Query         psy6494
Match_columns 87
No_of_seqs    112 out of 1021
Neff          7.3 
Searched_HMMs 46136
Date          Fri Aug 16 19:33:33 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6494.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6494hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00511 ribulose_e2b2 ribose  99.9 5.3E-27 1.1E-31  168.4   3.4   85    1-86    209-299 (301)
  2 PRK08535 translation initiatio  99.9 8.4E-27 1.8E-31  167.9   3.3   85    1-86    214-304 (310)
  3 KOG1465|consensus               99.9 1.2E-26 2.7E-31  165.8   3.2   85    1-86    256-346 (353)
  4 COG1184 GCD2 Translation initi  99.9 1.7E-26 3.7E-31  165.4   3.4   86    1-87    213-301 (301)
  5 PRK05720 mtnA methylthioribose  99.9 4.2E-25 9.1E-30  161.1   3.4   83    1-85    251-340 (344)
  6 KOG1466|consensus               99.9 1.6E-24 3.4E-29  152.7   1.3   87    1-87    224-313 (313)
  7 TIGR00524 eIF-2B_rel eIF-2B al  99.9   3E-24 6.4E-29  154.4   2.3   74    1-75    223-303 (303)
  8 PRK06371 translation initiatio  99.9 5.3E-24 1.1E-28  154.5   2.6   80    1-81    241-327 (329)
  9 TIGR00512 salvage_mtnA S-methy  99.9 7.9E-24 1.7E-28  153.7   2.5   74    1-75    251-331 (331)
 10 PF01008 IF-2B:  Initiation fac  99.9 3.3E-24 7.1E-29  151.4  -0.1   74    1-75    202-282 (282)
 11 PRK05772 translation initiatio  99.9 2.1E-23 4.7E-28  152.9   3.5   82    1-85    272-360 (363)
 12 PRK08334 translation initiatio  99.9 7.6E-23 1.7E-27  149.6   3.9   83    1-85    264-352 (356)
 13 PRK08335 translation initiatio  99.9 1.3E-22 2.8E-27  144.3   3.2   71    1-77    203-273 (275)
 14 PRK06036 translation initiatio  99.9 7.4E-23 1.6E-27  149.0   1.4   79    1-81    251-336 (339)
 15 COG0182 Predicted translation   99.9 2.8E-22 6.1E-27  144.5   3.2   76    1-77    254-336 (346)
 16 PRK06372 translation initiatio  99.8 4.7E-22   1E-26  140.1   2.5   76    1-79    177-252 (253)
 17 KOG1467|consensus               99.8 4.5E-22 9.7E-27  149.1  -0.6   84    1-85    453-551 (556)
 18 KOG1468|consensus               99.7 1.8E-19   4E-24  128.2  -0.9   81    1-82    259-349 (354)
 19 COG1929 Glycerate kinase [Carb  82.7    0.55 1.2E-05   35.3   0.8   22    1-22    308-329 (378)
 20 PRK09932 glycerate kinase II;   79.3    0.73 1.6E-05   34.7   0.4   22    1-22    308-329 (381)
 21 PF02595 Gly_kinase:  Glycerate  76.4    0.95   2E-05   34.1   0.3   23    1-23    308-330 (377)
 22 PRK10342 glycerate kinase I; P  75.7     1.2 2.5E-05   33.7   0.6   23    1-23    308-330 (381)
 23 TIGR00045 glycerate kinase. Th  75.1     1.1 2.3E-05   33.8   0.3   22    1-22    307-328 (375)
 24 PF13336 AcetylCoA_hyd_C:  Acet  60.8     4.8  0.0001   26.8   1.1   20   57-76    108-127 (154)
 25 PF00391 PEP-utilizers:  PEP-ut  60.2       3 6.6E-05   24.1   0.1   16    2-17     46-61  (80)
 26 KOG3325|consensus               56.6     5.6 0.00012   26.8   0.9   23    1-23     99-121 (183)
 27 PRK05634 nucleosidase; Provisi  47.6     6.5 0.00014   26.4   0.1   16    1-16    137-152 (185)
 28 COG4359 Uncharacterized conser  44.4      14  0.0003   25.8   1.3   17    5-21     85-101 (220)
 29 COG0238 RpsR Ribosomal protein  38.1     4.2 9.1E-05   24.0  -1.7   28   52-79     25-52  (75)
 30 PRK07077 hypothetical protein;  37.7      12 0.00026   26.4   0.3   15    1-15    148-162 (238)
 31 CHL00077 rps18 ribosomal prote  37.2     5.7 0.00012   24.0  -1.3   26   53-78     26-51  (86)
 32 TIGR00165 S18 ribosomal protei  37.1     5.6 0.00012   23.0  -1.3   25   54-78     17-41  (70)
 33 TIGR01704 MTA/SAH-Nsdase 5'-me  34.8      14  0.0003   25.3   0.2   17    1-17    177-193 (228)
 34 PF01084 Ribosomal_S18:  Riboso  32.5     6.2 0.00013   21.6  -1.5   27   53-79      5-31  (54)
 35 PRK06026 5'-methylthioadenosin  30.6      18 0.00039   25.1   0.2   15    1-15    153-167 (212)
 36 PRK14697 bifunctional 5'-methy  30.2      19 0.00041   24.9   0.2   15    1-15    176-190 (233)
 37 PF04223 CitF:  Citrate lyase,   30.2      18  0.0004   28.0   0.2   19   56-74    386-404 (466)
 38 COG0775 Pfs Nucleoside phospho  29.9      18  0.0004   25.2   0.1   20    1-20    181-201 (234)
 39 TIGR01705 MTA/SAH-nuc-hyp 5'-m  29.7      20 0.00042   25.0   0.2   15    1-15    153-167 (212)
 40 PRK08236 hypothetical protein;  29.6      19 0.00041   24.7   0.2   15    1-15    166-180 (212)
 41 PRK13401 30S ribosomal protein  29.3     9.5 0.00021   22.8  -1.2   24   55-78     26-49  (82)
 42 PRK06714 S-adenosylhomocystein  29.1      20 0.00043   25.0   0.2   17    1-17    177-193 (236)
 43 TIGR03468 HpnG hopanoid-associ  28.1      22 0.00047   24.2   0.2   17    1-17    137-153 (212)
 44 PRK07164 5'-methylthioadenosin  28.0      22 0.00047   24.6   0.2   16    1-16    166-181 (218)
 45 TIGR01584 citF citrate lyase,   27.6      29 0.00064   27.2   0.9   20   56-75    409-429 (492)
 46 cd08769 DAP_dppA_2 Peptidase M  27.3      19 0.00042   25.9  -0.2   23    2-24    140-162 (270)
 47 cd08770 DAP_dppA_3 Peptidase M  26.4      20 0.00044   25.8  -0.2   22    2-23    140-161 (263)
 48 TIGR02428 pcaJ_scoB_fam 3-oxoa  26.3      36 0.00077   23.3   1.0   18   57-74    160-177 (207)
 49 cd08663 DAP_dppA_1 Peptidase M  26.2      21 0.00045   25.7  -0.1   22    2-23    140-161 (266)
 50 PF02639 DUF188:  Uncharacteriz  26.1      31 0.00066   22.1   0.6   21    3-23      4-24  (130)
 51 PRK00391 rpsR 30S ribosomal pr  26.0      10 0.00022   22.5  -1.5   26   54-79     26-51  (79)
 52 cd00281 DAP_dppA Peptidase M55  25.7      21 0.00046   25.7  -0.2   22    2-23    139-160 (265)
 53 PHA02610 uvsY.-2 hypothetical   25.1   1E+02  0.0022   16.9   2.5   27   59-85     10-36  (53)
 54 TIGR03664 fut_nucase futalosin  24.2      27 0.00058   24.0   0.1   17    1-17    176-192 (222)
 55 PF03796 DnaB_C:  DnaB-like hel  22.9      18 0.00039   25.0  -0.9   20    3-22    164-183 (259)
 56 PRK06698 bifunctional 5'-methy  22.5      32 0.00069   26.0   0.3   15    1-15    176-190 (459)
 57 COG2873 MET17 O-acetylhomoseri  21.9      30 0.00066   26.5   0.0   15    1-15    169-183 (426)
 58 PRK06739 pyruvate kinase; Vali  21.3      35 0.00075   25.6   0.2   16    3-18    258-273 (352)
 59 COG2057 AtoA Acyl CoA:acetate/  21.1      45 0.00097   23.6   0.7   22   55-76    163-184 (225)
 60 PF04951 Peptidase_M55:  D-amin  20.9      35 0.00076   24.6   0.2   23    2-24    140-162 (265)
 61 PRK07004 replicative DNA helic  20.7      32 0.00068   26.4  -0.1   18    3-20    358-375 (460)
 62 PF05014 Nuc_deoxyrib_tr:  Nucl  20.5      60  0.0013   19.5   1.1   17    5-21     85-101 (113)
 63 PRK05584 5'-methylthioadenosin  20.2      38 0.00081   22.9   0.2   17    1-17    178-194 (230)
 64 COG2362 DppA D-aminopeptidase   20.0      56  0.0012   23.7   1.0   21    2-22    139-159 (274)

No 1  
>TIGR00511 ribulose_e2b2 ribose-1,5-bisphosphate isomerase, e2b2 family. The delineation of this family was based originally, in part, on a discussion and neighbor-joining phylogenetic study by Kyrpides and Woese of archaeal and other proteins homologous to the alpha, beta, and delta subunits of eukaryotic initiation factor 2B (eIF-2B), a five-subunit molecule that catalyzes GTP recycling for eIF-2. Recently, Sato, et al. assigned the function ribulose-1,5 bisphosphate isomerase.
Probab=99.93  E-value=5.3e-27  Score=168.44  Aligned_cols=85  Identities=26%  Similarity=0.424  Sum_probs=76.3

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC------CCccccCCeeeecCCCCccEEEeCCCCcC
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK------ENLSKYHPLVDYTPPQYITLLFTDLGILT   74 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~------~~~~~~np~fD~tPp~lI~~~iTe~G~~~   74 (87)
                      +|++||+++|||||+||+|||++.++.++ ...+|.+++.+++..      +++++.||+||+|||+|||++|||.|+++
T Consensus       209 lA~~Ak~~~vPv~V~a~~~K~~~~~~~~~-~~~ie~~~~~ev~~~~~~~~~~~~~v~np~fD~tP~~lIt~iITe~Gi~~  287 (301)
T TIGR00511       209 LALAAREARVPFMVAAETYKFHPKTITGE-LVEIEERDPTEVLDEEDLKQLGAVKVRNPAFDVTPAEYIDAIITEVGQIP  287 (301)
T ss_pred             HHHHHHHhCCCEEEEcccceecCCCCCCC-cccccccCHHHhccccCccCCCCccccCcceecCCHHHCCEEEeCCCcCC
Confidence            58999999999999999999999987654 456888998887643      47899999999999999999999999999


Q ss_pred             CchHHHHHHHhh
Q psy6494          75 PSAVSDELIKLY   86 (87)
Q Consensus        75 p~~i~~~l~~~y   86 (87)
                      |++++++++++|
T Consensus       288 p~~i~~~l~~~~  299 (301)
T TIGR00511       288 PEMAYTIIKELL  299 (301)
T ss_pred             cHHHHHHHHHHc
Confidence            999999999987


