Query         psy6525
Match_columns 360
No_of_seqs    475 out of 2584
Neff          10.2
Searched_HMMs 46136
Date          Fri Aug 16 20:18:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6525.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6525hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3608|consensus              100.0 1.9E-28 4.1E-33  206.7  14.4  247   99-347    69-378 (467)
  2 KOG2462|consensus              100.0 6.6E-30 1.4E-34  210.4   5.4  131  184-315   130-264 (279)
  3 KOG1074|consensus              100.0 4.5E-30 9.7E-35  238.3   4.7  191  157-347   606-933 (958)
  4 KOG2462|consensus              100.0 3.4E-29 7.3E-34  206.2   6.4  130  211-342   130-264 (279)
  5 KOG3608|consensus               99.9 7.2E-27 1.6E-31  197.2  12.3  230  129-360    69-364 (467)
  6 KOG1074|consensus               99.9 7.1E-28 1.5E-32  223.8   2.4  175  185-359   606-918 (958)
  7 KOG3623|consensus               99.9 2.3E-25   5E-30  203.9   8.4  107  100-206   211-331 (1007)
  8 KOG3623|consensus               99.9 9.2E-23   2E-27  187.0   6.4  104  129-232   210-330 (1007)
  9 KOG3576|consensus               99.8 2.5E-19 5.5E-24  140.4   3.6  110  238-347   117-238 (267)
 10 KOG3576|consensus               99.7   3E-17 6.4E-22  128.9   2.5  109  211-319   117-237 (267)
 11 PLN03086 PRLI-interacting fact  99.5   1E-13 2.2E-18  129.0   8.4  145  184-344   407-563 (567)
 12 PLN03086 PRLI-interacting fact  99.4 4.3E-13 9.3E-18  124.9   6.3  133  211-359   407-552 (567)
 13 PHA00733 hypothetical protein   99.3 3.7E-12 8.1E-17   97.1   4.5   82  264-346    38-124 (128)
 14 PHA00733 hypothetical protein   99.0 1.7E-10 3.7E-15   88.0   3.8   80  238-319    40-124 (128)
 15 PHA02768 hypothetical protein;  99.0 1.4E-10   3E-15   72.5   1.5   42  295-337     6-47  (55)
 16 KOG3993|consensus               99.0 7.3E-11 1.6E-15  103.3  -0.8   49  130-178   268-317 (500)
 17 KOG3993|consensus               98.9   2E-10 4.3E-15  100.6  -1.2  189   99-289   267-481 (500)
 18 PHA02768 hypothetical protein;  98.9 6.5E-10 1.4E-14   69.5   1.3   42  267-310     6-47  (55)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.7   1E-08 2.2E-13   54.8   1.4   24  282-305     2-25  (26)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.5 6.9E-08 1.5E-12   51.5   2.2   26  253-278     1-26  (26)
 21 PHA00616 hypothetical protein   98.4   9E-08 1.9E-12   56.9   1.5   25  295-319     2-26  (44)
 22 PHA00616 hypothetical protein   98.4 1.9E-07 4.1E-12   55.5   2.4   33  266-298     1-33  (44)
 23 PHA00732 hypothetical protein   98.4 1.5E-07 3.3E-12   64.9   2.2   47  266-318     1-48  (79)
 24 PF05605 zf-Di19:  Drought indu  98.3 7.8E-07 1.7E-11   57.0   4.0   50  294-346     2-54  (54)
 25 PHA00732 hypothetical protein   98.3 4.6E-07   1E-11   62.5   2.1   36  295-332     2-38  (79)
 26 PF00096 zf-C2H2:  Zinc finger,  98.0 3.2E-06 6.9E-11   43.7   1.9   23  322-344     1-23  (23)
 27 PF12756 zf-C2H2_2:  C2H2 type   97.9 5.2E-06 1.1E-10   61.0   2.4   71  269-343     2-72  (100)
 28 PF05605 zf-Di19:  Drought indu  97.9 1.5E-05 3.2E-10   51.0   4.1   49  100-151     3-51  (54)
 29 PF00096 zf-C2H2:  Zinc finger,  97.8 8.2E-06 1.8E-10   42.2   1.4   22  295-316     1-22  (23)
 30 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.8E-05 3.8E-10   41.3   2.1   24  322-345     1-24  (24)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.7 2.7E-05 5.7E-10   57.2   2.7   22  159-180     2-23  (100)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.6 2.7E-05 5.9E-10   42.0   1.5   25  321-345     1-25  (27)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.6 3.8E-05 8.2E-10   40.0   1.8   23  295-317     1-23  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.5 4.6E-05 9.9E-10   41.1   1.2   25  294-318     1-25  (27)
 35 COG5189 SFP1 Putative transcri  97.4 4.2E-05 9.1E-10   65.3   0.4   27  154-180   347-375 (423)
 36 KOG1146|consensus               97.3 4.1E-05 8.9E-10   77.3  -0.6   50  293-342   733-790 (1406)
 37 COG5189 SFP1 Putative transcri  97.3 6.1E-05 1.3E-09   64.3   0.2   51  292-342   347-419 (423)
 38 KOG2231|consensus               97.1   0.001 2.2E-08   63.9   6.1   23  158-181   117-139 (669)
 39 smart00355 ZnF_C2H2 zinc finge  97.0 0.00051 1.1E-08   36.2   2.2   24  322-345     1-24  (26)
 40 KOG2231|consensus               97.0  0.0017 3.6E-08   62.4   6.8   97  108-215   123-240 (669)
 41 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00053 1.1E-08   35.6   1.6   24  322-346     1-24  (24)
 42 smart00355 ZnF_C2H2 zinc finge  96.8  0.0011 2.4E-08   34.9   2.4   23  295-317     1-23  (26)
 43 PF09237 GAGA:  GAGA factor;  I  96.8 0.00062 1.3E-08   41.5   1.1   28  320-347    23-50  (54)
 44 COG5236 Uncharacterized conser  96.7  0.0021 4.5E-08   55.9   4.2  127   99-236   151-306 (493)
 45 PF12874 zf-met:  Zinc-finger o  96.5  0.0013 2.9E-08   34.4   1.4   22  322-343     1-22  (25)
 46 PRK04860 hypothetical protein;  96.4  0.0016 3.5E-08   51.7   1.8   34  321-358   119-153 (160)
 47 PF09237 GAGA:  GAGA factor;  I  96.4  0.0025 5.5E-08   38.9   2.2   19  296-314    26-44  (54)
 48 KOG2785|consensus               96.4  0.0086 1.9E-07   53.1   6.4   23  129-151     3-25  (390)
 49 PF13909 zf-H2C2_5:  C2H2-type   96.4  0.0021 4.4E-08   33.4   1.5   23  295-318     1-23  (24)
 50 PF12874 zf-met:  Zinc-finger o  96.2  0.0025 5.5E-08   33.3   1.3   20  296-315     2-21  (25)
 51 PRK04860 hypothetical protein;  96.1  0.0029 6.2E-08   50.2   1.7   26  279-304   128-153 (160)
 52 KOG2785|consensus               96.1   0.018 3.9E-07   51.1   6.7   50  294-343   166-242 (390)
 53 KOG2482|consensus               95.8   0.012 2.5E-07   51.3   4.0  137   98-234   143-357 (423)
 54 COG5236 Uncharacterized conser  95.7   0.021 4.6E-07   49.8   5.3  127  156-288   151-303 (493)
 55 PF12171 zf-C2H2_jaz:  Zinc-fin  95.6  0.0034 7.5E-08   33.6   0.0   21  322-342     2-22  (27)
 56 PF12171 zf-C2H2_jaz:  Zinc-fin  95.5  0.0054 1.2E-07   32.8   0.8   22  267-288     2-23  (27)
 57 KOG2482|consensus               95.3   0.062 1.3E-06   47.0   6.8  147  114-261   130-357 (423)
 58 PF13913 zf-C2HC_2:  zinc-finge  94.8   0.025 5.3E-07   29.6   1.9   21  322-343     3-23  (25)
 59 KOG1146|consensus               94.6   0.004 8.6E-08   63.6  -2.6   24  210-233   517-540 (1406)
 60 PF13913 zf-C2HC_2:  zinc-finge  93.7   0.051 1.1E-06   28.4   1.6   18  268-286     4-21  (25)
 61 COG5048 FOG: Zn-finger [Genera  93.3   0.014   3E-07   55.0  -1.5  116  238-353   289-451 (467)
 62 smart00451 ZnF_U1 U1-like zinc  93.0   0.066 1.4E-06   30.4   1.6   22  321-342     3-24  (35)
 63 KOG4173|consensus               92.5    0.13 2.7E-06   41.7   3.0   78   98-180    78-170 (253)
 64 smart00451 ZnF_U1 U1-like zinc  92.4   0.085 1.8E-06   30.0   1.5   23  294-316     3-25  (35)
 65 COG5048 FOG: Zn-finger [Genera  91.8   0.026 5.7E-07   53.0  -1.8   49  272-320   394-444 (467)
 66 KOG2893|consensus               91.7    0.06 1.3E-06   44.5   0.5   42  158-203    12-53  (341)
 67 KOG4173|consensus               89.9    0.12 2.6E-06   41.9   0.6   76  157-235    80-170 (253)
 68 cd00350 rubredoxin_like Rubred  89.8    0.17 3.7E-06   28.4   1.0    6  241-246     4-9   (33)
 69 TIGR00622 ssl1 transcription f  89.4    0.35 7.7E-06   35.6   2.7   48  297-345    58-105 (112)
 70 PF12013 DUF3505:  Protein of u  89.1    0.59 1.3E-05   34.7   3.8   25  322-346    81-109 (109)
 71 KOG2893|consensus               88.9    0.11 2.3E-06   43.1  -0.3   46  132-180    13-58  (341)
 72 TIGR00622 ssl1 transcription f  88.7    0.39 8.4E-06   35.4   2.5   17  129-145    15-31  (112)
 73 PF12013 DUF3505:  Protein of u  88.3    0.75 1.6E-05   34.1   3.9   25  295-319    81-109 (109)
 74 KOG2186|consensus               87.1    0.37 8.1E-06   40.5   1.7   46  295-342     4-49  (276)
 75 COG4049 Uncharacterized protei  84.4    0.69 1.5E-05   28.9   1.5   27  290-316    13-39  (65)
 76 COG4049 Uncharacterized protei  84.0    0.45 9.7E-06   29.7   0.6   27  321-347    17-43  (65)
 77 PF09538 FYDLN_acid:  Protein o  82.3     0.8 1.7E-05   33.7   1.5   11  130-140    10-20  (108)
 78 KOG2186|consensus               82.1    0.75 1.6E-05   38.8   1.4   46  185-232     4-49  (276)
 79 cd00729 rubredoxin_SM Rubredox  79.4    0.94   2E-05   25.6   0.8    6  241-246     5-10  (34)
 80 PF10571 UPF0547:  Uncharacteri  78.2     1.4 3.1E-05   23.1   1.2    8  241-248    17-24  (26)
 81 COG2888 Predicted Zn-ribbon RN  77.1     1.8 3.9E-05   27.6   1.6   32  294-329    27-58  (61)
 82 PF09986 DUF2225:  Uncharacteri  76.6    0.34 7.3E-06   40.8  -2.3   42  293-334     4-61  (214)
 83 TIGR00373 conserved hypothetic  75.6     3.8 8.2E-05   32.7   3.6   17  184-200   109-125 (158)
 84 COG1592 Rubrerythrin [Energy p  74.9     1.8 3.9E-05   34.5   1.5   11  263-273   146-156 (166)
 85 smart00531 TFIIE Transcription  74.6     2.1 4.6E-05   33.6   1.9   14  294-307    99-112 (147)
 86 PF09538 FYDLN_acid:  Protein o  73.8     2.5 5.4E-05   31.2   1.9   11  266-276    26-36  (108)
 87 TIGR00373 conserved hypothetic  73.0     2.9 6.3E-05   33.3   2.3   30  293-330   108-137 (158)
 88 PF06524 NOA36:  NOA36 protein;  72.8     1.2 2.5E-05   37.8   0.0   26  292-317   207-232 (314)
 89 PF13717 zinc_ribbon_4:  zinc-r  72.3     3.3 7.1E-05   23.7   1.8   33  100-139     3-35  (36)
 90 smart00659 RPOLCX RNA polymera  72.2       2 4.4E-05   25.9   1.0   25  295-329     3-27  (44)
 91 PF13719 zinc_ribbon_5:  zinc-r  71.4     2.3 4.9E-05   24.5   1.0    6  268-273    27-32  (37)
 92 PF02892 zf-BED:  BED zinc fing  71.4     2.8   6E-05   25.2   1.5   20  322-341    17-40  (45)
 93 PRK00464 nrdR transcriptional   71.1    0.83 1.8E-05   36.1  -1.1   12  267-278    29-40  (154)
 94 smart00614 ZnF_BED BED zinc fi  70.9     3.3 7.1E-05   25.7   1.8   10  296-305    20-29  (50)
 95 PF09986 DUF2225:  Uncharacteri  70.8       1 2.2E-05   37.9  -0.8   43  265-307     4-61  (214)
 96 smart00734 ZnF_Rad18 Rad18-lik  70.0     3.8 8.3E-05   21.5   1.6   19  323-342     3-21  (26)
 97 COG1592 Rubrerythrin [Energy p  69.8     2.7 5.8E-05   33.6   1.4   24  266-302   134-157 (166)
 98 KOG2272|consensus               69.7     4.6  0.0001   34.1   2.8  125  154-280    97-235 (332)
 99 TIGR02300 FYDLN_acid conserved  69.1     3.1 6.7E-05   31.3   1.5   12  156-167    26-37  (129)
