Diaphorina citri psyllid: psy6490


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
METMALGGAPDHHEQFNGLIPTMNGLVQIPHHPGLVHLNGPPPPPHQLVKLNGAPQVNTSPPQNAILHQQPTPQPQQQQQQPPQPQPRDLQPNSNNQLVLVNGKSSGDSGRSTPTGDDPTSAKLFVGGLNVVREAHQLVLVNGKSSGDSGRSTPTGDDPTSAKLFVGGLSWQTSSEKLREYFGMFGAVTDVLIMKDPITQRSRGFGFITFAEPETVEKVLKVPIHTLDGKKIDPKHATPKNRPKIGNRTKKIFVGGVSQDTSAEEVKAYFSQFGKVEETVMLMDQQTKRHRGFGFVTFENEEVVDHICEIHFHMIKNKKVECKKAQPKEAVQANLLVGKRVILGPLGLRMAAPAPITPATQLAALQSQAQAQVQAAAAAVAAQNAAAVANYGKIFECV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHHHccccccccccccEEEccccccccccccccccccccccEEEccccccccHHHHHHHHcccccEEEEEEEEccccccccccEEEEEccHHHHHHHHcccccEEccEEccccccccccccccccccccEEEccccccccHHHHHHHHHccccEEEEEEEEcccccccccEEEEEEcccHHHHHHHHHccEEEcccEEEEEEcccHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
***********HHEQFNGLIPTMNGLVQIPHH**************************************************************NNQLVLVNGKSSGDSGRSTPTGDDPTSAKLFVGGLNVVREAHQLVLV**********************LFVGGLSWQTSSEKLREYFGMFGAVTDVLIMKDPITQRSRGFGFITFAEPETVEKVLKVPIHTLDGKKIDPK***************KIFVGGVSQDTSAEEVKAYFSQFGKVEETVMLMDQQTKRHRGFGFVTFENEEVVDHICEIHFHMIKNKKVECKKAQPKEAVQANLLVGKRVILGPLGLRMAAPAPITPATQL***********************AAVANYGKIFECV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METMALGGAPDHHEQFNGLIPTMNGLVQIPHHPGLVHLNGPPPPPHQLVKLNGAPQVNTSPPQNAILHQQPTPQPQQQQQQPPQPQPRDLQPNSNNQLVLVNGKSSGDSGRSTPTGDDPTSAKLFVGGLNVVREAHQLVLVNGKSSGDSGRSTPTGDDPTSAKLFVGGLSWQTSSEKLREYFGMFGAVTDVLIMKDPITQRSRGFGFITFAEPETVEKVLKVPIHTLDGKKIDPKHATPKNRPKIGNRTKKIFVGGVSQDTSAEEVKAYFSQFGKVEETVMLMDQQTKRHRGFGFVTFENEEVVDHICEIHFHMIKNKKVECKKAQPKEAVQANLLVGKRVILGPLGLRMAAPAPITPATQLAALQSQAQAQVQAAAAAVAAQNAAAVANYGKIFECV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA-binding protein Musashi homolog 2 RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system.confidentQ920Q6
RNA-binding protein Musashi homolog 2 RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system.confidentQ96DH6
RNA-binding protein Musashi homolog 1 RNA binding protein that regulates the expression of target mRNAs at the translation level. Regulates expression of the NOTCH1 antagonist NUMB. Binds RNA containing the sequence 5'-GUUAGUUAGUUAGUU-3' and other sequences containing the pattern 5'-[GA]U(1-3)AGU-3'. May play a role in the proliferation and maintenance of stem cells in the central nervous system.confidentQ8K3P4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0000900 [MF]translation repressor activity, nucleic acid bindingprobableGO:0090079, GO:0003676, GO:0097159, GO:0030371, GO:0003674, GO:0005488, GO:0045182, GO:1901363
GO:0042078 [BP]germ-line stem cell divisionprobableGO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0008356, GO:0051301, GO:0000003, GO:0048869, GO:0007276, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0044763, GO:0022412, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0017145
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0006417 [BP]regulation of translationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:2001141 [BP]regulation of RNA biosynthetic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:0009889, GO:0050794, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0019827 [BP]stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0008266 [MF]poly(U) RNA bindingprobableGO:0097159, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:0008187, GO:1901363, GO:0005488
GO:0022416 [BP]chaeta developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0006397 [BP]mRNA processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001709 [BP]cell fate determinationprobableGO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005703 [CC]polytene chromosome puffprobableGO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0071456 [BP]cellular response to hypoxiaprobableGO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0048255 [BP]mRNA stabilizationprobableGO:0019222, GO:0043489, GO:0043488, GO:0043487, GO:0010608, GO:0050789, GO:0060255, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0005844 [CC]polysomeprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CJK, chain A
Confidence level:very confident
Coverage over the Query: 160-328
View the alignment between query and template
View the model in PyMOL
Template: 3MD3, chain A
Confidence level:very confident
Coverage over the Query: 108-238
View the alignment between query and template
View the model in PyMOL
Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 245-349
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 43-55
View the alignment between query and template
View the model in PyMOL