No 2  
>PRK08535 translation initiation factor IF-2B subunit delta; Provisional
Probab=99.93  E-value=8.4e-27  Score=167.91  Aligned_cols=85  Identities=27%  Similarity=0.461  Sum_probs=76.7

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC------CCccccCCeeeecCCCCccEEEeCCCCcC
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK------ENLSKYHPLVDYTPPQYITLLFTDLGILT   74 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~------~~~~~~np~fD~tPp~lI~~~iTe~G~~~   74 (87)
                      +|++||+|+|||||+|++|||++.++.++ +.++|++++.++++.      +++++.||+||+|||+|||++|||.|+++
T Consensus       214 ~A~~Ak~~~vPv~V~a~~~K~~~~~~~~~-~~~ie~~~~~ev~~~~~~~~~~~v~v~np~fD~tP~~lIt~iiTe~Gi~~  292 (310)
T PRK08535        214 IALAAHEARVPFMVAAETYKFSPKTLLGE-LVEIEERDPTEVLPEEILAKLPGVKVRNPAFDVTPPEYIDAIITEIGAIP  292 (310)
T ss_pred             HHHHHHHhCCCEEEecccceecCCCCCCC-cceecccCHHHhcccccccCCCCceeeccCcccCCHHHCCEEEeCCCcCC
Confidence            58999999999999999999999987654 556899998887643      57999999999999999999999999999


Q ss_pred             CchHHHHHHHhh
Q psy6494          75 PSAVSDELIKLY   86 (87)
Q Consensus        75 p~~i~~~l~~~y   86 (87)
                      |++++++++++|
T Consensus       293 ps~v~~~~~~~~  304 (310)
T PRK08535        293 PEMAYTIIKEYL  304 (310)
T ss_pred             hHHHHHHHHHHh
Confidence            999999999987


No 3  
>KOG1465|consensus
Probab=99.93  E-value=1.2e-26  Score=165.81  Aligned_cols=85  Identities=35%  Similarity=0.586  Sum_probs=80.3

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC------CCccccCCeeeecCCCCccEEEeCCCCcC
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK------ENLSKYHPLVDYTPPQYITLLFTDLGILT   74 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~------~~~~~~np~fD~tPp~lI~~~iTe~G~~~   74 (87)
                      +|+|||+|.+||+|||+.||+||.+|.+++.+ ++++.+++++++      +.+++.||.|||+||||||+||||.|.+.
T Consensus       256 vAlaAk~h~vPv~VlAp~yKLsPlyp~~~ds~-~~f~s~~~il~~~e~~~~~~~~v~nP~fDyvppeLVtLFIsNtgg~~  334 (353)
T KOG1465|consen  256 VALAAKHHSVPVIVLAPMYKLSPLYPTNPDSF-HEFRSPSEILPFSEGDPAGRVDVLNPAFDYVPPELVTLFISNTGGVA  334 (353)
T ss_pred             HHHHHHhcCCcEEEecchhhcCCCCCCCHHHH-HhcCCcccccCccccCcccceeecccccccCChhheeEEEecCCCCC
Confidence            58999999999999999999999999999888 699999999875      35789999999999999999999999999


Q ss_pred             CchHHHHHHHhh
Q psy6494          75 PSAVSDELIKLY   86 (87)
Q Consensus        75 p~~i~~~l~~~y   86 (87)
                      ||++||++.++|
T Consensus       335 PSyvyRl~~d~Y  346 (353)
T KOG1465|consen  335 PSYVYRLMEDLY  346 (353)
T ss_pred             hHHHHHHHHHhc
Confidence            999999999998


No 4  
>COG1184 GCD2 Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis]
Probab=99.92  E-value=1.7e-26  Score=165.42  Aligned_cols=86  Identities=40%  Similarity=0.630  Sum_probs=78.2

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC---CCccccCCeeeecCCCCccEEEeCCCCcCCch
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK---ENLSKYHPLVDYTPPQYITLLFTDLGILTPSA   77 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~---~~~~~~np~fD~tPp~lI~~~iTe~G~~~p~~   77 (87)
                      +|++||++++|||||||+|||++++++++... ++++++.++...   .+.+++||+||+|||+||+++|||.|+++|+.
T Consensus       213 lA~~A~e~~~Pf~v~aesyKf~p~~~~~~~~~-~~~~~~~e~~~~~~~~~~~v~Np~fD~TP~~~Id~iITe~G~~pp~~  291 (301)
T COG1184         213 LALAARELRVPFYVVAESYKFVPKTLLDTLVE-IELRDPLEVAREEPLGNLKVRNPAFDVTPPEYIDAIITELGIIPPSS  291 (301)
T ss_pred             HHHHHHHhCCCEEEEeeeecccccccCCCcce-eeccChhhccccCcccCccccccccCCCcHHHhheeeecCCCCCchh
Confidence            58999999999999999999999999888776 788888887543   25899999999999999999999999999999


Q ss_pred             HHHHHHHhhC
Q psy6494          78 VSDELIKLYL   87 (87)
Q Consensus        78 i~~~l~~~y~   87 (87)
                      ++++++++|.
T Consensus       292 ~~~i~~e~~~  301 (301)
T COG1184         292 IYRILRELYG  301 (301)
T ss_pred             HHHHHHHhhC
Confidence            9999999984


No 5  
>PRK05720 mtnA methylthioribose-1-phosphate isomerase; Reviewed
Probab=99.91  E-value=4.2e-25  Score=161.07  Aligned_cols=83  Identities=30%  Similarity=0.471  Sum_probs=72.5

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC-------CCccccCCeeeecCCCCccEEEeCCCCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK-------ENLSKYHPLVDYTPPQYITLLFTDLGIL   73 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~-------~~~~~~np~fD~tPp~lI~~~iTe~G~~   73 (87)
                      +|++||+|+|||||+|+++||++..+ +++++++|+|++.|++..       ++++++||+||+|||+|||++|||.|++
T Consensus       251 lAl~Ak~~~vPfyV~a~~~kfd~~~~-~g~~i~iE~r~~~ev~~~~~~~~~~~~v~v~Np~FDvTP~~lIt~iITE~Gv~  329 (344)
T PRK05720        251 LAIAAKYHGVPFYVAAPSSTIDLTLA-DGKEIPIEERDPEEVTEVGGVRIAPEGVKVYNPAFDVTPAELITGIITEKGIV  329 (344)
T ss_pred             HHHHHHHhCCCEEEeccccccCcCCC-CCcccccccCCHHHhcccCCcccCCCCceeecccccCCCHHHCCEEEcCCCcc
Confidence            58999999999999999999999976 456788999999988642       5789999999999999999999999999


Q ss_pred             CCchHHHHHHHh
Q psy6494          74 TPSAVSDELIKL   85 (87)
Q Consensus        74 ~p~~i~~~l~~~   85 (87)
                      +|+++.. ++++
T Consensus       330 ~p~~~~~-~~~~  340 (344)
T PRK05720        330 APPDTAN-LAAL  340 (344)
T ss_pred             CccHHHH-HHHH
Confidence            9997663 4544


No 6  
>KOG1466|consensus
Probab=99.89  E-value=1.6e-24  Score=152.67  Aligned_cols=87  Identities=68%  Similarity=1.185  Sum_probs=76.4

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCcccc---CCcccccCCCccccCCeeeecCCCCccEEEeCCCCcCCch
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFK---FTSSILKKENLSKYHPLVDYTPPQYITLLFTDLGILTPSA   77 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~---~~~~v~~~~~~~~~np~fD~tPp~lI~~~iTe~G~~~p~~   77 (87)
                      +|++||+.++||||+||+|||.+.||++|.|++.+.+   ....+.+.+++...+|..|||||++|++++||+|+++|+.
T Consensus       224 ~~v~Ak~~~kPfYV~AES~KFvRlfPLnQ~Dlp~~~~p~~f~~~~~~~~~~~~e~p~vDYTpPeyiTlL~TDLGvltPSa  303 (313)
T KOG1466|consen  224 VAVCAKSMNKPFYVVAESHKFVRLFPLNQKDLPPALPPFKFSRPVPEREDVEREHPTVDYTPPEYLTLLFTDLGVLTPSA  303 (313)
T ss_pred             hhhhHHhcCCCeEEEeeccceeeeccCcccccccccCCcccCCCCCcHHhhhhcCCCcccChHHHHHHHHhhccccChhh
Confidence            5899999999999999999999999999999987732   2222322257888999999999999999999999999999


Q ss_pred             HHHHHHHhhC
Q psy6494          78 VSDELIKLYL   87 (87)
Q Consensus        78 i~~~l~~~y~   87 (87)
                      ++++|-++|+
T Consensus       304 VsdELIKlYl  313 (313)
T KOG1466|consen  304 VSDELIKLYL  313 (313)
T ss_pred             hhHHHHHhhC
Confidence            9999999996


No 7  
>TIGR00524 eIF-2B_rel eIF-2B alpha/beta/delta-related uncharacterized proteins. This model, eIF-2B_rel, describes half of a superfamily, where the other half consists of eukaryotic translation initiation factor 2B (eIF-2B) subunits alpha, beta, and delta. It is unclear whether the eIF-2B_rel set is monophyletic, or whether they are all more closely related to each other than to any eIF-2B subunit because the eIF-2B clade is highly derived. Members of this branch of the family are all uncharacterized with respect to function and are found in the Archaea, Bacteria, and Eukarya, although a number are described as putative translation intiation factor components. Proteins found by eIF-2B_rel include at least three clades, including a set of uncharacterized eukaryotic proteins, a set found in some but not all Archaea, and a set universal so far among the Archaea and closely related to several uncharacterized bacterial proteins.
Probab=99.89  E-value=3e-24  Score=154.44  Aligned_cols=74  Identities=31%  Similarity=0.448  Sum_probs=65.7

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC-------CCccccCCeeeecCCCCccEEEeCCCCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK-------ENLSKYHPLVDYTPPQYITLLFTDLGIL   73 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~-------~~~~~~np~fD~tPp~lI~~~iTe~G~~   73 (87)
                      +|++||+++|||||+||+|||+++.+ .++++++|++++.|+...       ++++++||+||+|||+|||++|||.|++
T Consensus       223 lA~~Ak~~~vPv~V~a~s~K~~~~~~-~g~~i~~e~~~~~ev~~~~~~~~~~~~~~v~np~fD~TP~~lIt~iiTe~Gv~  301 (303)
T TIGR00524       223 LAVLAKEFRIPFFVAAPLSTFDTKTS-CGEDIVIEERDPEEVAQVGGVRIAPLGVKVYNPAFDITPHDLIDAIITEKGII  301 (303)
T ss_pred             HHHHHHHhCCCEEEecccccccCCCC-CccccccccCCHHHhccccCcccCCCCceeecccccCCCHHHCCEEEcCCCcc
Confidence            58999999999999999999999976 446778899988887532       5789999999999999999999999999


