BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy6476
         (546 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3P0J|A Chain A, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
           Tyrosinol, Triclinic Crystal Form 1
 pdb|3P0J|B Chain B, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
           Tyrosinol, Triclinic Crystal Form 1
 pdb|3P0J|C Chain C, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
           Tyrosinol, Triclinic Crystal Form 1
 pdb|3P0J|D Chain D, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
           Tyrosinol, Triclinic Crystal Form 1
          Length = 690

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 485 LNMDNAWGILRCIIDICLKQKDGKYLIMKDPNKPLIRLYD 524
           +N D  + +LR + + C+++ + + LI K   KPLIR YD
Sbjct: 9   MNTDERYKLLRSVGEECIQESELRNLIEK---KPLIRCYD 45


>pdb|3P0H|A Chain A, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
           Fisetin, Cubic Crystal Form
 pdb|3P0H|B Chain B, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
           Fisetin, Cubic Crystal Form
 pdb|3P0I|A Chain A, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
           Tyrosinol, Cubic Crystal Form
 pdb|3P0I|B Chain B, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
           Tyrosinol, Cubic Crystal Form
          Length = 690

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 486 NMDNAWGILRCIIDICLKQKDGKYLIMKDPNKPLIRLYD 524
           N D  + +LR + + C+++ + + LI K   KPLIR YD
Sbjct: 10  NTDERYKLLRSVGEECIQESELRNLIEK---KPLIRCYD 45


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.135    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,246,971
Number of Sequences: 62578
Number of extensions: 664671
Number of successful extensions: 1139
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1138
Number of HSP's gapped (non-prelim): 3
length of query: 546
length of database: 14,973,337
effective HSP length: 104
effective length of query: 442
effective length of database: 8,465,225
effective search space: 3741629450
effective search space used: 3741629450
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)