Diaphorina citri psyllid: psy6501


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
NAGTNKQPGTTKNTAKLDRETEELKHEKVPLDLAKLLMQGRQAKGWSQKDLATKINEKPQIVNDYEGGRGIPNQAIIGKMERALGIRLRVNAGTNKQPGTTKNTAKLDRETEELKHEKVPLDLAKLLMQGRQAKGWSQKDLATKINEKPQIVNDYEGGRGIPNQAIIGKMERAL
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHcccccccHHHHHHHHHHc
********************TEELKHEKVPLDLAKLLMQGRQAKGWSQKDLATKINEKPQIVNDYEGGRGIPNQAIIGKMERALGIRLRVNAGTNKQPGTTKNTAKLDRETEELKHEKVPLDLAKLLMQGRQAKGWSQKDLATKINEKPQIVNDYEGGRGIPNQAIIGKMERAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAGTNKQPGTTKNTAKLDRETEELKHEKVPLDLAKLLMQGRQAKGWSQKDLATKINEKPQIVNDYEGGRGIPNQAIIGKMERALGIRLRVNAGTNKQPGTTKNTAKLDRETEELKHEKVPLDLAKLLMQGRQAKGWSQKDLATKINEKPQIVNDYEGGRGIPNQAIIGKMERAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Multiprotein-bridging factor 1 Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators.confidentQ752P7
Multiprotein-bridging factor 1 Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators.confidentO94700
Endothelial differentiation-related factor 1 homolog Probable transcriptional coactivator.confidentQ5ZMC0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043388 [BP]positive regulation of DNA bindingprobableGO:0051099, GO:0051098, GO:0051101, GO:0065007, GO:0044093, GO:0008150, GO:0065009
GO:0008168 [MF]methyltransferase activityprobableGO:0003824, GO:0016740, GO:0016741, GO:0003674
GO:0005669 [CC]transcription factor TFIID complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0030674 [MF]protein binding, bridgingprobableGO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004402 [MF]histone acetyltransferase activityprobableGO:0008080, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JVL, chain A
Confidence level:very confident
Coverage over the Query: 10-92
View the alignment between query and template
View the model in PyMOL
Template: 2JVL, chain A
Confidence level:very confident
Coverage over the Query: 103-174
View the alignment between query and template
View the model in PyMOL