Q ss_pred             CC
Q psy6494          74 TP   75 (87)
Q Consensus        74 ~p   75 (87)
                      +|
T Consensus       302 ~p  303 (303)
T TIGR00524       302 TP  303 (303)
T ss_pred             Cc
Confidence            87


No 8  
>PRK06371 translation initiation factor IF-2B subunit alpha; Provisional
Probab=99.88  E-value=5.3e-24  Score=154.45  Aligned_cols=80  Identities=29%  Similarity=0.384  Sum_probs=68.8

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC-------CCccccCCeeeecCCCCccEEEeCCCCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK-------ENLSKYHPLVDYTPPQYITLLFTDLGIL   73 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~-------~~~~~~np~fD~tPp~lI~~~iTe~G~~   73 (87)
                      +|++||+|+|||||+||+++|..... +++.+++|+|++.|++..       +++++.||+||+|||+|||++|||.|++
T Consensus       241 lAl~Ak~~~VPfyV~a~~~t~d~~~~-~g~~i~iEer~~~ev~~~~g~~~~p~~~~v~Np~FDvTP~elIt~iITE~Gv~  319 (329)
T PRK06371        241 KAVLAKVNGIPFYVAAPGSTFDFSIK-SGDEIPIEERDENEVLEINGCRIGPQESHARNPAFDVTPNEYVTGFITEYGIF  319 (329)
T ss_pred             HHHHHHHcCCCEEEeccccccCCCCC-CcCccccccCCHHHeeccCCeecCCCCccccCcCccCCCHHHCCEEEccCCcc
Confidence            58999999999999999766665433 456788999999988753       4678999999999999999999999999


Q ss_pred             CCchHHHH
Q psy6494          74 TPSAVSDE   81 (87)
Q Consensus        74 ~p~~i~~~   81 (87)
                      +|++++++
T Consensus       320 ~p~~i~~~  327 (329)
T PRK06371        320 KPNELWKL  327 (329)
T ss_pred             ChHHhhhc
Confidence            99999874


No 9  
>TIGR00512 salvage_mtnA S-methyl-5-thioribose-1-phosphate isomerase. The delineation of this family was based in part on a discussion and neighbor-joining phylogenetic study, by Kyrpides and Woese, of archaeal and other proteins homologous to the alpha, beta, and delta subunits of eukaryotic initiation factor 2B (eIF-2B), a five-subunit molecule that catalyzes GTP recycling for eIF-2. This clade is now recognized to include the methionine salvage pathway enzyme MtnA.
Probab=99.88  E-value=7.9e-24  Score=153.73  Aligned_cols=74  Identities=28%  Similarity=0.432  Sum_probs=66.4

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC-------CCccccCCeeeecCCCCccEEEeCCCCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK-------ENLSKYHPLVDYTPPQYITLLFTDLGIL   73 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~-------~~~~~~np~fD~tPp~lI~~~iTe~G~~   73 (87)
                      +|++||+++|||||+||++||++..+ +++++++|+|++.|+...       ++++++||+||+|||+|||++|||.|++
T Consensus       251 lA~~Ak~~~vPfyV~a~~~kfd~~~~-~~~~i~iE~r~p~ev~~~~g~~~~~~~~~v~Np~FD~TP~~lIt~iITe~Gv~  329 (331)
T TIGR00512       251 LAVLAKHHGVPFYVAAPTSTIDLETK-DGAEIPIEERPPEEVTHVGGVRIAPPGIDVWNPAFDVTPAELITGIITEKGVI  329 (331)
T ss_pred             HHHHHHHhCCCEEEeccccccccCCC-CccccccccCCHHHhcccCCcccCCCCceeecccccCCCHHHCCEEEccCCcc
Confidence            58999999999999999999999875 556788999999887642       5789999999999999999999999999


Q ss_pred             CC
Q psy6494          74 TP   75 (87)
Q Consensus        74 ~p   75 (87)
                      .|
T Consensus       330 ~p  331 (331)
T TIGR00512       330 TP  331 (331)
T ss_pred             CC
Confidence            76


No 10 
>PF01008 IF-2B:  Initiation factor 2 subunit family;  InterPro: IPR000649 Initiation factor 2 binds to Met-tRNA, GTP and the small ribosomal subunit. The eukaryotic translation initiation factor EIF-2B is a complex made up of five different subunits, alpha, beta, gamma, delta and epsilon, and catalyses the exchange of EIF-2-bound GDP for GTP. This family includes initiation factor 2B alpha, beta and delta subunits from eukaryotes; related proteins from archaebacteria and IF-2 from prokaryotes and also contains a subfamily of proteins in eukaryotes, archaeae (e.g. Pyrococcus furiosus), or eubacteria such as Bacillus subtilis and Thermotoga maritima. Many of these proteins were initially annotated as putative translation initiation factors despite the fact that there is no evidence for the requirement of an IF2 recycling factor in prokaryotic translation initiation. Recently, one of these proteins from B. subtilis has been functionally characterised as a 5-methylthioribose-1-phosphate isomerase (MTNA) []. This enzyme participates in the methionine salvage pathway catalysing the isomerisation of 5-methylthioribose-1-phosphate to 5-methylthioribulose-1-phosphate []. The methionine salvage pathway leads to the synthesis of methionine from methylthioadenosine, the end product of the spermidine and spermine anabolism in many species.; GO: 0044237 cellular metabolic process; PDB: 1VB5_A 1T5O_D 3A11_E 3VM6_C 1W2W_A 1T9K_A 3ECS_B 2YRF_A 2YVK_B 2A0U_A ....
Probab=99.88  E-value=3.3e-24  Score=151.45  Aligned_cols=74  Identities=51%  Similarity=0.878  Sum_probs=58.1

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC-------CCccccCCeeeecCCCCccEEEeCCCCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK-------ENLSKYHPLVDYTPPQYITLLFTDLGIL   73 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~-------~~~~~~np~fD~tPp~lI~~~iTe~G~~   73 (87)
                      +|++||+++|||||+|++|||++.+++++... +|.+++.+++..       +++++.||+||+|||+|||++|||.|++
T Consensus       202 ~a~~Ak~~~vPv~v~~~~~K~~~~~~~~~~~~-~e~~~~~~v~~~~~~~~~~~~v~~~~p~~D~tP~~~It~~iTe~G~~  280 (282)
T PF01008_consen  202 LALAAKEFNVPVYVLAESYKFSPRYPLDQDSF-NELRDPQEVLPFDGSSIVPENVDVINPLFDYTPPDLITLIITELGIL  280 (282)
T ss_dssp             HHHHHHHTT-EEEEE--GGGBETTCSSGGGSS-S-B--THHHHEETTEEESTTTEEEE-BSEEEEEGGG-SEEEETTEEE
T ss_pred             HHHHHHhhCCCEEEEcccccccccccccchhh-hhccccceeeccCCcccccceeeccCccEeecCHHHCCEEEcCCCCC
Confidence            58999999999999999999999998887665 788888877543       4889999999999999999999999999


Q ss_pred             CC
Q psy6494          74 TP   75 (87)
Q Consensus        74 ~p   75 (87)
                      +|
T Consensus       281 ~P  282 (282)
T PF01008_consen  281 PP  282 (282)
T ss_dssp             -C
T ss_pred             Cc
Confidence            98


No 11 
>PRK05772 translation initiation factor IF-2B subunit alpha; Provisional
Probab=99.88  E-value=2.1e-23  Score=152.87  Aligned_cols=82  Identities=34%  Similarity=0.516  Sum_probs=69.7

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCccccc-------CCCccccCCeeeecCCCCccEEEeCCCCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILK-------KENLSKYHPLVDYTPPQYITLLFTDLGIL   73 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~-------~~~~~~~np~fD~tPp~lI~~~iTe~G~~   73 (87)
                      +|++||+|+|||||+||++||++..+.  +++.+|+|++.|++.       .++++++||+||+|||+|||++|||.|++
T Consensus       272 lA~~Ak~~~vPfyV~ap~~k~d~~~~~--~~i~ieer~p~ev~~~~~~~~~~~~~~v~Np~FDvTP~~lIt~iITE~Gv~  349 (363)
T PRK05772        272 EAVIAHELGIPFYALAPTSTFDLKSDV--NDVKIEERDPNEVRTIRGVPITPEDVNVYNPVFDVTPPKYITGIITEKGII  349 (363)
T ss_pred             HHHHHHHhCCCEEEEccccccCccccc--cccccccCCHHHhcccCCceecCCCceeeccCccCCCHHHCCEEEccCCcc
Confidence            589999999999999999999998764  567789999988854       26789999999999999999999999999


Q ss_pred             CCchHHHHHHHh
Q psy6494          74 TPSAVSDELIKL   85 (87)
Q Consensus        74 ~p~~i~~~l~~~   85 (87)
                      .|+... .++++
T Consensus       350 ~p~~~~-~~~~~  360 (363)
T PRK05772        350 YPPFHK-NIRKI  360 (363)
T ss_pred             CCchHH-HHHHH
Confidence            987533 34443


No 12 
>PRK08334 translation initiation factor IF-2B subunit beta; Validated
Probab=99.87  E-value=7.6e-23  Score=149.59  Aligned_cols=83  Identities=30%  Similarity=0.450  Sum_probs=70.5

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC------CCccccCCeeeecCCCCccEEEeCCCCcC
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK------ENLSKYHPLVDYTPPQYITLLFTDLGILT   74 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~------~~~~~~np~fD~tPp~lI~~~iTe~G~~~   74 (87)
                      +|++||+|+|||||+|+++|+++..+ ++.++++|+|++++++..      ++++++||+||+|||+|||++|||.|++.
T Consensus       264 lA~~Ak~~~vPfyV~Ap~~t~d~~~~-~~~~i~iE~r~~~ev~~~~~~~~~~~~~v~NPaFDvTPp~lIt~iITE~Gv~~  342 (356)
T PRK08334        264 LAVLAKEHGIPFFTVAPLSTIDMSLK-SGKEIPIEERSPEEVLTCGGCRIAPDVDVYNPAFDVTPHKYLTGIITDRGVVW  342 (356)
T ss_pred             HHHHHHHhCCCEEEEcccCccCCCCC-CCcccccccCChHHheeccCcccCCCcceecccccCCCHHHCCEEEcCCCccC
Confidence            58999999999999999999998765 455778999999988753      46899999999999999999999999999


Q ss_pred             CchHHHHHHHh
Q psy6494          75 PSAVSDELIKL   85 (87)
Q Consensus        75 p~~i~~~l~~~   85 (87)
                      |++.. .++++
T Consensus       343 P~~~~-~~~~~  352 (356)
T PRK08334        343 PPFER-NLKKL  352 (356)
T ss_pred             CchHH-HHHHH
Confidence            98644 34443


No 13 
>PRK08335 translation initiation factor IF-2B subunit alpha; Validated
Probab=99.86  E-value=1.3e-22  Score=144.32  Aligned_cols=71  Identities=30%  Similarity=0.444  Sum_probs=60.8