100 PRK06266 transcription initiat  68.8       6 0.00013   32.2   3.3   16  184-199   117-132 (178)
101 smart00531 TFIIE Transcription  68.7       6 0.00013   31.1   3.2   14  156-169    99-112 (147)
102 smart00834 CxxC_CXXC_SSSS Puta  67.8     1.3 2.7E-05   26.1  -0.6   29  295-329     6-34  (41)
103 TIGR02098 MJ0042_CXXC MJ0042 f  67.6     3.4 7.4E-05   23.8   1.3   10  185-194    26-35  (38)
104 PRK06266 transcription initiat  66.9     3.8 8.2E-05   33.4   1.8   16  295-310   118-133 (178)
105 PF03604 DNA_RNApol_7kD:  DNA d  65.8     3.8 8.3E-05   22.8   1.1    8  321-328    17-24  (32)
106 PHA00626 hypothetical protein   64.6     1.7 3.8E-05   27.3  -0.4   12  129-140    23-34  (59)
107 KOG4167|consensus               63.9      11 0.00024   37.1   4.4   25  129-153   792-816 (907)
108 TIGR02605 CxxC_CxxC_SSSS putat  63.7     2.3 4.9E-05   26.6  -0.0   11  185-195     6-16  (52)
109 PF05443 ROS_MUCR:  ROS/MUCR tr  63.4     4.3 9.3E-05   31.1   1.4   25  320-347    71-95  (132)
110 PF14353 CpXC:  CpXC protein     63.0     6.2 0.00013   30.1   2.3   12  157-168    39-50  (128)
111 PF06524 NOA36:  NOA36 protein;  62.8     2.3 5.1E-05   36.0  -0.1  100  157-289   126-232 (314)
112 COG5151 SSL1 RNA polymerase II  61.5     5.5 0.00012   34.8   1.8   24  238-261   388-411 (421)
113 COG1996 RPC10 DNA-directed RNA  61.5     2.9 6.2E-05   25.8   0.1   10  295-304     7-16  (49)
114 KOG2807|consensus               61.3      15 0.00033   32.5   4.5   24  211-234   345-368 (378)
115 PRK14890 putative Zn-ribbon RN  61.3     5.2 0.00011   25.6   1.3   10   99-108    25-34  (59)
116 PF09723 Zn-ribbon_8:  Zinc rib  60.2     2.4 5.2E-05   25.2  -0.3   11  185-195     6-16  (42)
117 PF02176 zf-TRAF:  TRAF-type zi  58.7     6.4 0.00014   25.3   1.5    6  172-177    26-31  (60)
118 PF08274 PhnA_Zn_Ribbon:  PhnA   57.9     3.4 7.4E-05   22.6   0.0    9  320-328    18-26  (30)
119 PF15269 zf-C2H2_7:  Zinc-finge  57.3     7.6 0.00017   23.1   1.4   21  322-342    21-41  (54)
120 COG3091 SprT Zn-dependent meta  57.1     4.1 8.8E-05   31.7   0.3   31  321-355   117-147 (156)
121 COG1997 RPL43A Ribosomal prote  56.9     3.4 7.4E-05   28.7  -0.1   10  295-304    54-63  (89)
122 PRK09678 DNA-binding transcrip  56.5     2.5 5.3E-05   28.6  -0.8    7  299-305    34-40  (72)
123 TIGR02300 FYDLN_acid conserved  56.3       9  0.0002   28.9   2.0   11  266-276    26-36  (129)
124 PRK00398 rpoP DNA-directed RNA  55.4     4.4 9.4E-05   24.6   0.2   11  100-110     4-14  (46)
125 PRK04023 DNA polymerase II lar  54.0      10 0.00022   39.0   2.5    9  267-275   627-635 (1121)
126 KOG1280|consensus               53.2      16 0.00034   32.7   3.3   38   99-136    79-116 (381)
127 PRK04023 DNA polymerase II lar  51.3      12 0.00026   38.5   2.6   10  185-194   664-673 (1121)
128 TIGR01206 lysW lysine biosynth  50.5     5.3 0.00011   25.3   0.0   10  321-330    22-31  (54)
129 COG4957 Predicted transcriptio  50.2     8.9 0.00019   29.1   1.2   23  322-347    77-99  (148)
130 PF12760 Zn_Tnp_IS1595:  Transp  46.8      15 0.00032   22.2   1.6    7  267-273    19-25  (46)
131 cd00730 rubredoxin Rubredoxin;  45.8      12 0.00025   23.3   1.0   11  100-110     2-12  (50)
132 KOG2807|consensus               45.6      33 0.00071   30.5   4.0   86  184-301   276-374 (378)
133 KOG3408|consensus               44.3      16 0.00035   27.2   1.7   26  291-316    54-79  (129)
134 PF04959 ARS2:  Arsenite-resist  44.2      16 0.00034   30.7   1.9   27  155-181    76-102 (214)
135 KOG2593|consensus               42.8      23 0.00049   32.8   2.8   35  128-164   127-161 (436)
136 COG5188 PRP9 Splicing factor 3  42.8      21 0.00045   31.9   2.5   91   97-187   236-406 (470)
137 COG1198 PriA Primosomal protei  42.7     8.7 0.00019   38.6   0.2    8  240-247   437-444 (730)
138 PF05290 Baculo_IE-1:  Baculovi  42.1      15 0.00033   27.9   1.3   56  263-335    77-135 (140)
139 PF05443 ROS_MUCR:  ROS/MUCR tr  42.1      19  0.0004   27.7   1.8   25   97-124    70-94  (132)
140 PF09845 DUF2072:  Zn-ribbon co  42.0      14 0.00031   28.1   1.2   11  240-250     3-13  (131)
141 KOG2593|consensus               42.0      24 0.00053   32.6   2.8   11  239-249   129-139 (436)
142 COG5151 SSL1 RNA polymerase II  41.8     9.2  0.0002   33.5   0.2   24  321-344   388-411 (421)
143 KOG4167|consensus               41.7     9.6 0.00021   37.5   0.3   26  294-319   792-817 (907)
144 TIGR00595 priA primosomal prot  39.2      19 0.00042   34.7   2.0    9  266-274   253-261 (505)
145 PF04959 ARS2:  Arsenite-resist  39.0      13 0.00029   31.1   0.7   25  321-345    77-101 (214)
146 COG1198 PriA Primosomal protei  38.6     7.3 0.00016   39.1  -1.0   10  130-139   436-445 (730)
147 KOG3408|consensus               37.9      33 0.00072   25.6   2.5   31   91-121    49-79  (129)
148 PRK14714 DNA polymerase II lar  37.9      25 0.00053   37.4   2.5   11  294-304   692-702 (1337)
149 PF12907 zf-met2:  Zinc-binding  37.1      25 0.00055   20.6   1.5   26  157-182     2-30  (40)
150 PF07754 DUF1610:  Domain of un  36.9      13 0.00028   19.1   0.2    8  294-301    16-23  (24)
151 PTZ00255 60S ribosomal protein  36.1     7.7 0.00017   27.4  -0.9   10  295-304    55-64  (90)
152 PF14446 Prok-RING_1:  Prokaryo  36.1      21 0.00047   22.5   1.1   11  100-110     6-16  (54)
153 TIGR00280 L37a ribosomal prote  34.7     6.9 0.00015   27.7  -1.3   10  322-331    54-63  (91)
154 KOG4124|consensus               34.1     6.2 0.00013   35.1  -2.0   22  320-341   397-418 (442)
155 KOG1280|consensus               33.6      44 0.00095   30.0   3.0   23  266-288    79-101 (381)
156 COG5112 UFD2 U1-like Zn-finger  32.2      29 0.00063   25.1   1.4   33   88-120    44-76  (126)
157 PRK14873 primosome assembly pr  32.1      28  0.0006   34.9   1.8   10  294-303   422-431 (665)
158 PRK14714 DNA polymerase II lar  31.5      37 0.00081   36.1   2.6   11  184-194   692-702 (1337)
159 PLN02294 cytochrome c oxidase   31.4      15 0.00032   29.3  -0.2   18  341-358   134-151 (174)
160 KOG4377|consensus               31.1      13 0.00027   34.0  -0.7   24  295-318   402-427 (480)
161 PF05191 ADK_lid:  Adenylate ki  30.4     6.9 0.00015   22.4  -1.6    8  241-248     4-11  (36)
162 PF01780 Ribosomal_L37ae:  Ribo  30.1     5.4 0.00012   28.1  -2.5   10  295-304    54-63  (90)
163 PF06220 zf-U1:  U1 zinc finger  29.1      38 0.00081   19.6   1.3   10  267-276     4-13  (38)
164 KOG4124|consensus               28.8     7.6 0.00016   34.6  -2.3   26  155-180   348-375 (442)
165 cd00924 Cyt_c_Oxidase_Vb Cytoc  28.8      15 0.00034   26.4  -0.4    8  348-355    79-86  (97)
166 PF13878 zf-C2H2_3:  zinc-finge  28.7      46   0.001   19.6   1.7    9  268-276    15-23  (41)
167 PRK03824 hypA hydrogenase nick  28.6      20 0.00043   27.7   0.1   10  239-248    71-80  (135)
168 smart00154 ZnF_AN1 AN1-like Zi  28.6      24 0.00053   20.5   0.5   13  321-333    12-24  (39)
169 COG3364 Zn-ribbon containing p  28.3      37 0.00079   24.5   1.4   11  268-278     4-14  (112)
170 PRK03976 rpl37ae 50S ribosomal  28.0     9.8 0.00021   26.9  -1.5   10  322-331    55-64  (90)
171 COG4530 Uncharacterized protei  27.8      30 0.00066   25.2   0.9   12  155-166    25-36  (129)
172 PF01363 FYVE:  FYVE zinc finge  27.6      40 0.00087   22.2   1.5    8  132-139    12-19  (69)
173 PF05495 zf-CHY:  CHY zinc fing  26.3      11 0.00024   25.4  -1.5   12  294-305    41-52  (71)
174 PRK12380 hydrogenase nickel in  26.2      34 0.00073   25.5   1.0   13  129-141    70-82  (113)
175 TIGR00100 hypA hydrogenase nic  25.9      34 0.00074   25.5   1.0   11  157-167    71-81  (115)
176 KOG2636|consensus               25.8      44 0.00096   31.1   1.8   29  259-287   394-423 (497)
177 PF14311 DUF4379:  Domain of un  25.7      41 0.00089   21.2   1.2    7  268-274    30-36  (55)
178 PRK00432 30S ribosomal protein  25.4      31 0.00068   21.4   0.6   10  238-247    37-46  (50)
179 COG3357 Predicted transcriptio  25.1      31 0.00067   24.3   0.5   26   99-136    58-83  (97)
180 PF03145 Sina:  Seven in absent  25.1      37 0.00079   28.1   1.1   37  309-346    32-72  (198)
181 PF07503 zf-HYPF:  HypF finger;  24.7      11 0.00023   21.5  -1.5   10  130-139    22-31  (35)
182 KOG2636|consensus               24.3      47   0.001   30.9   1.7   22  156-177   401-423 (497)
183 COG5112 UFD2 U1-like Zn-finger  24.2      49  0.0011   24.0   1.4   23  293-315    54-76  (126)
184 KOG0402|consensus               24.0      49  0.0011   22.9   1.3   10  294-303    36-45  (92)
185 PF10263 SprT-like:  SprT-like   23.8      16 0.00035   28.8  -1.2   10  295-304   124-133 (157)
186 PRK04351 hypothetical protein;  23.7      28  0.0006   27.4   0.1   12  320-331   131-142 (149)
187 KOG0717|consensus               23.7      39 0.00085   31.6   1.1   22  295-316   293-314 (508)
188 COG1998 RPS31 Ribosomal protei  23.4      49  0.0011   20.4   1.1   10  238-247    37-46  (51)
189 PF07282 OrfB_Zn_ribbon:  Putat  23.3      39 0.00084   22.3   0.8   10  321-330    46-55  (69)
190 PF13451 zf-trcl:  Probable zin  23.1      61  0.0013   20.1   1.5    7  101-107     6-12  (49)
191 KOG3507|consensus               22.6      32  0.0007   22.0   0.2   11  320-330    36-46  (62)
192 PF10276 zf-CHCC:  Zinc-finger   22.2      32  0.0007   20.2   0.2   11  321-331    29-39  (40)
193 PF01155 HypA:  Hydrogenase exp  22.1      32 0.00069   25.6   0.2   12  157-168    71-82  (113)
194 COG1327 Predicted transcriptio  21.9      21 0.00045   27.9  -0.9   11  268-278    30-40  (156)
195 COG0068 HypF Hydrogenase matur  21.6      16 0.00035   36.1  -1.8   28  269-302   154-181 (750)
196 PF01428 zf-AN1:  AN1-like Zinc  21.5      29 0.00062   20.6  -0.1   12  321-332    13-24  (43)
197 KOG2907|consensus               21.5      50  0.0011   24.3   1.0   12  184-195   102-113 (116)
198 KOG1842|consensus               21.3      55  0.0012   30.5   1.5   20  130-149    16-35  (505)
199 COG1675 TFA1 Transcription ini  21.0 1.2E+02  0.0026   24.7   3.2   14  182-195   111-124 (176)
200 smart00440 ZnF_C2C2 C2C2 Zinc   20.6      13 0.00028   21.8  -1.8   10  185-194    29-38  (40)
201 COG4888 Uncharacterized Zn rib  20.1      19 0.00041   25.9  -1.3    7  267-273    23-29  (104)
202 PRK00564 hypA hydrogenase nick  20.0      54  0.0012   24.6   1.0   13  129-141    71-83  (117)

