Diaphorina citri psyllid: psy6451


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MESVLQDTVLNVAKNVEKQIDEEIYRLENLDLDSIEKLREDHLKKLKAKAKRNQELKALGHGEYEEIPDEKKFFDLCKKSPNMVVHFYKDGSVNCKILDEHMKTLCKKHLETRFIKLNVERAPFLTGQQGHGEYEEIPDEKKFFDLCKKSPNMVVHFYKDGSVNCKILDEHMKTLCKKHLETRFIKLNVERAPFLTERLRIKVIPTLTLVKDSVTKDYIVGFTELGNCADFSTEMLEWRIAQAGVIDYEGDLFNPPDIKKKQKKRMIEKKKIIRGRNSTGVIDYEAGVIDYEGDLFNPPDIKKKQKKRLIEKKKIIRGRNSSDEDSDDPDDW
cHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEccccHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEcccccHHHHccccccccEEEEEEccEEEEEEEccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccc
***VLQD*VLNVAKNVEKQIDEEIYRLENLDLDSIEKLREDHLK****************HGEYEEIPDEKKFFDLCKKSPNMVVHFYKDGSVNCKILDEHMKTLCKKHLETRFIKLNVERAPFLTGQQGHGEYEEIPDEKKFFDLCKKSPNMVVHFYKDGSVNCKILDEHMKTLCKKHLETRFIKLNVERAPFLTERLRIKVIPTLTLVKDSVTKDYIVGFTELGNCADFSTEMLEWRIAQAGVIDYEG************************************GVIDYEGDLFNP**********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESVLQDTVLNVxxxxxxxxxxxxxxxxxxxxxSIEKLREDHLKKLKAKAKRNQELKALGHGEYEEIPDEKKFFDLCKKSPNMVVHFYKDGSVNCKILDEHMKTLCKKHLETRFIKLNVERAPFLTGQQGHGEYEEIPDEKKFFDLCKKSPNMVVHFYKDGSVNCKILDEHMKTLCKKHLETRFIKLNVERAPFLTERLRIKVIPTLTLVKDSVTKDYIVGFTELGNCADFSTEMLEWRIAQAGVIDYEGDLFNPPDIKKKQKKRMIEKKKIIRGRNSTGVIDYEAGVIDYEGDLFNPPDIKKKQKKRLIEKKKIIRGRNSSDEDSDDPDDW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin domain-containing protein 9 Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.confidentQ9CQ79
Thioredoxin domain-containing protein 9 Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.confidentO18883
Thioredoxin domain-containing protein 9 Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.confidentO14530

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DBC, chain A
Confidence level:very confident
Coverage over the Query: 127-249
View the alignment between query and template
View the model in PyMOL
Template: 1A0R, chain P
Confidence level:very confident
Coverage over the Query: 24-80,148-249
View the alignment between query and template
View the model in PyMOL
Template: 2DBC, chain A
Confidence level:very confident
Coverage over the Query: 59-123
View the alignment between query and template
View the model in PyMOL