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccCCCccccCCeeeecCCCCccEEEeCCCCcCCch
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKKENLSKYHPLVDYTPPQYITLLFTDLGILTPSA   77 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~~~~~~~np~fD~tPp~lI~~~iTe~G~~~p~~   77 (87)
                      +|++||+|+|||||+||+|||++.++.  .++++|+++..    .+++++.||+||+||++|||++|||.|++.|+.
T Consensus       203 lA~~Ak~~~vPfyV~a~~~k~~~~~~~--~~i~ieer~~~----~~~~~v~Np~FDvTP~~lIt~iITE~Gv~~p~~  273 (275)
T PRK08335        203 LALACHDNGVPFYVAAETFKFHPELKS--EEVELVERPYA----RQGHRVRNVLFDVTPWKYVRGIITELGILVPPR  273 (275)
T ss_pred             HHHHHHHcCCCEEEECccceecccCCC--CCccccccCCC----CCCceecCcCccCCCHHHCCEEEccCCccCCCC
Confidence            589999999999999999999998653  36667766542    368999999999999999999999999998754


No 14 
>PRK06036 translation initiation factor IF-2B subunit alpha; Provisional
Probab=99.86  E-value=7.4e-23  Score=149.05  Aligned_cols=79  Identities=28%  Similarity=0.325  Sum_probs=68.2

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC-------CCccccCCeeeecCCCCccEEEeCCCCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK-------ENLSKYHPLVDYTPPQYITLLFTDLGIL   73 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~-------~~~~~~np~fD~tPp~lI~~~iTe~G~~   73 (87)
                      +|++||+|+|||||+|+++||+.... ++ ++++|+|++.|+...       ++++++||+||+|||+|||++|||.|++
T Consensus       251 lA~~Ak~~~vPfyV~ap~s~~d~~~~-~g-~i~iE~r~~~Ev~~~~~~~~~~~~v~v~Np~FDvTP~~lIt~iITE~Gv~  328 (339)
T PRK06036        251 HSVLAKEHEIPFYVAAPLSTFDFEGW-EG-SVKIEERDPDELRYCGKTQIAPKDVPVYNPAFDATPMENVTAIITEKGVF  328 (339)
T ss_pred             HHHHHHHhCCCEEEEeecCccCCCcC-CC-CcccccCCHHHhccccCcccCCCCceeeCcccccCCHHHCCEEEccCCcc
Confidence            58999999999999999999998754 23 677899999887542       5789999999999999999999999999


Q ss_pred             CCchHHHH
Q psy6494          74 TPSAVSDE   81 (87)
Q Consensus        74 ~p~~i~~~   81 (87)
                      .|++.+++
T Consensus       329 ~P~~~~~~  336 (339)
T PRK06036        329 YPPFLLDE  336 (339)
T ss_pred             cCCccccc
Confidence            99876543


No 15 
>COG0182 Predicted translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis]
Probab=99.85  E-value=2.8e-22  Score=144.46  Aligned_cols=76  Identities=34%  Similarity=0.491  Sum_probs=68.1

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC-------CCccccCCeeeecCCCCccEEEeCCCCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK-------ENLSKYHPLVDYTPPQYITLLFTDLGIL   73 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~-------~~~~~~np~fD~tPp~lI~~~iTe~G~~   73 (87)
                      +|.+||+|||||||+++.-.|+.... ++.++++|+|+|.|++..       +++.+.||+||+||++||+++|||+|++
T Consensus       254 lAvlAk~~gIPFyVaAP~sTiD~~~~-~G~~I~IEER~p~Ev~~v~g~riap~~v~~yNPAFDvTP~~lItgIITEkGv~  332 (346)
T COG0182         254 LAVLAKHHGIPFYVAAPLSTIDFELK-SGEDIPIEERDPEEVLEVGGVRIAPEGVEAYNPAFDVTPPELITGIITEKGVF  332 (346)
T ss_pred             HHHHHHHcCCCeEEEcccCccccccC-CCCccceeecCHHHeEeeccEEeCCCCccccCccccCChHHhcceeeecccee
Confidence            48899999999999999888887754 567899999999998653       6899999999999999999999999999


Q ss_pred             CCch
Q psy6494          74 TPSA   77 (87)
Q Consensus        74 ~p~~   77 (87)
                      .|..
T Consensus       333 ~p~~  336 (346)
T COG0182         333 TPPF  336 (346)
T ss_pred             cCch
Confidence            9973


No 16 
>PRK06372 translation initiation factor IF-2B subunit delta; Provisional
Probab=99.84  E-value=4.7e-22  Score=140.09  Aligned_cols=76  Identities=30%  Similarity=0.451  Sum_probs=59.3

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccCCCccccCCeeeecCCCCccEEEeCCCCcCCchHH
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKKENLSKYHPLVDYTPPQYITLLFTDLGILTPSAVS   79 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~~~~~~~np~fD~tPp~lI~~~iTe~G~~~p~~i~   79 (87)
                      +|++||+++|||||+|++|||+++++.+...- .+.....+.  .++++++||+||+|||+||+++|||.|+++|+++.
T Consensus       177 ~Al~A~~~~vPv~V~~~s~Kf~~~~~~~~~~~-~~~~~~~~~--~~~l~v~Np~FD~TPpelI~~iITE~Gi~~pssV~  252 (253)
T PRK06372        177 LALCARYLKKPFYSLTISMKIERNFLYSTYPN-FKNHPCSEW--NIDIPCINRYFDKTPPDLIDYYINENGFVKPSDVN  252 (253)
T ss_pred             HHHHHHHcCCCEEEEeeccccCCCCccccccc-ccccccccC--CCCCceeCcCcCCCCHHHCCEEEcCCCccccccCC
Confidence            58999999999999999999999876543221 111111111  15789999999999999999999999999999863


No 17 
>KOG1467|consensus
Probab=99.83  E-value=4.5e-22  Score=149.12  Aligned_cols=84  Identities=29%  Similarity=0.434  Sum_probs=71.9

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCccccc---------------CCCccccCCeeeecCCCCccE
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILK---------------KENLSKYHPLVDYTPPQYITL   65 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~---------------~~~~~~~np~fD~tPp~lI~~   65 (87)
                      +|++|++|+|||+||||+|||+.++++|.--. ||.++|.++..               ..++++.|..||.||||||++
T Consensus       453 valvAna~nVPVlVCCE~yKF~eRvQlDsi~~-NEL~dpn~l~~v~g~~~~~~L~~wqn~~~L~~lnl~YD~TPpelIs~  531 (556)
T KOG1467|consen  453 VALVANAFNVPVLVCCEAYKFHERVQLDSIVS-NELGDPNALQEVRGREDKVALAGWQNNANLKFLNLMYDVTPPELISA  531 (556)
T ss_pred             HHHHhcccCCCEEEEechhhhhhhhhhhhhhh-cccCChhhhhhccCcchhhhhhccccccccchhheeeccCcHHHHHH
Confidence            58999999999999999999999998886443 77777663211               147899999999999999999


Q ss_pred             EEeCCCCcCCchHHHHHHHh
Q psy6494          66 LFTDLGILTPSAVSDELIKL   85 (87)
Q Consensus        66 ~iTe~G~~~p~~i~~~l~~~   85 (87)
                      +|||.|+++|++++..|++.
T Consensus       532 vVTe~g~lp~TSVPvilr~~  551 (556)
T KOG1467|consen  532 VVTELGMLPPTSVPVILREK  551 (556)
T ss_pred             HHhhccccCCccchHHHhhh
Confidence            99999999999999988763


No 18 
>KOG1468|consensus
Probab=99.73  E-value=1.8e-19  Score=128.23  Aligned_cols=81  Identities=25%  Similarity=0.376  Sum_probs=67.8

Q ss_pred             CccccccCCCcEEEEcccccCccCccCCCCCCCccccCCcccccC----------CCccccCCeeeecCCCCccEEEeCC
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKK----------ENLSKYHPLVDYTPPQYITLLFTDL   70 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~~~~~~~~~~~~e~~~~~~v~~~----------~~~~~~np~fD~tPp~lI~~~iTe~   70 (87)
                      +|.+||+||+||||+++.-..+.... .++++.+|+|++.|....          .++.++||+||+||++||++||||.
T Consensus       259 LAv~aKhhgipFyvaaP~tsid~~l~-tG~eIiIEERp~~Em~~v~gg~~v~Iaapgi~vwnPAFDvTPa~LItgIiTe~  337 (354)
T KOG1468|consen  259 LAVLAKHHGIPFYVAAPFTSIDLSLA-TGDEIIIEERPPAEMTHVTGGEGVRIAAPGINVWNPAFDVTPAELITGIITEK  337 (354)
T ss_pred             HHHHHHhcCCceEEeccccccccccC-CCCeeEEeecCchHheeecCCcceEecCCCCCccCccccCCHHHHHHHHhhhc
Confidence            58899999999999999776666554 566777899999886442          5789999999999999999999999


Q ss_pred             CCcCCchHHHHH
Q psy6494          71 GILTPSAVSDEL   82 (87)
Q Consensus        71 G~~~p~~i~~~l   82 (87)
                      |.++|....+.+
T Consensus       338 g~f~~~~~~~~~  349 (354)
T KOG1468|consen  338 GVFTPEELEEAI  349 (354)
T ss_pred             cccChHHhcchh
Confidence            999998765443


No 19 
>COG1929 Glycerate kinase [Carbohydrate transport and metabolism]
Probab=82.73  E-value=0.55  Score=35.28  Aligned_cols=22  Identities=27%  Similarity=0.193  Sum_probs=18.6

Q ss_pred             CccccccCCCcEEEEcccccCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFV   22 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~   22 (87)
                      +|.+||.|+|||+++|++.+-.
T Consensus       308 VA~~Akk~~vPvIaiaGs~~~~  329 (378)
T COG1929         308 VAKLAKKYGVPVIAIAGSLGED  329 (378)
T ss_pred             HHHhhhhhCCCEEEEecccccC
Confidence            5789999999999999985543


No 20 
>PRK09932 glycerate kinase II; Provisional
Probab=79.33  E-value=0.73  Score=34.73  Aligned_cols=22  Identities=23%  Similarity=0.178  Sum_probs=18.7

Q ss_pred             CccccccCCCcEEEEcccccCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFV   22 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~   22 (87)
                      ||..|+++++||+++|++.+..
T Consensus       308 Va~~A~~~~~Pvi~i~G~~~~~  329 (381)
T PRK09932        308 VASVAKQFNVPVIGIAGVLGDG  329 (381)
T ss_pred             HHHHHHHcCCCEEEEecccCCC
Confidence            4678999999999999997544


No 21 
>PF02595 Gly_kinase:  Glycerate kinase family;  InterPro: IPR004381 This family includes glycerate kinase 2 (2.7.1.31 from EC), which catalyses the phosphorylation of (R)-glycerate to 3-phospho-(R)-glycerate in the presence of ATP. These proteins consist of two different alpha/beta domains: domain 1 has a flavodoxin-like fold, while domain 2 has a restriction enzyme-like fold (domain 2 is inserted into domain 1).; GO: 0008887 glycerate kinase activity, 0031388 organic acid phosphorylation; PDB: 3CWC_B 1TO6_A.
Probab=76.39  E-value=0.95  Score=34.06  Aligned_cols=23  Identities=26%  Similarity=0.210  Sum_probs=16.3