No 1  
>KOG3608|consensus
Probab=99.96  E-value=1.9e-28  Score=206.69  Aligned_cols=247  Identities=24%  Similarity=0.482  Sum_probs=214.4

Q ss_pred             ceecc--cchhccCC-hHHHHHHHhhccC--------------------------------CCCCcccc--ccccccccC
Q psy6525          99 NVLCY--ICDEILKD-IDDLRYHGLLHAT--------------------------------PLGTQFQC--NVCFLMLNN  141 (360)
Q Consensus        99 ~~~C~--~C~~~f~~-~~~l~~H~~~~~~--------------------------------~~~~~~~C--~~C~~~f~~  141 (360)
                      .+.|.  .|++...+ ..+|.+|.-.|--                                ..+..|.|  ..|+..|.+
T Consensus        69 e~qC~w~~C~f~~~~~s~~l~RHvy~H~y~~~l~q~G~~al~~~~dig~c~~~f~~~~~ip~~g~~f~C~WedCe~~F~s  148 (467)
T KOG3608|consen   69 EHQCTWNSCDFRTENSSADLIRHVYFHCYHTKLKQQGKLALDLHPDIGACTAPFRLMEKIPALGQNFRCGWEDCEREFVS  148 (467)
T ss_pred             ceeEEeccCCccccchHHHHHhhhhhhhhHHHHHHHHHHHHhcCCCcCcccCCcchhhccccchhhhccChhhcCCcccC
Confidence            46776  48877766 5789999765511                                11234566  479999999


