BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy6426
         (74 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3FIH|B Chain B, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 30s Subunit, Trnas And The Ternary
           Complex.
 pdb|2WWL|B Chain B, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 30s, The P-Site
           Trna And The Tnac Leader Peptide (Part 1 Of 2).
 pdb|3OFO|B Chain B, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OFP|B Chain B, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 pdb|3OFA|B Chain B, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The First 70s Ribosome.
 pdb|3OFB|B Chain B, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The Second 70s Ribosome.
 pdb|3OFX|B Chain B, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OFY|B Chain B, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
 pdb|3OAQ|B Chain B, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OAR|B Chain B, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 pdb|2YKR|B Chain B, 30s Ribosomal Subunit With Rsga Bound In The Presence Of
           Gmppnp
 pdb|4A2I|B Chain B, Cryo-Electron Microscopy Structure Of The 30s Subunit In
           Complex With The Yjeq Biogenesis Factor
 pdb|3J18|B Chain B, Structure Of The Bacterial Ribosome Complexed By
           Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
           (30s Subunit)
 pdb|4GD1|B Chain B, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|4GD2|B Chain B, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
          Length = 218

 Score = 26.2 bits (56), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 4   EPSDKKVKSYGGIPEAVFVDDVD-KYMSLPENDRIEV 39
           E S   +K  GG+P+A+FV D D +++++ E + + +
Sbjct: 137 ENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGI 173


>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With
           Mn-Amppnp
 pdb|4DB1|B Chain B, Cardiac Human Myosin S1dc, Beta Isoform Complexed With
           Mn-Amppnp
          Length = 783

 Score = 25.4 bits (54), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 9/40 (22%)

Query: 14  GGIPEAVFVDDVDKYMSLPENDRIEVVLKKLDEEHNKYKF 53
             IPE  F+D              E +L  LD +HN+YKF
Sbjct: 728 AAIPEGQFIDS---------RKGAEKLLSSLDIDHNQYKF 758


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.135    0.374 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,875,308
Number of Sequences: 62578
Number of extensions: 59800
Number of successful extensions: 204
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 197
Number of HSP's gapped (non-prelim): 12
length of query: 74
length of database: 14,973,337
effective HSP length: 44
effective length of query: 30
effective length of database: 12,219,905
effective search space: 366597150
effective search space used: 366597150
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 45 (21.9 bits)