Q ss_pred             CccccccCCCcEEEEcccccCcc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVR   23 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~   23 (87)
                      ||.+|+.++||++++|++.....
T Consensus       308 Va~~A~~~~vPviav~G~~~~~~  330 (377)
T PF02595_consen  308 VARLAKKHGVPVIAVAGSVDLDA  330 (377)
T ss_dssp             HHCCHCCTT--EEEEECEC-TT-
T ss_pred             HHHHHHHcCCcEEEEeCCCCCCh
Confidence            47789999999999999866554


No 22 
>PRK10342 glycerate kinase I; Provisional
Probab=75.69  E-value=1.2  Score=33.68  Aligned_cols=23  Identities=30%  Similarity=0.225  Sum_probs=19.1

Q ss_pred             CccccccCCCcEEEEcccccCcc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVR   23 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~   23 (87)
                      ||..||+++||++++|++.....
T Consensus       308 Va~~A~~~~vPviai~G~~~~~~  330 (381)
T PRK10342        308 VANVAKKYHKPVIGIAGSLTDDV  330 (381)
T ss_pred             HHHHHHHhCCCEEEEecccCCCh
Confidence            46789999999999999875543


No 23 
>TIGR00045 glycerate kinase. The only characterized member of this family so far is the glycerate kinase GlxK (EC 2.7.1.31) of E. coli. This enzyme acts after glyoxylate carboligase and 2-hydroxy-3-oxopropionate reductase (tartronate semialdehyde reductase) in the conversion of glyoxylate to 3-phosphoglycerate (the D-glycerate pathway) as a part of allantoin degradation.
Probab=75.14  E-value=1.1  Score=33.79  Aligned_cols=22  Identities=27%  Similarity=0.167  Sum_probs=18.8

Q ss_pred             CccccccCCCcEEEEcccccCc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFV   22 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~   22 (87)
                      ||..|++++||++++|++....
T Consensus       307 Va~~A~~~~vPviai~G~v~~~  328 (375)
T TIGR00045       307 VAKRAKKYGVPVIAIAGSLGDG  328 (375)
T ss_pred             HHHHHHHhCCeEEEEecccCCC
Confidence            4678999999999999987554


No 24 
>PF13336 AcetylCoA_hyd_C:  Acetyl-CoA hydrolase/transferase C-terminal domain; PDB: 3EH7_A 3D3U_A 2OAS_A 3GK7_B 3QDQ_A 2G39_A 2NVV_C 3S8D_B 3QLI_B 3QLK_B ....
Probab=60.77  E-value=4.8  Score=26.77  Aligned_cols=20  Identities=20%  Similarity=0.366  Sum_probs=14.5

Q ss_pred             ecCCCCccEEEeCCCCcCCc
Q psy6494          57 YTPPQYITLLFTDLGILTPS   76 (87)
Q Consensus        57 ~tPp~lI~~~iTe~G~~~p~   76 (87)
                      .+|...++.+|||.|+..-.
T Consensus       108 t~~r~dvd~VVTEyGvA~Lr  127 (154)
T PF13336_consen  108 TTPRHDVDYVVTEYGVADLR  127 (154)
T ss_dssp             SB-TTT-SEEEETTEEEE-T
T ss_pred             ccCcccCCEEEcCCEEEEeC
Confidence            57889999999999987543


No 25 
>PF00391 PEP-utilizers:  PEP-utilising enzyme, mobile domain;  InterPro: IPR008279 A number of enzymes that catalyze the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) via a phospho-histidine intermediate have been shown to be structurally related [, , , ]. All these enzymes share the same catalytic mechanism: they bind PEP and transfer the phosphoryl group from it to a histidine residue. This domain is a "swivelling" beta/beta/alpha domain which is thought to be mobile in all proteins known to contain it []. It is often found associated with the pyruvate phosphate dikinase, PEP/pyruvate-binding domain (IPR002192 from INTERPRO) at its N terminus.; GO: 0016772 transferase activity, transferring phosphorus-containing groups, 0016310 phosphorylation; PDB: 2X0S_A 2OLS_A 2HRO_A 2E28_A 2WQD_A 3T05_D 3T0T_D 3T07_B 2DIK_A 2FM4_A ....
Probab=60.16  E-value=3  Score=24.13  Aligned_cols=16  Identities=38%  Similarity=0.343  Sum_probs=13.5

Q ss_pred             ccccccCCCcEEEEcc
Q psy6494           2 AVCAKELKKPFYVLAE   17 (87)
Q Consensus         2 A~~Ak~~~vPv~v~a~   17 (87)
                      |.+||++++|.++-+.
T Consensus        46 aIlAr~~giP~ivg~~   61 (80)
T PF00391_consen   46 AILARELGIPAIVGVG   61 (80)
T ss_dssp             HHHHHHTT-EEEESTT
T ss_pred             HHHHHHcCCCEEEeec
Confidence            6789999999999886


No 26 
>KOG3325|consensus
Probab=56.62  E-value=5.6  Score=26.82  Aligned_cols=23  Identities=22%  Similarity=0.377  Sum_probs=20.7

Q ss_pred             CccccccCCCcEEEEcccccCcc
Q psy6494           1 MAVCAKELKKPFYVLAESFKFVR   23 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~~~K~~~   23 (87)
                      +|++||+.++-..+...+|||.-
T Consensus        99 L~~LaRqldvDILl~G~Th~f~A  121 (183)
T KOG3325|consen   99 LALLARQLDVDILLTGHTHKFEA  121 (183)
T ss_pred             HHHHHHhcCCcEEEeCCceeEEE
Confidence            47899999999999999999974


No 27 
>PRK05634 nucleosidase; Provisional
Probab=47.63  E-value=6.5  Score=26.41  Aligned_cols=16  Identities=25%  Similarity=0.357  Sum_probs=13.6

Q ss_pred             CccccccCCCcEEEEc
Q psy6494           1 MAVCAKELKKPFYVLA   16 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a   16 (87)
                      +|..|+.+++||+++=
T Consensus       137 va~va~~~~vPf~~iR  152 (185)
T PRK05634        137 VAAVAAEFGVPCRLVK  152 (185)
T ss_pred             HHHHHHHhCCCEEEEE
Confidence            4788999999999873


No 28 
>COG4359 Uncharacterized conserved protein [Function unknown]
Probab=44.40  E-value=14  Score=25.84  Aligned_cols=17  Identities=29%  Similarity=0.425  Sum_probs=14.8

Q ss_pred             cccCCCcEEEEcccccC
Q psy6494           5 AKELKKPFYVLAESFKF   21 (87)
Q Consensus         5 Ak~~~vPv~v~a~~~K~   21 (87)
                      +|++++||+|++.-.++
T Consensus        85 ike~di~fiVvSsGm~~  101 (220)
T COG4359          85 IKEHDIPFIVVSSGMDP  101 (220)
T ss_pred             HHHcCCCEEEEeCCCch
Confidence            68999999999887765


No 29 
>COG0238 RpsR Ribosomal protein S18 [Translation, ribosomal structure and biogenesis]
Probab=38.08  E-value=4.2  Score=23.95  Aligned_cols=28  Identities=14%  Similarity=0.388  Sum_probs=23.7

Q ss_pred             CCeeeecCCCCccEEEeCCCCcCCchHH
Q psy6494          52 HPLVDYTPPQYITLLFTDLGILTPSAVS   79 (87)
Q Consensus        52 np~fD~tPp~lI~~~iTe~G~~~p~~i~   79 (87)
                      .+..||=.+++..-+|||.|-+.|.-+.
T Consensus        25 ~~~iDYKd~~~L~rfise~GKI~prRiT   52 (75)
T COG0238          25 IEEIDYKDVELLKRFISERGKILPRRIT   52 (75)
T ss_pred             CCccCccCHHHHHHHhcccCcccccccc
Confidence            3578898999999999999999997543


No 30 
>PRK07077 hypothetical protein; Provisional
Probab=37.66  E-value=12  Score=26.35  Aligned_cols=15  Identities=27%  Similarity=0.193  Sum_probs=12.9

Q ss_pred             CccccccCCCcEEEE
Q psy6494           1 MAVCAKELKKPFYVL   15 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~   15 (87)
                      +|..|+++++||+++
T Consensus       148 vA~va~~~giPf~vi  162 (238)
T PRK07077        148 AAAFAAARGLPFAAC  162 (238)
T ss_pred             HHHHHHHcCCCEEEE
Confidence            467889999999987


No 31 
>CHL00077 rps18 ribosomal protein S18
Probab=37.19  E-value=5.7  Score=23.98  Aligned_cols=26  Identities=15%  Similarity=0.340  Sum_probs=22.9

Q ss_pred             CeeeecCCCCccEEEeCCCCcCCchH
Q psy6494          53 PLVDYTPPQYITLLFTDLGILTPSAV   78 (87)
Q Consensus        53 p~fD~tPp~lI~~~iTe~G~~~p~~i   78 (87)
                      ..+||.-.++++-+|||.|-+-|..+
T Consensus        26 ~~iDYKnv~lL~~Fis~~GkIlpRri   51 (86)
T CHL00077         26 DRIDYKNMSLLSRFISEQGKILSRRV   51 (86)
T ss_pred             CcCCccCHHHHHHhcCCCCeEcCccc
Confidence            35999999999999999999998754


No 32 
>TIGR00165 S18 ribosomal protein S18. This ribosomal small subunit protein is found in all eubacteria so far, as well as in chloroplasts. YER050C from Saccharomyces cerevisiae and a related protein from Caenorhabditis elegans appear to be homologous and may represent mitochondrial forms. The trusted cutoff is set high enough that these two candidate S18 proteins are not categorized automatically.
Probab=37.12  E-value=5.6  Score=23.04  Aligned_cols=25  Identities=16%  Similarity=0.498  Sum_probs=22.1

Q ss_pred             eeeecCCCCccEEEeCCCCcCCchH
Q psy6494          54 LVDYTPPQYITLLFTDLGILTPSAV   78 (87)
Q Consensus        54 ~fD~tPp~lI~~~iTe~G~~~p~~i   78 (87)
                      .+||--.++++-+|||.|-+-|..+
T Consensus        17 ~iDYKnv~lL~~Fis~~GkIlpRri   41 (70)
T TIGR00165        17 FIDYKDLDLLKKFISERGKILPRRI   41 (70)
T ss_pred             cCCccCHHHHHHhcCCCCeEcCCcc
Confidence            4889999999999999999998754


No 33 
>TIGR01704 MTA/SAH-Nsdase 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase. There are homologs of this enzyme in plants, some of which score between trusted and noise cutoffs here, but there is no experimental evidence to validate this function at this time.
Probab=34.75  E-value=14  Score=25.32  Aligned_cols=17  Identities=24%  Similarity=0.473  Sum_probs=13.9

Q ss_pred             CccccccCCCcEEEEcc
Q psy6494           1 MAVCAKELKKPFYVLAE   17 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~   17 (87)
                      +|.+|+.+++||+++=.
T Consensus       177 va~va~~~~ip~~~iR~  193 (228)
T TIGR01704       177 IAHVCHNFNVPFVVVRA  193 (228)
T ss_pred             HHHHHHHhCCCEEEEEE
Confidence            46789999999998743