Q ss_pred             hHHHHHHHHHcCC--------------ccccccc--ccccccCHHHHHHHHHHcCCCceeecccccccccChhHHHHHHH
Q psy6525         142 RCYTRFHLLKHNW--------------VRFKCDL--CSRTFNSQSYLQQHKKHDHEGVKYKCKECGKCYTQNTNLKQHML  205 (360)
Q Consensus       142 ~~~l~~H~~~h~~--------------~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~  205 (360)
                      ...+..|+..|..              ..+.|..  |-+.|.++..|++|++.|.+++...|+.||.-|.++..|-.|++
T Consensus       149 ~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~r  228 (467)
T KOG3608|consen  149 IVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLR  228 (467)
T ss_pred             HHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHH
Confidence            9999999988831              1255655  99999999999999999999999999999999999999999988


Q ss_pred             hcCC---CCCcCccccccccCHHHHHHHHhhcCCCCcccCCCCCccCCHHHHHHHHH-HhcCCCcccccccccccCChhH
Q psy6525         206 SHKG---IFFICFHCNKNFTHRALLVRHMQKHSSERFKCDLCGKVTPYYQHYLRHMR-IHQGLEVHECNLCAKLFACKRS  281 (360)
Q Consensus       206 ~h~~---~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~  281 (360)
                      ..+.   .+|.|..|.+.|.++..|..|+..|..- |+|+.|+.+....+.|..|++ .|...+||+|..|++.|.+.+.
T Consensus       229 Rqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~-ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esd  307 (467)
T KOG3608|consen  229 RQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNC-YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESD  307 (467)
T ss_pred             hhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhc-ccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHH
Confidence            7653   4899999999999999999999987654 999999999999999999998 5888999999999999999999


Q ss_pred             HHHhHhhhcCCCcccccc--chhhhcCHHHHHHHHhhhc-C---CcccccccccccCChHHHHHHHHHhCCC
Q psy6525         282 LQDHMQRHEEPNKYQCAM--CKKQYASKKMLEKHIRRHE-G---QDYKCYICGNRYATQKYLEEHIRLHQGH  347 (360)
Q Consensus       282 l~~H~~~h~~~~~~~C~~--C~~~f~~~~~L~~H~~~h~-~---~~~~C~~C~~~f~~~~~l~~H~~~h~g~  347 (360)
                      |.+|..+|. +..|+|+.  |..+|.+...|++|++.++ |   -+|.|-.|++.|++-.+|..|+...+|.
T Consensus       308 L~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f  378 (467)
T KOG3608|consen  308 LAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGF  378 (467)
T ss_pred             HHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcc
Confidence            999999988 77899988  9999999999999999866 4   3799999999999999999999877775


No 2  
>KOG2462|consensus
Probab=99.96  E-value=6.6e-30  Score=210.39  Aligned_cols=131  Identities=36%  Similarity=0.692  Sum_probs=91.8

Q ss_pred             eeecccccccccChhHHHHHHHhcCC----CCCcCccccccccCHHHHHHHHhhcCCCCcccCCCCCccCCHHHHHHHHH
Q psy6525         184 KYKCKECGKCYTQNTNLKQHMLSHKG----IFFICFHCNKNFTHRALLVRHMQKHSSERFKCDLCGKVTPYYQHYLRHMR  259 (360)
Q Consensus       184 ~~~C~~C~~~f~~~~~l~~H~~~h~~----~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~  259 (360)
                      .|+|+.||+.+.+..+|.+|.++|..    ..+.|++|++.|.+...|..|+++|. -+..|.+||+.|...+.|+.|+|
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~-l~c~C~iCGKaFSRPWLLQGHiR  208 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT-LPCECGICGKAFSRPWLLQGHIR  208 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC-CCcccccccccccchHHhhcccc
Confidence            57888888888888888888877754    25667777777777777777776665 34666677777766666666777


Q ss_pred             HhcCCCcccccccccccCChhHHHHhHhhhcCCCccccccchhhhcCHHHHHHHHh
Q psy6525         260 IHQGLEVHECNLCAKLFACKRSLQDHMQRHEEPNKYQCAMCKKQYASKKMLEKHIR  315 (360)
Q Consensus       260 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~  315 (360)
                      +|+|||||.|++|+++|+++++|+.|+++|.+.++|+|..|+|+|+..+.|.+|..
T Consensus       209 THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  209 THTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            77777777777777777777777777776666666667667666666666666654


No 3  
>KOG1074|consensus
Probab=99.96  E-value=4.5e-30  Score=238.31  Aligned_cols=191  Identities=27%  Similarity=0.496  Sum_probs=159.9

Q ss_pred             cccccccccccCHHHHHHHHHHcCCCceeecccccccccChhHHHHHHHhcCCC-----CCcCc---cccccccCHHHHH
Q psy6525         157 FKCDLCSRTFNSQSYLQQHKKHDHEGVKYKCKECGKCYTQNTNLKQHMLSHKGI-----FFICF---HCNKNFTHRALLV  228 (360)
Q Consensus       157 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-----~~~C~---~C~~~f~~~~~l~  228 (360)
                      -+|-+|.++..-.+.|+.|++.|.+++||+|.+||+.|.++.+|+.|+-.|...     .+.|+   +|-+.|.+.-.|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            589999999999999999999999999999999999999999999999999764     68999   9999999999999


Q ss_pred             HHHhhcCCC--------------CcccCCCCCccCCHHHHHHHHHHhcCC----------------C----ccccccccc
Q psy6525         229 RHMQKHSSE--------------RFKCDLCGKVTPYYQHYLRHMRIHQGL----------------E----VHECNLCAK  274 (360)
Q Consensus       229 ~H~~~h~~~--------------~~~C~~C~~~f~~~~~l~~H~~~h~~~----------------~----~~~C~~C~~  274 (360)
                      .|++.|.+.              .-+|..|.+.|.....+..++..|.+.                .    +..+..|+.
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence            999998743              247999999998888888887666321                1    355666777


