425
Match_columns 68
No_of_seqs 101 out of 194
Neff 5.2
Searched_HMMs 46136
Date Fri Aug 16 17:40:45 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy6425.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6425hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF04597 Ribophorin_I: Ribopho 100.0 4.2E-28 9.1E-33 181.9 9.1 67 2-68 161-227 (432)
2 KOG2291|consensus 99.9 2.5E-28 5.4E-33 188.9 7.7 67 2-68 188-254 (602)
3 PF15092 UPF0728: Uncharacteri 39.0 16 0.00035 22.9 0.9 10 9-18 8-17 (88)
4 cd06419 GH25_muramidase_2 Unch 38.7 15 0.00033 24.9 0.9 14 44-57 9-23 (190)
5 PF04022 Staphylcoagulse: Stap 27.1 36 0.00078 16.9 0.9 11 4-14 17-27 (27)
6 cd06523 GH25_PlyB-like PlyB is 27.0 27 0.00057 23.1 0.5 13 44-56 1-14 (177)
7 PF09544 DUF2381: Protein of u 20.3 2.3E+02 0.0049 20.7 4.3 45 5-49 71-123 (289)
8 TIGR02268 Myxococcus xanthus p 19.6 2.3E+02 0.0049 21.2 4.2 46 6-51 76-129 (295)
9 PF01289 Thiol_cytolysin: Thio 19.4 46 0.001 26.3 0.5 13 42-54 446-459 (467)
10 cd06522 GH25_AtlA-like AtlA is 17.1 61 0.0013 21.6 0.7 10 45-54 3-13 (192)
No 1
>PF04597 Ribophorin_I: Ribophorin I; InterPro: IPR007676 Ribophorin I is an essential subunit of oligosaccharyltransferase (OST), which is also known as dolichyl-diphosphooligosaccharide--protein glycosyltransferase, (2.4.1.119 from EC). OST catalyses the transfer of an oligosaccharide from dolichol pyrophosphate to selected asparagine residues of nascent polypeptides as they are translocated into the lumen of the rough endoplasmic reticulum. Ribophorin I and OST48 are thought to be responsible for OST catalytic activity []. Both yeast and mammalian proteins are glycosylated but the sites are not conserved. Glycosylation may contribute towards general solubility but is unlikely to be involved in a specific biochemical function []. Most family members are predicted to have a transmembrane helix at the C terminus of this region.; GO: 0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity, 0006486 protein glycosylation, 0005783 endoplasmic reticulum, 0016021 integral to membrane
Probab=99.95 E-value=4.2e-28 Score=181.89 Aligned_cols=67 Identities=49% Similarity=0.900 Sum_probs=64.9
Q ss_pred CceeecCeEEEcccCcCCCCCcccEEEEEecCCCceEEeEEEEEEEEeccccceeeeEEEeEEcccC
Q psy6425 2 PTTQVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWGNPKNPDNDSIESGFIR 68 (68)
Q Consensus 2 ~~~~~g~~i~yGP~~~v~p~t~~p~~VhYe~n~P~~~v~~L~R~IeVSHWgni~veE~y~l~n~~~~ 68 (68)
|.+++|++|+||||+|++||+.+|++||||||.||++|++|+|+|||||||||||||+|+|+|.+|+
T Consensus 161 ~~~~~~~~i~yGP~~~v~p~~~~~~~vhye~n~P~~~v~~l~R~IeVSHWgni~veE~y~l~N~GA~ 227 (432)
T PF04597_consen 161 PPKKKGNTITYGPYENVPPFSSQPLSVHYENNAPFLTVTSLERDIEVSHWGNIAVEEYYELRNDGAK 227 (432)
T ss_pred CceecCCeEEeccccccCCCCcccEEEEEECCCCceEEEEEEEEEEEcCCccEEEEEEEEEEEcCcc
Confidence 6789999999999999999999999999999999999999999999999999999999999999874
No 2
>KOG2291|consensus
Probab=99.95 E-value=2.5e-28 Score=188.87 Aligned_cols=67 Identities=40% Similarity=0.847 Sum_probs=64.6