No 34 
>PF01084 Ribosomal_S18:  Ribosomal protein S18;  InterPro: IPR001648 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Evidence suggests that, in prokaryotes, the peptidyl transferase reaction is performed by the large subunit 23S rRNA, whereas proteins probably have a greater role in eukaryotic ribosomes. Most of the proteins lie close to, or on the surface of, the 30S subunit, arranged peripherally around the rRNA []. The small subunit ribosomal proteins can be categorised as primary binding proteins, which bind directly and independently to 16S rRNA; secondary binding proteins, which display no specific affinity for 16S rRNA, but its assembly is contingent upon the presence of one or more primary binding proteins; and tertiary binding proteins, which require the presence of one or more secondary binding proteins and sometimes other tertiary binding proteins. The small ribosomal subunit protein S18 is known to be involved in binding the aminoacyl-tRNA complex in Escherichia coli [], and appears to be situated at the tRNA A-site. Experimental evidence has revealed that S18 is well exposed on the surface of the E. coli ribosome, and is a secondary rRNA binding protein []. S18 belongs to a family of ribosomal proteins [] that includes: eubacterial S18; metazoan mitochondrial S18, algal and plant chloroplast S18; and cyanelle S18.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2UXD_R 3I8G_U 3UZ7_U 1N33_R 2XSY_R 3V24_R 3OGY_R 2XUY_R 2XFZ_R 3UXT_R ....
Probab=32.53  E-value=6.2  Score=21.61  Aligned_cols=27  Identities=15%  Similarity=0.455  Sum_probs=22.7

Q ss_pred             CeeeecCCCCccEEEeCCCCcCCchHH
Q psy6494          53 PLVDYTPPQYITLLFTDLGILTPSAVS   79 (87)
Q Consensus        53 p~fD~tPp~lI~~~iTe~G~~~p~~i~   79 (87)
                      -.+||--.++++-|||+.|-+-|..+.
T Consensus         5 ~~idykn~~lL~~Fi~~~GkIl~rr~T   31 (54)
T PF01084_consen    5 EYIDYKNVELLSQFISPTGKILPRRIT   31 (54)
T ss_dssp             SSSSSSSHHHHGCGBTTSSSBSTHHHH
T ss_pred             CcCCcCCHHHHHHHcCcccceehhhhc
Confidence            457888899999999999999997644


No 35 
>PRK06026 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; Validated
Probab=30.61  E-value=18  Score=25.11  Aligned_cols=15  Identities=13%  Similarity=0.217  Sum_probs=13.2

Q ss_pred             CccccccCCCcEEEE
Q psy6494           1 MAVCAKELKKPFYVL   15 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~   15 (87)
                      +|..|..+++||.++
T Consensus       153 vAqVc~~~~vPfl~i  167 (212)
T PRK06026        153 VLRACQAFGVPLIGL  167 (212)
T ss_pred             HHHHHHHcCCCEEEE
Confidence            478899999999986


No 36 
>PRK14697 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Provisional
Probab=30.22  E-value=19  Score=24.90  Aligned_cols=15  Identities=27%  Similarity=0.355  Sum_probs=13.0

Q ss_pred             CccccccCCCcEEEE
Q psy6494           1 MAVCAKELKKPFYVL   15 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~   15 (87)
                      +|..|+.+++||+++
T Consensus       176 va~v~~~~~vpfl~i  190 (233)
T PRK14697        176 IGHVAYINEVPFLVI  190 (233)
T ss_pred             HHHHHHHcCCCEEEE
Confidence            477899999999986


No 37 
>PF04223 CitF:  Citrate lyase, alpha subunit (CitF);  InterPro: IPR006472 These sequences, from both Gram-positive and Gram-negative bacteria, represent the alpha subunit of the holoenzyme citrate lyase composed of alpha (2.8.3.10 from EC), beta, and acyl carrier protein subunits in a stoichiometric relationship of 6:6:6. Citrate lyase is an enzyme which converts citrate to oxaloacetate. In bacteria, this reaction is involved in citrate fermentation. The alpha subunit catalyzes the reaction Acetyl-CoA + citrate = acetate + (3S)-citryl-CoA. The protein from Lactococcus lactis subsp. lactis (Streptococcus lactis) has been experimentally characterised [].; GO: 0008814 citrate CoA-transferase activity, 0006084 acetyl-CoA metabolic process, 0005737 cytoplasm, 0009346 citrate lyase complex; PDB: 2HJ0_B 1XR4_B.
Probab=30.21  E-value=18  Score=28.01  Aligned_cols=19  Identities=32%  Similarity=0.438  Sum_probs=13.3

Q ss_pred             eecCCCCccEEEeCCCCcC
Q psy6494          56 DYTPPQYITLLFTDLGILT   74 (87)
Q Consensus        56 D~tPp~lI~~~iTe~G~~~   74 (87)
                      =.||-|-|+.+|||.|+--
T Consensus       386 v~TPGetVDVlVTe~GIAV  404 (466)
T PF04223_consen  386 VTTPGETVDVLVTERGIAV  404 (466)
T ss_dssp             -SB-GGG--EEEETTEEEE
T ss_pred             EcCCCCceeEEEecCceee
Confidence            4689999999999999854


No 38 
>COG0775 Pfs Nucleoside phosphorylase [Nucleotide transport and metabolism]
Probab=29.92  E-value=18  Score=25.17  Aligned_cols=20  Identities=35%  Similarity=0.313  Sum_probs=15.1

Q ss_pred             CccccccCCCcEEEE-ccccc
Q psy6494           1 MAVCAKELKKPFYVL-AESFK   20 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~-a~~~K   20 (87)
                      ||.+|.++++|+.++ |-+.+
T Consensus       181 ia~v~~~~~vP~~~ir~ISD~  201 (234)
T COG0775         181 IAQVCYRFGVPFLVLRAISDI  201 (234)
T ss_pred             HHHHHHHhCCCEEEEEEeccC
Confidence            477899999999987 43433


No 39 
>TIGR01705 MTA/SAH-nuc-hyp 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase, putative. This enzyme is involved in the recycling of the components of S-adenosylmethionine after it has donated one of its two non-ribose sulfur ligands to an acceptor. In the case of 5'-methylthioadenosine this represents the first step of the methionine salvage pathway in bacteria. This enzyme is widely distributed in bacteria.
Probab=29.66  E-value=20  Score=24.99  Aligned_cols=15  Identities=13%  Similarity=0.135  Sum_probs=13.1

Q ss_pred             CccccccCCCcEEEE
Q psy6494           1 MAVCAKELKKPFYVL   15 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~   15 (87)
                      +|..|+.+++||.++
T Consensus       153 ia~vc~~~~vpf~~i  167 (212)
T TIGR01705       153 CLRACQLFDVPLIGL  167 (212)
T ss_pred             HHHHHHHcCCCEEEE
Confidence            477899999999986


No 40 
>PRK08236 hypothetical protein; Provisional
Probab=29.59  E-value=19  Score=24.72  Aligned_cols=15  Identities=27%  Similarity=0.224  Sum_probs=12.9

Q ss_pred             CccccccCCCcEEEE
Q psy6494           1 MAVCAKELKKPFYVL   15 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~   15 (87)
                      +|.+|..+++||.++
T Consensus       166 vA~vc~~~~vPf~~i  180 (212)
T PRK08236        166 VAEAAAAAGLPVLEL  180 (212)
T ss_pred             HHHHHHHhCCCEEEE
Confidence            477899999999987


No 41 
>PRK13401 30S ribosomal protein S18; Provisional
Probab=29.32  E-value=9.5  Score=22.82  Aligned_cols=24  Identities=25%  Similarity=0.468  Sum_probs=21.3

Q ss_pred             eeecCCCCccEEEeCCCCcCCchH
Q psy6494          55 VDYTPPQYITLLFTDLGILTPSAV   78 (87)
Q Consensus        55 fD~tPp~lI~~~iTe~G~~~p~~i   78 (87)
                      +||--.+++.-+|||.|-+-|.-+
T Consensus        26 iDYKnv~lL~~Fis~~GkIlpRR~   49 (82)
T PRK13401         26 VDYKDTALLRTFISDRGKIRSRRV   49 (82)
T ss_pred             CCccCHHHHHHhcCCCccCcCccc
Confidence            689999999999999999998643


No 42 
>PRK06714 S-adenosylhomocysteine nucleosidase; Validated
Probab=29.10  E-value=20  Score=25.00  Aligned_cols=17  Identities=35%  Similarity=0.467  Sum_probs=14.0

Q ss_pred             CccccccCCCcEEEEcc
Q psy6494           1 MAVCAKELKKPFYVLAE   17 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~   17 (87)
                      +|++|..+++||+++-.
T Consensus       177 vA~vc~~~~vP~l~IR~  193 (236)
T PRK06714        177 FAYVCQINKKPFLCLKA  193 (236)
T ss_pred             HHHHHHHhCCCEEEEEE
Confidence            47889999999998743


No 43 
>TIGR03468 HpnG hopanoid-associated phosphorylase. The sequences in this family are members of the pfam01048 family of phosphorylases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene. This gene is adjacent to the genes PhnA-E and squalene-hopene cyclase (which would be HpnF) in Zymomonas mobilis and their association with hopene biosynthesis has been noted in the literature. Extending the gene symbol sequence, we suggest the symbol HpnG for the product of this gene. Hopanoids are known to be components of the plasma membrane and to have polar sugar head groups in Z. mobilis and other species.
Probab=28.14  E-value=22  Score=24.21  Aligned_cols=17  Identities=29%  Similarity=0.350  Sum_probs=13.9

Q ss_pred             CccccccCCCcEEEEcc
Q psy6494           1 MAVCAKELKKPFYVLAE   17 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~   17 (87)
                      +|..|+++++||.++.-
T Consensus       137 va~va~~~gip~~~ir~  153 (212)
T TIGR03468       137 VAAVAAAAGLPFAVIRV  153 (212)
T ss_pred             HHHHHHHcCCCEEEEEE
Confidence            36789999999998743


No 44 
>PRK07164 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; Provisional
Probab=27.95  E-value=22  Score=24.58  Aligned_cols=16  Identities=25%  Similarity=0.360  Sum_probs=13.4

Q ss_pred             CccccccCCCcEEEEc
Q psy6494           1 MAVCAKELKKPFYVLA   16 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a   16 (87)
                      +|.+|+.+++||+++-
T Consensus       166 iaqv~~~~~vpf~~ir  181 (218)
T PRK07164        166 LAQVCFKNKVKFYCIK  181 (218)
T ss_pred             HHHHHHHcCCCEEEEE
Confidence            4788999999999863