Q ss_pred             ccCChhHHHHhHhhh-----------------------cC----------------------------------------
Q psy6525         275 LFACKRSLQDHMQRH-----------------------EE----------------------------------------  291 (360)
Q Consensus       275 ~f~~~~~l~~H~~~h-----------------------~~----------------------------------------  291 (360)
                      .+.....+..+-..+                       ++                                        
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence            666655444332111                       00                                        


Q ss_pred             -------------------------------CCccccccchhhhcCHHHHHHHHhhhcC-CcccccccccccCChHHHHH
Q psy6525         292 -------------------------------PNKYQCAMCKKQYASKKMLEKHIRRHEG-QDYKCYICGNRYATQKYLEE  339 (360)
Q Consensus       292 -------------------------------~~~~~C~~C~~~f~~~~~L~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~  339 (360)
                                                     .....|.+||+.|.+.++|..|+|+|++ +||.|.+|++.|..+.+|+.
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKv  925 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKV  925 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhh
Confidence                                           0126799999999999999999999999 79999999999999999999


Q ss_pred             HHHHhCCC
Q psy6525         340 HIRLHQGH  347 (360)
Q Consensus       340 H~~~h~g~  347 (360)
                      ||.+|...
T Consensus       926 HMgtH~w~  933 (958)
T KOG1074|consen  926 HMGTHMWV  933 (958)
T ss_pred             hhcccccc
Confidence            99999876


No 4  
>KOG2462|consensus
Probab=99.95  E-value=3.4e-29  Score=206.22  Aligned_cols=130  Identities=32%  Similarity=0.675  Sum_probs=110.9

Q ss_pred             CCcCccccccccCHHHHHHHHhhcCC----CCcccCCCCCccCCHHHHHHHHHHhcCCCcccccccccccCChhHHHHhH
Q psy6525         211 FFICFHCNKNFTHRALLVRHMQKHSS----ERFKCDLCGKVTPYYQHYLRHMRIHQGLEVHECNLCAKLFACKRSLQDHM  286 (360)
Q Consensus       211 ~~~C~~C~~~f~~~~~l~~H~~~h~~----~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  286 (360)
                      .|.|+.||+.+.+.++|.+|.++|-.    +.+.|+.|++.|.+...|..|+++|+  -+++|.+||+.|.+..-|+-|+
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHi  207 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHI  207 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccc
Confidence            67888888888888888888888753    35788888888888888888888887  5688888888888888888888


Q ss_pred             hhhcCCCccccccchhhhcCHHHHHHHHhhhcC-CcccccccccccCChHHHHHHHH
Q psy6525         287 QRHEEPNKYQCAMCKKQYASKKMLEKHIRRHEG-QDYKCYICGNRYATQKYLEEHIR  342 (360)
Q Consensus       287 ~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~  342 (360)
                      |+|+||+||.|+.|+++|..+++|+.||++|.+ ++|+|..|+|+|..++.|..|..
T Consensus       208 RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  208 RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             ccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            888888888888888888888888888888888 78888888888888888888864


No 5  
>KOG3608|consensus
Probab=99.94  E-value=7.2e-27  Score=197.16  Aligned_cols=230  Identities=23%  Similarity=0.456  Sum_probs=198.9

Q ss_pred             ccccc--cccccccC-hHHHHHHHHHcCCc-----------------------------------cccccc--ccccccC
Q psy6525         129 QFQCN--VCFLMLNN-RCYTRFHLLKHNWV-----------------------------------RFKCDL--CSRTFNS  168 (360)
Q Consensus       129 ~~~C~--~C~~~f~~-~~~l~~H~~~h~~~-----------------------------------~~~C~~--C~~~f~~  168 (360)
                      .++|.  .|+....+ ...|.+|...|...                                   .|.|..  |+..|.+
T Consensus        69 e~qC~w~~C~f~~~~~s~~l~RHvy~H~y~~~l~q~G~~al~~~~dig~c~~~f~~~~~ip~~g~~f~C~WedCe~~F~s  148 (467)
T KOG3608|consen   69 EHQCTWNSCDFRTENSSADLIRHVYFHCYHTKLKQQGKLALDLHPDIGACTAPFRLMEKIPALGQNFRCGWEDCEREFVS  148 (467)
T ss_pred             ceeEEeccCCccccchHHHHHhhhhhhhhHHHHHHHHHHHHhcCCCcCcccCCcchhhccccchhhhccChhhcCCcccC
Confidence            56775  48777666 57899998776310                                   166765  9999999


Q ss_pred             HHHHHHHHHHcCCC-------------ceeec--ccccccccChhHHHHHHHhcCCC-CCcCccccccccCHHHHHHHHh
Q psy6525         169 QSYLQQHKKHDHEG-------------VKYKC--KECGKCYTQNTNLKQHMLSHKGI-FFICFHCNKNFTHRALLVRHMQ  232 (360)
Q Consensus       169 ~~~l~~H~~~~h~~-------------~~~~C--~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~  232 (360)
                      ...|..|...|.-.             ..+.|  ..|.+.|.++..|+.|+++|.+. ...|+.||..|+++..|..|++
T Consensus       149 ~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~r  228 (467)
T KOG3608|consen  149 IVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLR  228 (467)
T ss_pred             HHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHH
Confidence            99999998775421             13455  57999999999999999999986 6789999999999999999998


Q ss_pred             hcCC---CCcccCCCCCccCCHHHHHHHHHHhcCCCcccccccccccCChhHHHHhHhh-hcCCCccccccchhhhcCHH
Q psy6525         233 KHSS---ERFKCDLCGKVTPYYQHYLRHMRIHQGLEVHECNLCAKLFACKRSLQDHMQR-HEEPNKYQCAMCKKQYASKK  308 (360)
Q Consensus       233 ~h~~---~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~  308 (360)
                      .-+.   .+|.|..|.+.|.+...|..|+..|..  -|+|+.|+.+....++|.+|++. |...+||+|+.|.+.|.+.+
T Consensus       229 Rqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~es  306 (467)
T KOG3608|consen  229 RQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRES  306 (467)
T ss_pred             hhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh--cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHH
Confidence            6543   489999999999999999999999864  59999999999999999999995 88899999999999999999


Q ss_pred             HHHHHHhhhcCCcccccc--cccccCChHHHHHHHHHhC-CC---CccCCCcccccCC
Q psy6525         309 MLEKHIRRHEGQDYKCYI--CGNRYATQKYLEEHIRLHQ-GH---TYMCNAKFSFNEQ  360 (360)
Q Consensus       309 ~L~~H~~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-g~---~~~C~~c~~~f~~  360 (360)
                      .|.+|..+|..-.|+|..  |..+|.+..+|..|++.++ |.   +|.|..|.+.|++
T Consensus       307 dL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~  364 (467)
T KOG3608|consen  307 DLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTS  364 (467)
T ss_pred             HHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhcc
Confidence            999999999977899998  9999999999999999776 65   6999999999964


No 6  
>KOG1074|consensus
Probab=99.94  E-value=7.1e-28  Score=223.80  Aligned_cols=175  Identities=24%  Similarity=0.487  Sum_probs=124.4

Q ss_pred             eecccccccccChhHHHHHHHhcCCC-CCcCccccccccCHHHHHHHHhhcCCC-----CcccC---CCCCccCCHHHHH
Q psy6525         185 YKCKECGKCYTQNTNLKQHMLSHKGI-FFICFHCNKNFTHRALLVRHMQKHSSE-----RFKCD---LCGKVTPYYQHYL  255 (360)
Q Consensus       185 ~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~-----~~~C~---~C~~~f~~~~~l~  255 (360)
                      -+|-+|.++..-++.|+.|.++|+|. ||+|.+||+.|.++.+|+.|+-.|..+     .+.|+   +|.+.|...-.|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            57777888888888888888887774 778888888888888888887777654     46777   7777777777777


Q ss_pred             HHHHHhcCCC-------------cccccccccccCChhHHHHhHhhhc----------------CCC----ccccccchh
Q psy6525         256 RHMRIHQGLE-------------VHECNLCAKLFACKRSLQDHMQRHE----------------EPN----KYQCAMCKK  302 (360)
Q Consensus       256 ~H~~~h~~~~-------------~~~C~~C~~~f~~~~~l~~H~~~h~----------------~~~----~~~C~~C~~  302 (360)
                      .|+++|.+..             .-+|..|.+.|.....+..++-.|.                ++.    +..+..|+.
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence            7777776321             1357777777777777766665542                112    345556666


Q ss_pred             hhcCHHHHHHHHhhh-----------------------cC-C--------------------------------------
Q psy6525         303 QYASKKMLEKHIRRH-----------------------EG-Q--------------------------------------  320 (360)
Q Consensus       303 ~f~~~~~L~~H~~~h-----------------------~~-~--------------------------------------  320 (360)
                      .+.....+..+-..+                       ++ +                                      
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence            555544443332111                       00 0                                      


