BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy6481
         (94 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1VG0|A Chain A, The Crystal Structures Of The Rep-1 Protein In Complex
           With Monoprenylated Rab7 Protein
 pdb|1VG9|A Chain A, The Crystal Structures Of The Rep-1 Protein In Complex
           With C-Terminally Truncated Rab7 Protein
 pdb|1VG9|C Chain C, The Crystal Structures Of The Rep-1 Protein In Complex
           With C-Terminally Truncated Rab7 Protein
 pdb|1VG9|E Chain E, The Crystal Structures Of The Rep-1 Protein In Complex
           With C-Terminally Truncated Rab7 Protein
 pdb|1VG9|G Chain G, The Crystal Structures Of The Rep-1 Protein In Complex
           With C-Terminally Truncated Rab7 Protein
          Length = 650

 Score = 26.6 bits (57), Expect = 4.1,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 9   LYAYQENKNVPVNSSLWKN--IGKLEALPLPMA-CTLTQIVLFC 49
           L  YQEN +V   +S+W+   +   EA+PL     T+  + +FC
Sbjct: 59  LKEYQENNDVVTENSMWQEQILENEEAIPLSSKDKTIQHVEVFC 102


>pdb|1LTX|R Chain R, Structure Of Rab Escort Protein-1 In Complex With Rab
           Geranylgeranyl Transferase And Isoprenoid
          Length = 650

 Score = 26.6 bits (57), Expect = 4.1,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 9   LYAYQENKNVPVNSSLWKN--IGKLEALPLPMA-CTLTQIVLFC 49
           L  YQEN +V   +S+W+   +   EA+PL     T+  + +FC
Sbjct: 59  LKEYQENNDVVTENSMWQEQILENEEAIPLSSKDKTIQHVEVFC 102


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,633,616
Number of Sequences: 62578
Number of extensions: 79729
Number of successful extensions: 136
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 136
Number of HSP's gapped (non-prelim): 2
length of query: 94
length of database: 14,973,337
effective HSP length: 61
effective length of query: 33
effective length of database: 11,156,079
effective search space: 368150607
effective search space used: 368150607
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 45 (21.9 bits)