Diaphorina citri psyllid: psy6494


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKKENLSKYHPLVDYTPPQYITLLFTDLGILTPSAVSDELIKLYL
cccHHHHccccEEEEcccccccccCCccccccccccccccccccccccccccccCCccccccccEEEEcccccccHHHHHHHHHHHc
MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKKENLSKYHPLVDYTPPQYITLLFTDLGILTPSAVSDELIKLYL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVCAKELKKPFYVLAESFKFVRLYPLNQRDLPNEFKFTSSILKKENLSKYHPLVDYTPPQYITLLFTDLGILTPSAVSDELIKLYL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Translation initiation factor eIF-2B subunit alpha Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.confidentQ0IIF2
Translation initiation factor eIF-2B subunit alpha Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.confidentQ5RAR0
Translation initiation factor eIF-2B subunit alpha Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.confidentQ99LC8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006446 [BP]regulation of translational initiationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0006417, GO:0008150, GO:0010468
GO:0019003 [MF]GDP bindingprobableGO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0043434 [BP]response to peptide hormone stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0010033
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005085 [MF]guanyl-nucleotide exchange factor activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0003674
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0005851 [CC]eukaryotic translation initiation factor 2B complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0003743 [MF]translation initiation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0009408 [BP]response to heatprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0009749 [BP]response to glucose stimulusprobableGO:0009746, GO:1901700, GO:0009743, GO:0034284, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006413 [BP]translational initiationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ECS, chain A
Confidence level:very confident
Coverage over the Query: 2-87
View the alignment between query and template
View the model in PyMOL