Q ss_pred             ---------------------------------cccccccccccCChHHHHHHHHHhCCC-CccCCCcccccC
Q psy6525         321 ---------------------------------DYKCYICGNRYATQKYLEEHIRLHQGH-TYMCNAKFSFNE  359 (360)
Q Consensus       321 ---------------------------------~~~C~~C~~~f~~~~~l~~H~~~h~g~-~~~C~~c~~~f~  359 (360)
                                                       ...|..||+.|...++|..|+|+|+|+ ||.|.+|++.|.
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFt  918 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFT  918 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhh
Confidence                                             067999999999999999999999999 999999999985


No 7  
>KOG3623|consensus
Probab=99.92  E-value=2.3e-25  Score=203.86  Aligned_cols=107  Identities=23%  Similarity=0.479  Sum_probs=98.2

Q ss_pred             eecccchhccCChHHHHHHHhhccCCCCCccccccccccccChHHHHHHHHHcCC--------------ccccccccccc
Q psy6525         100 VLCYICDEILKDIDDLRYHGLLHATPLGTQFQCNVCFLMLNNRCYTRFHLLKHNW--------------VRFKCDLCSRT  165 (360)
Q Consensus       100 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~--------------~~~~C~~C~~~  165 (360)
                      +.|++|+..++.+..|+.|++..+......|.|..|...|..+..|.+|+..|..              +.|+|..|+|.
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            6799999999999999999886665557789999999999999999999998842              45999999999


Q ss_pred             ccCHHHHHHHHHHcCCCceeecccccccccChhHHHHHHHh
Q psy6525         166 FNSQSYLQQHKKHDHEGVKYKCKECGKCYTQNTNLKQHMLS  206 (360)
Q Consensus       166 f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~  206 (360)
                      |+.+..|+.|++.|.|++||.|+.|+++|....++..||.+
T Consensus       291 FKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             hhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            99999999999999999999999999999999999999854


No 8  
>KOG3623|consensus
Probab=99.87  E-value=9.2e-23  Score=186.99  Aligned_cols=104  Identities=32%  Similarity=0.597  Sum_probs=94.1

Q ss_pred             ccccccccccccChHHHHHHHHHcC---CcccccccccccccCHHHHHHHHHHcCCC-------------ceeecccccc
Q psy6525         129 QFQCNVCFLMLNNRCYTRFHLLKHN---WVRFKCDLCSRTFNSQSYLQQHKKHDHEG-------------VKYKCKECGK  192 (360)
Q Consensus       129 ~~~C~~C~~~f~~~~~l~~H~~~h~---~~~~~C~~C~~~f~~~~~l~~H~~~~h~~-------------~~~~C~~C~~  192 (360)
                      ..+|++|.+.+.....|+.|+..-+   +..|.|.+|.++|..+..|.+||..|...             +.|+|..||+
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccch
Confidence            4689999999999999999987543   66799999999999999999999987532             3699999999


Q ss_pred             cccChhHHHHHHHhcCCC-CCcCccccccccCHHHHHHHHh
Q psy6525         193 CYTQNTNLKQHMLSHKGI-FFICFHCNKNFTHRALLVRHMQ  232 (360)
Q Consensus       193 ~f~~~~~l~~H~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~  232 (360)
                      .|..+..|+.|+++|.|. ||.|+.|++.|.....+..||.
T Consensus       290 AFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  290 AFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            999999999999999985 9999999999999999999984


No 9  
>KOG3576|consensus
Probab=99.76  E-value=2.5e-19  Score=140.43  Aligned_cols=110  Identities=28%  Similarity=0.629  Sum_probs=93.5

Q ss_pred             CcccCCCCCccCCHHHHHHHHHHhcCCCcccccccccccCChhHHHHhHhhhcCCCccccccchhhhcCHHHHHHHHhhh
Q psy6525         238 RFKCDLCGKVTPYYQHYLRHMRIHQGLEVHECNLCAKLFACKRSLQDHMQRHEEPNKYQCAMCKKQYASKKMLEKHIRRH  317 (360)
Q Consensus       238 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h  317 (360)
                      .|.|.+|++.|.....|.+|++-|...+.+-|..||+.|.....|++|+|+|+|.+||+|..|+++|+..-.|..|++.-
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kv  196 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKV  196 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHH
Confidence            57888888888888888888888888888888888888888888888888888888888888888888888888888764


Q ss_pred             cC------------CcccccccccccCChHHHHHHHHHhCCC
Q psy6525         318 EG------------QDYKCYICGNRYATQKYLEEHIRLHQGH  347 (360)
Q Consensus       318 ~~------------~~~~C~~C~~~f~~~~~l~~H~~~h~g~  347 (360)
                      +|            +.|.|+.||.+-.....+..|++.|+..
T Consensus       197 hgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  197 HGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             cCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence            43            2588999999999999999999988754


No 10 
>KOG3576|consensus
Probab=99.66  E-value=3e-17  Score=128.92  Aligned_cols=109  Identities=30%  Similarity=0.577  Sum_probs=83.4

Q ss_pred             CCcCccccccccCHHHHHHHHhhcCCC-CcccCCCCCccCCHHHHHHHHHHhcCCCcccccccccccCChhHHHHhHhhh
Q psy6525         211 FFICFHCNKNFTHRALLVRHMQKHSSE-RFKCDLCGKVTPYYQHYLRHMRIHQGLEVHECNLCAKLFACKRSLQDHMQRH  289 (360)
Q Consensus       211 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  289 (360)
                      .|.|.+|++.|.-...|.+|++.|..- ++-|..||+.|.+..+|++|+++|+|.+||+|..|+++|..+-+|..|++.-
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kv  196 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKV  196 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHH
Confidence            345555555555555555555555433 5678888888888888888888888888888888888888888888888764


Q ss_pred             cC-----------CCccccccchhhhcCHHHHHHHHhhhcC
Q psy6525         290 EE-----------PNKYQCAMCKKQYASKKMLEKHIRRHEG  319 (360)
Q Consensus       290 ~~-----------~~~~~C~~C~~~f~~~~~L~~H~~~h~~  319 (360)
                      +|           .+.|.|+.||.+-.....+..|+..|+.
T Consensus       197 hgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  197 HGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             cCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            44           3568899999998888889999988765


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.47  E-value=1e-13  Score=128.98  Aligned_cols=145  Identities=17%  Similarity=0.363  Sum_probs=113.2

Q ss_pred             eeecccccccccChhHHHHHHHhcCCCCCcCcc--ccccccCHHHHHHHHhhcCCCCcccCCCCCccCCHHHHHHHHHHh
Q psy6525         184 KYKCKECGKCYTQNTNLKQHMLSHKGIFFICFH--CNKNFTHRALLVRHMQKHSSERFKCDLCGKVTPYYQHYLRHMRIH  261 (360)
Q Consensus       184 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h  261 (360)
                      ...|+.|.+.... ..|..|.....-....|+.  |+..|. +..+..|        +.|+.|++.|. ...|..|+.++
T Consensus       407 ~V~C~NC~~~i~l-~~l~lHe~~C~r~~V~Cp~~~Cg~v~~-r~el~~H--------~~C~~Cgk~f~-~s~LekH~~~~  475 (567)
T PLN03086        407 TVECRNCKHYIPS-RSIALHEAYCSRHNVVCPHDGCGIVLR-VEEAKNH--------VHCEKCGQAFQ-QGEMEKHMKVF  475 (567)
T ss_pred             eEECCCCCCccch-hHHHHHHhhCCCcceeCCcccccceee-ccccccC--------ccCCCCCCccc-hHHHHHHHHhc
Confidence            4578888877654 4566888776656667884  998884 3333444        58999999995 67889999987


Q ss_pred             cCCCcccccccccccCChhHHHHhHhhhcCCCccccccchhhhc----------CHHHHHHHHhhhcCCccccccccccc
Q psy6525         262 QGLEVHECNLCAKLFACKRSLQDHMQRHEEPNKYQCAMCKKQYA----------SKKMLEKHIRRHEGQDYKCYICGNRY  331 (360)
Q Consensus       262 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~L~~H~~~h~~~~~~C~~C~~~f  331 (360)
                      +  .++.|+ ||+.+ .+..|..|+.+|.+.+++.|++|++.|.          ....|..|...+..+++.|..||+.+
T Consensus       476 H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~CG~rt~~C~~Cgk~V  551 (567)
T PLN03086        476 H--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESICGSRTAPCDSCGRSV  551 (567)
T ss_pred             C--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhcCCcceEccccCCee
Confidence            5  789999 99654 6789999999999999999999999985          24579999998866899999999888