Q ss_pred CceeecCeEEEcccCcCCCCCcccEEEEEecCCCceEEeEEEEEEEEeccccceeeeEEEeEEcccC
Q psy6425 2 PTTQVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWGNPKNPDNDSIESGFIR 68 (68)
Q Consensus 2 ~~~~~g~~i~yGP~~~v~p~t~~p~~VhYe~n~P~~~v~~L~R~IeVSHWgni~veE~y~l~n~~~~ 68 (68)
|.+++|+.|+||||+|+++|+++|+.||||||.||+++++|+|+|||||||||||||+|+|+|++|+
T Consensus 188 ~~k~~gn~l~yGPyeni~afs~~pl~VhYEnnaPf~~v~~L~R~IevSHWgnIqVeE~~~lth~gAk 254 (602)
T KOG2291|consen 188 PSKRSGNELKYGPYENIPAFSQEPLVVHYENNAPFVTVENLEREIEVSHWGNIQVEENYELTHKGAK 254 (602)
T ss_pred cccccCceeeecCccccccccCCceEEEEecCCCcceeeeEEEEEEeecceeeEEEEEEEEEeccee
Confidence 4578999999999999999999999999999999999999999999999999999999999999874
No 3
>PF15092 UPF0728: Uncharacterised protein family UPF0728
Probab=38.97 E-value=16 Score=22.92 Aligned_cols=10 Identities=60% Similarity=1.198 Sum_probs=7.9
Q ss_pred eEEEcccCcC
Q psy6425 9 TITYGPYENV 18 (68)
Q Consensus 9 ~i~yGP~~~v 18 (68)
+|.||||+..
T Consensus 8 ~iryGPY~a~ 17 (88)
T PF15092_consen 8 TIRYGPYSAC 17 (88)
T ss_pred EEEecCchhh
Confidence 5899999743
No 4
>cd06419 GH25_muramidase_2 Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
Probab=38.72 E-value=15 Score=24.95 Aligned_cols=14 Identities=14% Similarity=0.019 Sum_probs=10.6
Q ss_pred EEEEEecc-ccceee
Q psy6425 44 RQIEVSHW-GNPKNP 57 (68)
Q Consensus 44 R~IeVSHW-gni~ve 57 (68)
+-|.|||| |+|..+
T Consensus 9 ~GIDVS~~qg~IDw~ 23 (190)
T cd06419 9 LGVQLSQDDGYIDFN 23 (190)
T ss_pred cCEEeCCCCCccCHH
Confidence 67999999 676543
No 5
>PF04022 Staphylcoagulse: Staphylocoagulase repeat; InterPro: IPR001443 Staphylocoagulase is an extracellular protein produced by several strains of Staphylococcus aureus and which specifically forms a complex with prothrombin [, ]. This complex named staphylothrombin can clot fibrinogen without any proteolytic cleavage of prothrombin. The C terminus of staphylocoagulase contains the tandem repeat which does not seem to be required for the procoagulant activity.
Probab=27.14 E-value=36 Score=16.91 Aligned_cols=11 Identities=36% Similarity=0.764 Sum_probs=8.1
Q ss_pred eeecCeEEEcc
Q psy6425 4 TQVEQTITYGP 14 (68)
Q Consensus 4 ~~~g~~i~yGP 14 (68)
+.++++++||+
T Consensus 17 t~~dgtvsyga 27 (27)
T PF04022_consen 17 TNQDGTVSYGA 27 (27)
T ss_pred eccCceEecCC
Confidence 35677899986
No 6
>cd06523 GH25_PlyB-like PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
Probab=26.96 E-value=27 Score=23.15 Aligned_cols=13 Identities=23% Similarity=0.603 Sum_probs=9.8
Q ss_pred EEEEEecc-cccee
Q psy6425 44 RQIEVSHW-GNPKN 56 (68)
Q Consensus 44 R~IeVSHW-gni~v 56 (68)
|.|.|||| |+|..
T Consensus 1 ~viDVS~~qg~id~ 14 (177)
T cd06523 1 AIVDISEWQGPINW 14 (177)
T ss_pred CceeecccCCCCCH
Confidence 46899999 56654
No 7
>PF09544 DUF2381: Protein of unknown function (DUF2381); InterPro: IPR011754 This family consists of at least 8 paralogs in Myxococcus xanthus, a member of the Deltaproteobacteria. The function is unknown.
