BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6481
(94 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1VG0|A Chain A, The Crystal Structures Of The Rep-1 Protein In Complex
With Monoprenylated Rab7 Protein
pdb|1VG9|A Chain A, The Crystal Structures Of The Rep-1 Protein In Complex
With C-Terminally Truncated Rab7 Protein
pdb|1VG9|C Chain C, The Crystal Structures Of The Rep-1 Protein In Complex
With C-Terminally Truncated Rab7 Protein
pdb|1VG9|E Chain E, The Crystal Structures Of The Rep-1 Protein In Complex
With C-Terminally Truncated Rab7 Protein
pdb|1VG9|G Chain G, The Crystal Structures Of The Rep-1 Protein In Complex
With C-Terminally Truncated Rab7 Protein
Length = 650
Score = 26.6 bits (57), Expect = 4.1, Method: Composition-based stats.
Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%)
Query: 9 LYAYQENKNVPVNSSLWKN--IGKLEALPLPMA-CTLTQIVLFC 49
L YQEN +V +S+W+ + EA+PL T+ + +FC
Sbjct: 59 LKEYQENNDVVTENSMWQEQILENEEAIPLSSKDKTIQHVEVFC 102
>pdb|1LTX|R Chain R, Structure Of Rab Escort Protein-1 In Complex With Rab
Geranylgeranyl Transferase And Isoprenoid
Length = 650
Score = 26.6 bits (57), Expect = 4.1, Method: Composition-based stats.
Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%)
Query: 9 LYAYQENKNVPVNSSLWKN--IGKLEALPLPMA-CTLTQIVLFC 49
L YQEN +V +S+W+ + EA+PL T+ + +FC
Sbjct: 59 LKEYQENNDVVTENSMWQEQILENEEAIPLSSKDKTIQHVEVFC 102
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.136 0.409
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,633,616
Number of Sequences: 62578
Number of extensions: 79729
Number of successful extensions: 136
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 136
Number of HSP's gapped (non-prelim): 2
length of query: 94
length of database: 14,973,337
effective HSP length: 61
effective length of query: 33
effective length of database: 11,156,079
effective search space: 368150607
effective search space used: 368150607
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 45 (21.9 bits)