Q ss_pred             CChHHHHHHHHHh
Q psy6525         332 ATQKYLEEHIRLH  344 (360)
Q Consensus       332 ~~~~~l~~H~~~h  344 (360)
                      ..+ .|..|+-.-
T Consensus       552 rlr-dm~~H~~~~  563 (567)
T PLN03086        552 MLK-EMDIHQIAV  563 (567)
T ss_pred             eeh-hHHHHHHHh
Confidence            765 577886543


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.39  E-value=4.3e-13  Score=124.91  Aligned_cols=133  Identities=19%  Similarity=0.349  Sum_probs=107.7

Q ss_pred             CCcCccccccccCHHHHHHHHhhcCCCCcccCC--CCCccCCHHHHHHHHHHhcCCCcccccccccccCChhHHHHhHhh
Q psy6525         211 FFICFHCNKNFTHRALLVRHMQKHSSERFKCDL--CGKVTPYYQHYLRHMRIHQGLEVHECNLCAKLFACKRSLQDHMQR  288 (360)
Q Consensus       211 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  288 (360)
                      ...|+.|..... ...|..|.....-....|+.  |+..|. +..+.         +.+.|+.|++.|. ...|..|++.
T Consensus       407 ~V~C~NC~~~i~-l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~-r~el~---------~H~~C~~Cgk~f~-~s~LekH~~~  474 (567)
T PLN03086        407 TVECRNCKHYIP-SRSIALHEAYCSRHNVVCPHDGCGIVLR-VEEAK---------NHVHCEKCGQAFQ-QGEMEKHMKV  474 (567)
T ss_pred             eEECCCCCCccc-hhHHHHHHhhCCCcceeCCcccccceee-ccccc---------cCccCCCCCCccc-hHHHHHHHHh
Confidence            457999988766 45666888776666677985  999884 33333         3368999999996 6889999999


Q ss_pred             hcCCCccccccchhhhcCHHHHHHHHhhhcC-CcccccccccccC----------ChHHHHHHHHHhCCCCccCCCcccc
Q psy6525         289 HEEPNKYQCAMCKKQYASKKMLEKHIRRHEG-QDYKCYICGNRYA----------TQKYLEEHIRLHQGHTYMCNAKFSF  357 (360)
Q Consensus       289 h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~-~~~~C~~C~~~f~----------~~~~l~~H~~~h~g~~~~C~~c~~~  357 (360)
                      |+  .++.|+ ||+.+ .+..|..|+++|.+ +++.|.+|++.|.          ..+.|..|..+..+.++.|..|++.
T Consensus       475 ~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~CG~rt~~C~~Cgk~  550 (567)
T PLN03086        475 FH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESICGSRTAPCDSCGRS  550 (567)
T ss_pred             cC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhcCCcceEccccCCe
Confidence            86  789999 99755 67899999999887 7999999999995          2458999999986669999999998


Q ss_pred             cC
Q psy6525         358 NE  359 (360)
Q Consensus       358 f~  359 (360)
                      |+
T Consensus       551 Vr  552 (567)
T PLN03086        551 VM  552 (567)
T ss_pred             ee
Confidence            75


No 13 
>PHA00733 hypothetical protein
Probab=99.28  E-value=3.7e-12  Score=97.08  Aligned_cols=82  Identities=17%  Similarity=0.368  Sum_probs=62.0

Q ss_pred             CCcccccccccccCChhHHHHh--Hh---hhcCCCccccccchhhhcCHHHHHHHHhhhcCCcccccccccccCChHHHH
Q psy6525         264 LEVHECNLCAKLFACKRSLQDH--MQ---RHEEPNKYQCAMCKKQYASKKMLEKHIRRHEGQDYKCYICGNRYATQKYLE  338 (360)
Q Consensus       264 ~~~~~C~~C~~~f~~~~~l~~H--~~---~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~~~~~l~  338 (360)
                      .+++.|.+|...|.....|..|  ++   .+.+.+||.|+.|++.|.+...|..|++.| ..+|.|..|++.|.....|.
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h-~~~~~C~~CgK~F~~~~sL~  116 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT-EHSKVCPVCGKEFRNTDSTL  116 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC-CcCccCCCCCCccCCHHHHH
Confidence            4567777777777766666555  21   234577888888888888888888888876 35788888888888888888


Q ss_pred             HHHHHhCC
Q psy6525         339 EHIRLHQG  346 (360)
Q Consensus       339 ~H~~~h~g  346 (360)
                      .|++..||
T Consensus       117 ~H~~~~h~  124 (128)
T PHA00733        117 DHVCKKHN  124 (128)
T ss_pred             HHHHHhcC
Confidence            88887766


No 14 
>PHA00733 hypothetical protein
Probab=99.04  E-value=1.7e-10  Score=88.00  Aligned_cols=80  Identities=16%  Similarity=0.308  Sum_probs=59.0

Q ss_pred             CcccCCCCCccCCHHHHHHH--HH---HhcCCCcccccccccccCChhHHHHhHhhhcCCCccccccchhhhcCHHHHHH
Q psy6525         238 RFKCDLCGKVTPYYQHYLRH--MR---IHQGLEVHECNLCAKLFACKRSLQDHMQRHEEPNKYQCAMCKKQYASKKMLEK  312 (360)
Q Consensus       238 ~~~C~~C~~~f~~~~~l~~H--~~---~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~  312 (360)
                      ++.|.+|...|.....|..+  +.   .+.+.+||.|+.|++.|.+...|..|++.|  ..+|.|+.|++.|.....|..
T Consensus        40 ~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~  117 (128)
T PHA00733         40 RLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLD  117 (128)
T ss_pred             hHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHH
Confidence            56666666666655555444  11   234577888999999999988888888876  356899999999999999998


Q ss_pred             HHhhhcC
Q psy6525         313 HIRRHEG  319 (360)
Q Consensus       313 H~~~h~~  319 (360)
                      |+...++
T Consensus       118 H~~~~h~  124 (128)
T PHA00733        118 HVCKKHN  124 (128)
T ss_pred             HHHHhcC
Confidence            8887554


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.00  E-value=1.4e-10  Score=72.50  Aligned_cols=42  Identities=24%  Similarity=0.547  Sum_probs=26.5

Q ss_pred             cccccchhhhcCHHHHHHHHhhhcCCcccccccccccCChHHH
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRRHEGQDYKCYICGNRYATQKYL  337 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~~~~~l  337 (360)
                      |.|+.||+.|+..++|..|+++|+ ++|+|..|++.|.+.+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceeccccee
Confidence            566666666666666666666665 466666666666655544


No 16 
>KOG3993|consensus
Probab=98.97  E-value=7.3e-11  Score=103.26  Aligned_cols=49  Identities=18%  Similarity=0.490  Sum_probs=22.6

Q ss_pred             cccccccccccChHHHHHHHHHc-CCcccccccccccccCHHHHHHHHHH
Q psy6525         130 FQCNVCFLMLNNRCYTRFHLLKH-NWVRFKCDLCSRTFNSQSYLQQHKKH  178 (360)
Q Consensus       130 ~~C~~C~~~f~~~~~l~~H~~~h-~~~~~~C~~C~~~f~~~~~l~~H~~~  178 (360)
                      |.|.+|...|.+...|..|.-.- -..-|+|+.|+|+|.-..+|..|.++
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRW  317 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRW  317 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcc
Confidence            45555555555555554442110 01234555555555555555555544


No 17 
>KOG3993|consensus
Probab=98.88  E-value=2e-10  Score=100.61  Aligned_cols=189  Identities=14%  Similarity=0.213  Sum_probs=119.8

Q ss_pred             ceecccchhccCChHHHHHHHhhccCCCCCccccccccccccChHHHHHHHHHcCCcccccccc----cccccCHHHHHH
Q psy6525          99 NVLCYICDEILKDIDDLRYHGLLHATPLGTQFQCNVCFLMLNNRCYTRFHLLKHNWVRFKCDLC----SRTFNSQSYLQQ  174 (360)
Q Consensus        99 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C----~~~f~~~~~l~~  174 (360)
                      .|+|.+|...|.+.-.|.+|.-....  .-.|+|+.|+++|+-..+|..|.+-|..++--=.-=    .+...+....+.
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV--~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~e  344 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIV--HVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQE  344 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeE--EeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhh
Confidence            48999999999999999999632222  235999999999999999999999996443111000    000011111110