No 45 
>TIGR01584 citF citrate lyase, alpha subunit. This is a model of the alpha subunit of the holoenzyme citrate lyase (EC 4.1.3.6) composed of alpha (EC 2.8.3.10), beta (EC 4.1.3.34), and acyl carrier protein subunits in a stoichiometric relationship of 6:6:6. Citrate lyase is an enzyme which converts citrate to oxaloacetate. In bacteria, this reaction is involved in citrate fermentation. The alpha subunit catalyzes the reaction Acetyl-CoA + citrate = acetate + (3S)-citryl-CoA. The seed contains an experimentally characterized member from Lactococcus lactis subsp. lactis. The model covers both Gram positive and Gram negative bacteria. It is quite robust with queries scoring either quite well or quite poorly against the model. There are currently no hits in between the noise cutoff and trusted cutoff.
Probab=27.55  E-value=29  Score=27.21  Aligned_cols=20  Identities=40%  Similarity=0.669  Sum_probs=17.4

Q ss_pred             eecCCCCccEEEeCCCCc-CC
Q psy6494          56 DYTPPQYITLLFTDLGIL-TP   75 (87)
Q Consensus        56 D~tPp~lI~~~iTe~G~~-~p   75 (87)
                      =.||-+-|+.+|||.|+. .|
T Consensus       409 VtTpr~~Vd~VVTEyGIAvnl  429 (492)
T TIGR01584       409 VITPGESIDVLVTEIGIAINP  429 (492)
T ss_pred             EECChhhCCEEEccCEEecCC
Confidence            468999999999999988 44


No 46 
>cd08769 DAP_dppA_2 Peptidase M55, D-aminopeptidase dipeptide-binding protein family. M55 Peptidase, D-Aminopeptidase dipeptide-binding protein (dppA; DAP dppA; EC 3.4.11.-) domain: Peptide transport systems are found in many bacterial species and generally function to accumulate intact peptides in the cell, where they are hydrolyzed. The dipeptide-binding protein (dppA) of Bacillus subtilis belongs to the dipeptide ABC transport (dpp) operon expressed early during sporulation. It is a binuclear zinc-dependent, D-specific aminopeptidase. The biologically active enzyme is a homodecamer with active sites buried in its channel. These self-compartmentalizing proteases are characterized by a SXDXEG motif. D-Ala-D-Ala and D-Ala-Gly-Gly are the preferred substrates. Bacillus subtilis dppA is thought to function as an adaptation to nutrient deficiency; hydrolysis of its substrate releases D-Ala which can be used subsequently as metabolic fuel. This family also contains a number of uncharacteriz
Probab=27.30  E-value=19  Score=25.95  Aligned_cols=23  Identities=22%  Similarity=0.245  Sum_probs=19.3

Q ss_pred             ccccccCCCcEEEEcccccCccC
Q psy6494           2 AVCAKELKKPFYVLAESFKFVRL   24 (87)
Q Consensus         2 A~~Ak~~~vPv~v~a~~~K~~~~   24 (87)
                      |.+|-++||||..+++--+++..
T Consensus       140 a~~Ag~~gVPV~lVsGDd~~~~e  162 (270)
T cd08769         140 AAYAGEFGVPVVLVAGDSELEKE  162 (270)
T ss_pred             HHHHhhcCCCEEEEecCHHHHHH
Confidence            56889999999999998777653


No 47 
>cd08770 DAP_dppA_3 Peptidase M55, D-aminopeptidase dipeptide-binding protein family. M55 Peptidase, D-Aminopeptidase dipeptide-binding protein (dppA; DAP dppA; EC 3.4.11.-) domain: Peptide transport systems are found in many bacterial species and generally function to accumulate intact peptides in the cell, where they are hydrolyzed. The dipeptide-binding protein (dppA) of Bacillus subtilis belongs to the dipeptide ABC transport (dpp) operon expressed early during sporulation. It is a binuclear zinc-dependent, D-specific aminopeptidase. The biologically active enzyme is a homodecamer with active sites buried in its channel. These self-compartmentalizing proteases are characterized by a SXDXEG motif. D-Ala-D-Ala and D-Ala-Gly-Gly are the preferred substrates. Bacillus subtilis dppA is thought to function as an adaptation to nutrient deficiency; hydrolysis of its substrate releases D-Ala which can be used subsequently as metabolic fuel. This family also contains a number of uncharacteriz
Probab=26.36  E-value=20  Score=25.77  Aligned_cols=22  Identities=18%  Similarity=0.132  Sum_probs=19.3

Q ss_pred             ccccccCCCcEEEEcccccCcc
Q psy6494           2 AVCAKELKKPFYVLAESFKFVR   23 (87)
Q Consensus         2 A~~Ak~~~vPv~v~a~~~K~~~   23 (87)
                      |.+|-++||||..+++--+++.
T Consensus       140 a~~Ag~~gVPV~lvsGD~~~~~  161 (263)
T cd08770         140 AYTAAYLGVPVVFVSGDAGLCA  161 (263)
T ss_pred             HHHHhhcCCCEEEEecCHHHHH
Confidence            5688999999999999888876


No 48 
>TIGR02428 pcaJ_scoB_fam 3-oxoacid CoA-transferase, B subunit. Various members of this family are characterized as the B subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by Pfam model pfam01144. The A subunit represents a different clade in pfam01144.
Probab=26.34  E-value=36  Score=23.35  Aligned_cols=18  Identities=17%  Similarity=0.338  Sum_probs=15.4

Q ss_pred             ecCCCCccEEEeCCCCcC
Q psy6494          57 YTPPQYITLLFTDLGILT   74 (87)
Q Consensus        57 ~tPp~lI~~~iTe~G~~~   74 (87)
                      .|++..+..+|||.|++.
T Consensus       160 ~t~~~~v~~vVTe~gV~~  177 (207)
T TIGR02428       160 LTGAGCVDRIVTELAVFE  177 (207)
T ss_pred             cCCCCcccEEECCCEEEE
Confidence            678888899999999964


No 49 
>cd08663 DAP_dppA_1 Peptidase M55, D-aminopeptidase dipeptide-binding protein family. M55 Peptidase, D-Aminopeptidase dipeptide-binding protein (dppA; DAP dppA; EC 3.4.11.-) domain: Peptide transport systems are found in many bacterial species and generally function to accumulate intact peptides in the cell, where they are hydrolyzed. The dipeptide-binding protein (dppA) of Bacillus subtilis belongs to the dipeptide ABC transport (dpp) operon expressed early during sporulation. It is a binuclear zinc-dependent, D-specific aminopeptidase. The biologically active enzyme is a homodecamer with active sites buried in its channel. These self-compartmentalizing proteases are characterized by a SXDXEG motif. D-Ala-D-Ala and D-Ala-Gly-Gly are the preferred substrates. Bacillus subtilis dppA is thought to function as an adaptation to nutrient deficiency; hydrolysis of its substrate releases D-Ala which can be used subsequently as metabolic fuel. This family also contains a number of uncharacteriz
Probab=26.17  E-value=21  Score=25.74  Aligned_cols=22  Identities=18%  Similarity=0.113  Sum_probs=19.4

Q ss_pred             ccccccCCCcEEEEcccccCcc
Q psy6494           2 AVCAKELKKPFYVLAESFKFVR   23 (87)
Q Consensus         2 A~~Ak~~~vPv~v~a~~~K~~~   23 (87)
                      |.+|-++||||..+++--+++.
T Consensus       140 a~~Ag~~gVPV~lVsGDd~~~~  161 (266)
T cd08663         140 AAVAGEYGVPVVLVTGDDAACA  161 (266)
T ss_pred             HHHHhhcCCCEEEEecCHHHHH
Confidence            5688999999999999888876


No 50 
>PF02639 DUF188:  Uncharacterized BCR, YaiI/YqxD family COG1671;  InterPro: IPR003791 This entry describes proteins of unknown function.
Probab=26.08  E-value=31  Score=22.11  Aligned_cols=21  Identities=19%  Similarity=0.107  Sum_probs=16.2

Q ss_pred             cccccCCCcEEEEcccccCcc
Q psy6494           3 VCAKELKKPFYVLAESFKFVR   23 (87)
Q Consensus         3 ~~Ak~~~vPv~v~a~~~K~~~   23 (87)
                      .+|+++++|++++|...=..+
T Consensus         4 ~~a~r~~i~vi~Van~~h~~~   24 (130)
T PF02639_consen    4 RVAKRYGIPVIFVANYSHRLP   24 (130)
T ss_pred             HHHHHHCCEEEEEeCCCccCC
Confidence            479999999999987544443


No 51 
>PRK00391 rpsR 30S ribosomal protein S18; Reviewed
Probab=25.98  E-value=10  Score=22.50  Aligned_cols=26  Identities=15%  Similarity=0.489  Sum_probs=22.7

Q ss_pred             eeeecCCCCccEEEeCCCCcCCchHH
Q psy6494          54 LVDYTPPQYITLLFTDLGILTPSAVS   79 (87)
Q Consensus        54 ~fD~tPp~lI~~~iTe~G~~~p~~i~   79 (87)
                      .+||--.++++-+|||.|-+-|..+.
T Consensus        26 ~iDYKnv~lL~~Fis~~GkIlprriT   51 (79)
T PRK00391         26 YIDYKDVELLKKFISERGKILPRRIT   51 (79)
T ss_pred             cCCccCHHHHHHhcCCCceEcCcccC
Confidence            48999999999999999999997543


No 52 
>cd00281 DAP_dppA Peptidase M55, D-aminopeptidase dipeptide-binding protein family. M55 Peptidase, D-Aminopeptidase dipeptide-binding protein (dppA; DAP dppA; EC 3.4.11.-) domain: Peptide transport systems are found in many bacterial species and generally function to accumulate intact peptides in the cell, where they are hydrolyzed. The dipeptide-binding protein (dppA) of Bacillus subtilis belongs to the dipeptide ABC transport (dpp) operon expressed early during sporulation. It is a binuclear zinc-dependent, D-specific aminopeptidase. The biologically active enzyme is a homodecamer with active sites buried in its channel. These self-compartmentalizing proteases are characterized by a SXDXEG motif. D-Ala-D-Ala and D-Ala-Gly-Gly are the preferred substrates. Bacillus subtilis dppA is thought to function as an adaptation to nutrient deficiency; hydrolysis of its substrate releases D-Ala which can be used subsequently as metabolic fuel. This family also contains a number of uncharacterized
Probab=25.69  E-value=21  Score=25.71  Aligned_cols=22  Identities=18%  Similarity=0.203  Sum_probs=19.3

Q ss_pred             ccccccCCCcEEEEcccccCcc
Q psy6494           2 AVCAKELKKPFYVLAESFKFVR   23 (87)
Q Consensus         2 A~~Ak~~~vPv~v~a~~~K~~~   23 (87)
                      |.+|-++||||..+++--+++.
T Consensus       139 a~~Ag~~gVPV~lvsGDd~~~~  160 (265)
T cd00281         139 ALTAGYYGVPVVMVAGDAEVCK  160 (265)
T ss_pred             HHHHhhcCCCEEEEecCHHHHH
Confidence            5688999999999999888876


No 53 
>PHA02610 uvsY.-2 hypothetical protein; Provisional
Probab=25.08  E-value=1e+02  Score=16.86  Aligned_cols=27  Identities=19%  Similarity=0.261  Sum_probs=19.9

