BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>psy6472
MKRVDGRLEELESRINEEARRLDRLHPLDAKHNVDVLEHDLRQAEENINTLFSDVQTLRE
GRYPQASDLHIF

High Scoring Gene Products

Symbol, full name Information P value
shot
short stop
protein from Drosophila melanogaster 2.9e-12

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy6472
        (72 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

FB|FBgn0013733 - symbol:shot "short stop" species:7227 "D...   187  2.9e-12   1


>FB|FBgn0013733 [details] [associations]
            symbol:shot "short stop" species:7227 "Drosophila
            melanogaster" [GO:0016203 "muscle attachment" evidence=NAS;TAS]
            [GO:0007517 "muscle organ development" evidence=NAS] [GO:0007017
            "microtubule-based process" evidence=ISS;NAS] [GO:0008017
            "microtubule binding" evidence=ISS;TAS] [GO:0003779 "actin binding"
            evidence=ISS;TAS] [GO:0016204 "determination of muscle attachment
            site" evidence=TAS] [GO:0048813 "dendrite morphogenesis"
            evidence=IMP;TAS] [GO:0005856 "cytoskeleton" evidence=NAS]
            [GO:0008092 "cytoskeletal protein binding" evidence=ISS]
            [GO:0030516 "regulation of axon extension" evidence=IMP]
            [GO:0035147 "branch fusion, open tracheal system"
            evidence=IEP;IMP;TAS] [GO:0007424 "open tracheal system
            development" evidence=IMP;TAS] [GO:0035149 "lumen formation, open
            tracheal system" evidence=IMP] [GO:0007423 "sensory organ
            development" evidence=TAS] [GO:0007409 "axonogenesis" evidence=TAS]
            [GO:0005874 "microtubule" evidence=IDA;TAS] [GO:0007475 "apposition
            of dorsal and ventral imaginal disc-derived wing surfaces"
            evidence=TAS] [GO:0016319 "mushroom body development" evidence=IMP]
            [GO:0000226 "microtubule cytoskeleton organization"
            evidence=IMP;TAS] [GO:0030036 "actin cytoskeleton organization"
            evidence=TAS] [GO:0007026 "negative regulation of microtubule
            depolymerization" evidence=IMP] [GO:0030716 "oocyte fate
            determination" evidence=IMP] [GO:0045169 "fusome" evidence=IDA]
            [GO:0005912 "adherens junction" evidence=IDA;TAS] [GO:0007050 "cell
            cycle arrest" evidence=IEA] [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0000235 "astral microtubule" evidence=IDA]
            [GO:0005515 "protein binding" evidence=IPI] [GO:0016199 "axon
            midline choice point recognition" evidence=IMP] [GO:0030426 "growth
            cone" evidence=IDA] InterPro:IPR001101 InterPro:IPR001452
            InterPro:IPR001715 InterPro:IPR002017 InterPro:IPR002048
            InterPro:IPR003108 InterPro:IPR011992 Pfam:PF00307 Pfam:PF00435
            Pfam:PF00681 Pfam:PF02187 PROSITE:PS50021 PROSITE:PS50222
            PROSITE:PS51460 SMART:SM00033 SMART:SM00054 SMART:SM00243
            SMART:SM00250 SMART:SM00326 Prosite:PS00018 EMBL:AE013599
            GO:GO:0003779 GO:GO:0000226 GO:GO:0007423 GO:GO:0030036
            GO:GO:0016199 GO:GO:0005509 Gene3D:1.10.238.10 InterPro:IPR018247
            GO:GO:0007050 GO:GO:0030426 SUPFAM:SSF50044 GO:GO:0048813
            GO:GO:0030516 GO:GO:0005912 GO:GO:0016319 Gene3D:1.10.418.10
            InterPro:IPR018159 SMART:SM00150 SUPFAM:SSF47576 GO:GO:0008017
            GO:GO:0000235 GO:GO:0007026 GO:GO:0035147 GO:GO:0007475
            GO:GO:0045169 GO:GO:0016204 GO:GO:0035149
            GeneTree:ENSGT00700000104214 Gene3D:3.30.920.20 SUPFAM:SSF143575
            GO:GO:0030716 UniGene:Dm.7941 GeneID:36542 KEGG:dme:Dmel_CG18076
            CTD:36542 FlyBase:FBgn0013733 ChiTaRS:SHOX2 GenomeRNAi:36542
            NextBio:799100 RefSeq:NP_725339.1 ProteinModelPortal:A1Z9J3
            STRING:A1Z9J3 PRIDE:A1Z9J3 EnsemblMetazoa:FBtr0087621
            UCSC:CG18076-RH InParanoid:A1Z9J3 OMA:MKCNSFL Bgee:A1Z9J3
            Uniprot:A1Z9J3
        Length = 8805

 Score = 187 (70.9 bits), Expect = 2.9e-12, P = 2.9e-12
 Identities = 36/70 (51%), Positives = 47/70 (67%)

Query:     1 MKRVDGRLEELESRINEEARRLDRLHPLDAKHNVDVLEHDLRQAEENINTLFSDVQTLRE 60
             +K VD +L +LE RI EE RR++RLHP+DAK  V+ LE ++R  EE I  +  D   L E
Sbjct:   469 IKHVDQKLTDLEGRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNE 528

Query:    61 GRYPQASDLH 70
             GRYP  S+LH
Sbjct:   529 GRYPHVSELH 538


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.136   0.378    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       72        72   0.00091  102 3  11 22  0.50    28
                                                     29  0.43    29


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  409 (44 KB)
  Total size of DFA:  75 KB (2064 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:01
  No. of threads or processors used:  24
  Search cpu time:  12.55u 0.07s 12.62t   Elapsed:  00:00:06
  Total cpu time:  12.55u 0.07s 12.62t   Elapsed:  00:00:07
  Start:  Thu Aug 15 13:57:46 2013   End:  Thu Aug 15 13:57:53 2013

Back to top