Probab=20.30 E-value=2.3e+02 Score=20.74 Aligned_cols=45 Identities=27% Similarity=0.476 Sum_probs=34.7
Q ss_pred eecCeEEEcccCcCCCCCcccEEEEEecCC-----CceEEe---EEEEEEEEe
Q psy6425 5 QVEQTITYGPYENVPPYTKANITIHYENNS-----PFLVVT---RLVRQIEVS 49 (68)
Q Consensus 5 ~~g~~i~yGP~~~v~p~t~~p~~VhYe~n~-----P~~~v~---~L~R~IeVS 49 (68)
..+++++.-|-.++.+-+..+|+|.|-..+ .|.-++ ..++.|+|+
T Consensus 71 ~g~~~l~L~P~~~l~~ger~~L~V~f~dg~aP~~a~f~Lv~~p~~vD~qVeV~ 123 (289)
T PF09544_consen 71 VGERSLILVPSEDLPEGERLPLTVRFADGAAPARAVFVLVTHPAEVDRQVEVF 123 (289)
T ss_pred ccCCEEEEEECccCCCCCceEEEEEECCCCCccceEEEEEcChhhcccEEEEE
Confidence 457889999999999999999999998876 333333 466777775
No 8
>TIGR02268 Myxococcus xanthus paralogous family TIGR02268. This family consists of at least 8 paralogs in Myxococcus xanthus, a member of the Deltaproteobacteria. The function is unknown.
Probab=19.63 E-value=2.3e+02 Score=21.22 Aligned_cols=46 Identities=26% Similarity=0.458 Sum_probs=36.1
Q ss_pred ecCeEEEcccCcCCCCCcccEEEEEecCC-CceEE-------eEEEEEEEEecc
Q psy6425 6 VEQTITYGPYENVPPYTKANITIHYENNS-PFLVV-------TRLVRQIEVSHW 51 (68)
Q Consensus 6 ~g~~i~yGP~~~v~p~t~~p~~VhYe~n~-P~~~v-------~~L~R~IeVSHW 51 (68)
.+++|..-|-+++.+-..-+++|+|-.-+ |.--+ ...++.|+|+-=
T Consensus 76 g~~~l~L~P~~~L~~gERl~L~V~F~DGa~P~~a~f~LV~~p~~vD~~VeV~R~ 129 (295)
T TIGR02268 76 TETHLILVPSEALPEGERLPLTVRFADGAVPQRAVLELVTDPARVERQVEVRRH 129 (295)
T ss_pred CCcEEEEEEccccCCCCceEEEEEEcCCCCCcceEEEEEeCCcccceEEEEEcC
Confidence 46678899999999999999999999888 76322 456778888743
No 9
>PF01289 Thiol_cytolysin: Thiol-activated cytolysin; InterPro: IPR001869 Thiol-activated cytolysins [] are toxins produced by a variety of Gram-positive bacteria and are characterised by their ability to lyse cholesterol-containing membranes, their reversible inactivation by oxidation and their capacity to bind to cholesterol. All these proteins contain a single cysteine residue, located in their C-terminal section, which has been shown [] to be essential for the binding to cholesterol.; GO: 0015485 cholesterol binding, 0009405 pathogenesis; PDB: 1S3R_A 1M3I_A 1PFO_A 1M3J_B 3CQF_A 3HVN_A.
Probab=19.38 E-value=46 Score=26.27 Aligned_cols=13 Identities=38% Similarity=0.805 Sum_probs=9.3
Q ss_pred EEEEEEEeccc-cc
Q psy6425 42 LVRQIEVSHWG-NP 54 (68)
Q Consensus 42 L~R~IeVSHWg-ni 54 (68)
|.+++.||+|| +|
T Consensus 446 l~~~~~~~~~gttl 459 (467)
T PF01289_consen 446 LVKERTISIWGTTL 459 (467)
T ss_dssp --SEEEEEEEEESS
T ss_pred cccceEEEEeCcEe
Confidence 46788999999 55
No 10
>cd06522 GH25_AtlA-like AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.
Probab=17.11 E-value=61 Score=21.62 Aligned_cols=10 Identities=30% Similarity=0.252 Sum_probs=8.1
Q ss_pred EEEEecc-ccc
Q psy6425 45 QIEVSHW-GNP 54 (68)
Q Consensus 45 ~IeVSHW-gni 54 (68)
.|.|||| |+|
T Consensus 3 ~IDVS~~Qg~i 13 (192)
T cd06522 3 VVDVSSNNGIM 13 (192)
T ss_pred eEEccCCCCCc
Confidence 5899999 576
Done!