Q ss_pred             CCCCccEEEeCCCCcCCchHHHHHHHh
Q psy6494          59 PPQYITLLFTDLGILTPSAVSDELIKL   85 (87)
Q Consensus        59 Pp~lI~~~iTe~G~~~p~~i~~~l~~~   85 (87)
                      |-+=-..+.||.|..-|...+..+.++
T Consensus        10 Pi~~al~v~T~~Gpvh~g~C~~y~~e~   36 (53)
T PHA02610         10 PIEKALVVETEKGPVHPGPCYNYVEEL   36 (53)
T ss_pred             chhhceEEecCCCCCCChhHHHHHHhc
Confidence            334456789999999998877776654


No 54 
>TIGR03664 fut_nucase futalosine nucleosidase. This enzyme catalyzes the conversion of futalosine to de-hypoxanthine futalosine in a pathway for the biosynthesis of menaquinone distinct from the pathway observed in E. coli.
Probab=24.23  E-value=27  Score=23.96  Aligned_cols=17  Identities=29%  Similarity=0.383  Sum_probs=13.8

Q ss_pred             CccccccCCCcEEEEcc
Q psy6494           1 MAVCAKELKKPFYVLAE   17 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~   17 (87)
                      +|..|+.+++|+.++-.
T Consensus       176 va~va~~~~vP~~~IR~  192 (222)
T TIGR03664       176 VALAALRYGVPFLELRG  192 (222)
T ss_pred             HHHHHHHhCCCEEEEEe
Confidence            46789999999998843


No 55 
>PF03796 DnaB_C:  DnaB-like helicase C terminal domain;  InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis. ; GO: 0003678 DNA helicase activity, 0005524 ATP binding, 0006260 DNA replication; PDB: 1Q57_E 1E0K_D 1E0J_B 1CR2_A 1CR4_A 1CR1_A 1CR0_A 1MI8_A 2R6D_B 2R6C_C ....
Probab=22.91  E-value=18  Score=24.96  Aligned_cols=20  Identities=30%  Similarity=0.303  Sum_probs=16.6

Q ss_pred             cccccCCCcEEEEcccccCc
Q psy6494           3 VCAKELKKPFYVLAESFKFV   22 (87)
Q Consensus         3 ~~Ak~~~vPv~v~a~~~K~~   22 (87)
                      .+|+++++|+++++..-+-.
T Consensus       164 ~lA~~~~i~vi~~sQlnr~~  183 (259)
T PF03796_consen  164 ALAKELNIPVIALSQLNREA  183 (259)
T ss_dssp             HHHHHHTSEEEEEEEBSGGG
T ss_pred             HHHHHcCCeEEEccccChhh
Confidence            57999999999999866554


No 56 
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated
Probab=22.55  E-value=32  Score=26.01  Aligned_cols=15  Identities=27%  Similarity=0.355  Sum_probs=12.9

Q ss_pred             CccccccCCCcEEEE
Q psy6494           1 MAVCAKELKKPFYVL   15 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~   15 (87)
                      +|+.|+.+++||+++
T Consensus       176 va~va~~~~vp~~~i  190 (459)
T PRK06698        176 IGHVAYINEVPFLVI  190 (459)
T ss_pred             HHHHHHHcCCCEEEE
Confidence            477899999999986


No 57 
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism]
Probab=21.87  E-value=30  Score=26.54  Aligned_cols=15  Identities=27%  Similarity=0.200  Sum_probs=12.7

Q ss_pred             CccccccCCCcEEEE
Q psy6494           1 MAVCAKELKKPFYVL   15 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~   15 (87)
                      ||..||++|+|++|=
T Consensus       169 ia~iAh~~gvpliVD  183 (426)
T COG2873         169 IAEIAHRHGVPLIVD  183 (426)
T ss_pred             HHHHHHHcCCcEEEe
Confidence            467899999999974


No 58 
>PRK06739 pyruvate kinase; Validated
Probab=21.32  E-value=35  Score=25.56  Aligned_cols=16  Identities=0%  Similarity=-0.147  Sum_probs=13.7

Q ss_pred             cccccCCCcEEEEccc
Q psy6494           3 VCAKELKKPFYVLAES   18 (87)
Q Consensus         3 ~~Ak~~~vPv~v~a~~   18 (87)
                      ..|+++|+||++++..
T Consensus       258 ~~c~~~gkPvIvATqm  273 (352)
T PRK06739        258 QECNRTNTYVITATQM  273 (352)
T ss_pred             HHHHHhCCCEEEEcch
Confidence            4688999999999874


No 59 
>COG2057 AtoA Acyl CoA:acetate/3-ketoacid CoA transferase, beta subunit [Lipid metabolism]
Probab=21.12  E-value=45  Score=23.58  Aligned_cols=22  Identities=18%  Similarity=0.255  Sum_probs=16.8

Q ss_pred             eeecCCCCccEEEeCCCCcCCc
Q psy6494          55 VDYTPPQYITLLFTDLGILTPS   76 (87)
Q Consensus        55 fD~tPp~lI~~~iTe~G~~~p~   76 (87)
                      +=.|....++.+|||+|++...
T Consensus       163 lplt~~~~v~~iiTdl~V~~~~  184 (225)
T COG2057         163 LPLTGNGCVDRVITDLAVFEFD  184 (225)
T ss_pred             ccccCCCCceEEEeccEEEEec
Confidence            3456677789999999988754


No 60 
>PF04951 Peptidase_M55:  D-aminopeptidase;  InterPro: IPR007035 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M55 (DppA aminopeptidase family, clan MN). The type example is Bacillus subtilis DppA, which is a binuclear zinc-dependent, D-specific aminopeptidase. The structure reveals that DppA is a new example of a self-compartmentalising protease, a family of proteolytic complexes. Proteasomes are the most extensively studied representatives of this family. The DppA enzyme is composed of identical 30 kDa subunits organised in a decamer with 52 point-group symmetry. A 20 A wide channel runs through the complex, giving access to a central chamber holding the active sites. The structure shows DppA to be a prototype of a new family of metalloaminopeptidases characterised by the SXDXEG key sequence []. The only known substrates are D-ala-D-ala and D-ala-gly-gly.; PDB: 1HI9_A.
Probab=20.95  E-value=35  Score=24.56  Aligned_cols=23  Identities=13%  Similarity=0.039  Sum_probs=17.4

Q ss_pred             ccccccCCCcEEEEcccccCccC
Q psy6494           2 AVCAKELKKPFYVLAESFKFVRL   24 (87)
Q Consensus         2 A~~Ak~~~vPv~v~a~~~K~~~~   24 (87)
                      |++|-++||||..+++--+++..
T Consensus       140 a~~Ag~~GVPV~lVsGD~~l~~e  162 (265)
T PF04951_consen  140 AALAGYYGVPVVLVSGDDALCEE  162 (265)
T ss_dssp             HHHHHHTT--EEEEEEEHHHHHH
T ss_pred             HHHHhhcCCcEEEEeCcHHHHHH
Confidence            57889999999999988777654


No 61 
>PRK07004 replicative DNA helicase; Provisional
Probab=20.73  E-value=32  Score=26.40  Aligned_cols=18  Identities=33%  Similarity=0.388  Sum_probs=15.3

Q ss_pred             cccccCCCcEEEEccccc
Q psy6494           3 VCAKELKKPFYVLAESFK   20 (87)
Q Consensus         3 ~~Ak~~~vPv~v~a~~~K   20 (87)
                      .+||++++||+++|..-+
T Consensus       358 ~lAkel~ipVi~lsQLnR  375 (460)
T PRK07004        358 SLAKELDVPVIALSQLNR  375 (460)
T ss_pred             HHHHHhCCeEEEEeccCh
Confidence            579999999999997544


No 62 
>PF05014 Nuc_deoxyrib_tr:  Nucleoside 2-deoxyribosyltransferase;  InterPro: IPR007710 Nucleoside 2-deoxyribosyltransferase (2.4.2.6 from EC) catalyses the cleavage of the glycosidic bonds of 2-deoxyribonucleosides. Nucleoside 2-deoxyribosyltransferases can be divided into two groups based on their substrate specificity: class I enzymes are specific for the transfer of deoxyribose between two purines, while class II enzymes will transfer the deoxyribose between either purines or pyrimidines. The structure of the class I [] and class II [] enzymes are very similar. In class I enzymes, the purine base shields the active site from solvent, which the smaller pyrimidine base cannot do, while in class II enzymes the active site is shielded by a loop (residues 48-62). Both classes of enzymes are found in various Lactobacillus species and participate in nucleoside recycling in these microorganisms. This entry represents both classes of enzymes.; GO: 0050144 nucleoside deoxyribosyltransferase activity, 0070694 deoxyribonucleoside 5'-monophosphate N-glycosidase activity, 0009159 deoxyribonucleoside monophosphate catabolic process; PDB: 1S2L_A 1S2D_C 1S2I_A 1S3F_B 1S2G_C 2A0K_A 2F67_A 2F64_B 2F62_A 2F2T_A ....
Probab=20.46  E-value=60  Score=19.49  Aligned_cols=17  Identities=35%  Similarity=0.360  Sum_probs=13.8

Q ss_pred             cccCCCcEEEEcccccC
Q psy6494           5 AKELKKPFYVLAESFKF   21 (87)
Q Consensus         5 Ak~~~vPv~v~a~~~K~   21 (87)
                      |.+.|+|++++++..+-
T Consensus        85 A~algkpv~~~~~d~~~  101 (113)
T PF05014_consen   85 AYALGKPVILLTEDDRP  101 (113)
T ss_dssp             HHHTTSEEEEEECCCCT
T ss_pred             HHHCCCEEEEEEcCCcc
Confidence            66789999999877655


No 63 
>PRK05584 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; Validated
Probab=20.24  E-value=38  Score=22.93  Aligned_cols=17  Identities=29%  Similarity=0.499  Sum_probs=13.6

Q ss_pred             CccccccCCCcEEEEcc
Q psy6494           1 MAVCAKELKKPFYVLAE   17 (87)
Q Consensus         1 iA~~Ak~~~vPv~v~a~   17 (87)
                      +|.+|+.+++|+.++-.
T Consensus       178 ~a~va~~~~vp~~~ir~  194 (230)
T PRK05584        178 IAQVCHEFGVPFVVVRA  194 (230)
T ss_pred             HHHHHHHcCCCEEEEEE
Confidence            36789999999998744


No 64 
>COG2362 DppA D-aminopeptidase [Amino acid transport and metabolism]
Probab=20.00  E-value=56  Score=23.70  Aligned_cols=21  Identities=19%  Similarity=0.056  Sum_probs=17.2

Q ss_pred             ccccccCCCcEEEEcccccCc
Q psy6494           2 AVCAKELKKPFYVLAESFKFV   22 (87)
Q Consensus         2 A~~Ak~~~vPv~v~a~~~K~~   22 (87)
                      |++|-++||||.++++-.-+.
T Consensus       139 a~laG~ygVPV~~~sGDd~~~  159 (274)
T COG2362         139 AYLAGEYGVPVALVSGDDVAA  159 (274)
T ss_pred             HHHhhccCCcEEEeeCcHHHh
Confidence            678999999999998866443


Done!