Q ss_pred             HHHH--cCCCceeecccccccccChhHHHHHHHhcCCC------------------CCcCccccccccCHHHHHHHHhhc
Q psy6525         175 HKKH--DHEGVKYKCKECGKCYTQNTNLKQHMLSHKGI------------------FFICFHCNKNFTHRALLVRHMQKH  234 (360)
Q Consensus       175 H~~~--~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~------------------~~~C~~C~~~f~~~~~l~~H~~~h  234 (360)
                      --+.  .....-|.|..|++.|.+..-|+.|+.+|+..                  .+-|..|.-.+...+.-..+...+
T Consensus       345 a~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~  424 (500)
T KOG3993|consen  345 AERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYV  424 (500)
T ss_pred             ccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeee
Confidence            0000  01122688999999999999999998877532                  134555655554443322332222


Q ss_pred             CCC--CcccCCCCCccCCHHHHHHHHHHhcCCCcccccccccccCChhHHHHhHhhh
Q psy6525         235 SSE--RFKCDLCGKVTPYYQHYLRHMRIHQGLEVHECNLCAKLFACKRSLQDHMQRH  289 (360)
Q Consensus       235 ~~~--~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  289 (360)
                      .+.  .-.|+.|+..+.+...-..+.+.-..+..|.|.+|..+|.+...|.+|+...
T Consensus       425 a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~  481 (500)
T KOG3993|consen  425 AGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKC  481 (500)
T ss_pred             eccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhc
Confidence            221  3457778877766555444444444456689999999999999999998763


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.87  E-value=6.5e-10  Score=69.49  Aligned_cols=42  Identities=19%  Similarity=0.557  Sum_probs=30.3

Q ss_pred             ccccccccccCChhHHHHhHhhhcCCCccccccchhhhcCHHHH
Q psy6525         267 HECNLCAKLFACKRSLQDHMQRHEEPNKYQCAMCKKQYASKKML  310 (360)
Q Consensus       267 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L  310 (360)
                      |.|+.||+.|+..++|..|+++|+  ++|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            677777777777777777777776  567777777777766554


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.66  E-value=1e-08  Score=54.80  Aligned_cols=24  Identities=33%  Similarity=0.868  Sum_probs=12.4

Q ss_pred             HHHhHhhhcCCCccccccchhhhc
Q psy6525         282 LQDHMQRHEEPNKYQCAMCKKQYA  305 (360)
Q Consensus       282 l~~H~~~h~~~~~~~C~~C~~~f~  305 (360)
                      |.+|+++|+|++||.|++|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            445555555555555555555543


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.51  E-value=6.9e-08  Score=51.52  Aligned_cols=26  Identities=38%  Similarity=0.722  Sum_probs=23.4

Q ss_pred             HHHHHHHHhcCCCcccccccccccCC
Q psy6525         253 HYLRHMRIHQGLEVHECNLCAKLFAC  278 (360)
Q Consensus       253 ~l~~H~~~h~~~~~~~C~~C~~~f~~  278 (360)
                      +|.+|+++|+|++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999999999999999864


No 21 
>PHA00616 hypothetical protein
Probab=98.43  E-value=9e-08  Score=56.90  Aligned_cols=25  Identities=28%  Similarity=0.527  Sum_probs=10.6

Q ss_pred             cccccchhhhcCHHHHHHHHhhhcC
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRRHEG  319 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~h~~  319 (360)
                      |+|+.||+.|...+.|..|+++|+|
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg   26 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHK   26 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcC
Confidence            3444444444444444444444433


No 22 
>PHA00616 hypothetical protein
Probab=98.40  E-value=1.9e-07  Score=55.52  Aligned_cols=33  Identities=21%  Similarity=0.459  Sum_probs=19.5

Q ss_pred             cccccccccccCChhHHHHhHhhhcCCCccccc
Q psy6525         266 VHECNLCAKLFACKRSLQDHMQRHEEPNKYQCA  298 (360)
Q Consensus       266 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~  298 (360)
                      ||+|+.||+.|..++.|..|++.|+|++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            355666666666666666666666666555554


No 23 
>PHA00732 hypothetical protein
Probab=98.40  E-value=1.5e-07  Score=64.95  Aligned_cols=47  Identities=26%  Similarity=0.586  Sum_probs=28.8

Q ss_pred             cccccccccccCChhHHHHhHhh-hcCCCccccccchhhhcCHHHHHHHHhhhc
Q psy6525         266 VHECNLCAKLFACKRSLQDHMQR-HEEPNKYQCAMCKKQYASKKMLEKHIRRHE  318 (360)
Q Consensus       266 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~  318 (360)
                      ||.|..|++.|.+..+|..|++. |.   ++.|+.|++.|.   .|..|.++..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            45667777777777777777663 43   246666666666   3566665443


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.32  E-value=7.8e-07  Score=57.02  Aligned_cols=50  Identities=26%  Similarity=0.539  Sum_probs=31.3

Q ss_pred             ccccccchhhhcCHHHHHHHHhh-hcC--CcccccccccccCChHHHHHHHHHhCC
Q psy6525         294 KYQCAMCKKQYASKKMLEKHIRR-HEG--QDYKCYICGNRYATQKYLEEHIRLHQG  346 (360)
Q Consensus       294 ~~~C~~C~~~f~~~~~L~~H~~~-h~~--~~~~C~~C~~~f~~~~~l~~H~~~h~g  346 (360)
                      .|.|++|++ ..+...|..|... |.+  +.+.|++|...++  .+|..|+..++|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            366777777 4455667777664 333  3567777776544  377777776654


No 25 
>PHA00732 hypothetical protein
Probab=98.26  E-value=4.6e-07  Score=62.53  Aligned_cols=36  Identities=31%  Similarity=0.716  Sum_probs=17.4

Q ss_pred             cccccchhhhcCHHHHHHHHhh-hcCCcccccccccccC
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRR-HEGQDYKCYICGNRYA  332 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~-h~~~~~~C~~C~~~f~  332 (360)
                      |.|+.|++.|.+...|..|++. |.  ++.|+.||+.|.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~   38 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR   38 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC
Confidence            4455555555555555555542 32  234555555554


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.03  E-value=3.2e-06  Score=43.74  Aligned_cols=23  Identities=43%  Similarity=1.051  Sum_probs=15.6

Q ss_pred             ccccccccccCChHHHHHHHHHh
Q psy6525         322 YKCYICGNRYATQKYLEEHIRLH  344 (360)
Q Consensus       322 ~~C~~C~~~f~~~~~l~~H~~~h  344 (360)
                      |+|++|++.|.++..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56777777777777777776654


No 27 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.94  E-value=5.2e-06  Score=61.02  Aligned_cols=71  Identities=21%  Similarity=0.481  Sum_probs=13.4

Q ss_pred             ccccccccCChhHHHHhHhhhcCCCccccccchhhhcCHHHHHHHHhhhcCCcccccccccccCChHHHHHHHHH
Q psy6525         269 CNLCAKLFACKRSLQDHMQRHEEPNKYQCAMCKKQYASKKMLEKHIRRHEGQDYKCYICGNRYATQKYLEEHIRL  343 (360)
Q Consensus       269 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~  343 (360)
                      |.+|+..|.+...|..|+...++...-    ....+.....+..+++.-....+.|.+|++.|.+...|..||+.
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             ---------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccc----cccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcC
Confidence            555555555555555555443321100    11111222333333332222345566666666666666666554


No 28 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.93  E-value=1.5e-05  Score=51.04  Aligned_cols=49  Identities=16%  Similarity=0.139  Sum_probs=26.0

Q ss_pred             eecccchhccCChHHHHHHHhhccCCCCCccccccccccccChHHHHHHHHH
Q psy6525         100 VLCYICDEILKDIDDLRYHGLLHATPLGTQFQCNVCFLMLNNRCYTRFHLLK  151 (360)
Q Consensus       100 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  151 (360)
                      |.|++|++ .-+...|..|....|....+.+.||+|...+.  ..|..|+..
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~   51 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNS   51 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHH
Confidence            56666666 34455666665554444344566666655333  245555543


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.84  E-value=8.2e-06  Score=42.17  Aligned_cols=22  Identities=45%  Similarity=1.100  Sum_probs=12.5

Q ss_pred             cccccchhhhcCHHHHHHHHhh
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRR  316 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~  316 (360)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4555555555555555555554


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.77  E-value=1.8e-05  Score=41.27  Aligned_cols=24  Identities=33%  Similarity=0.941  Sum_probs=13.2

Q ss_pred             ccccccccccCChHHHHHHHHHhC
Q psy6525         322 YKCYICGNRYATQKYLEEHIRLHQ  345 (360)
Q Consensus       322 ~~C~~C~~~f~~~~~l~~H~~~h~  345 (360)
                      |.|++|++.|.+...|..|+++|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666553


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.69  E-value=2.7e-05  Score=57.18  Aligned_cols=22  Identities=41%  Similarity=0.753  Sum_probs=0.0

Q ss_pred             cccccccccCHHHHHHHHHHcC
Q psy6525         159 CDLCSRTFNSQSYLQQHKKHDH  180 (360)
Q Consensus       159 C~~C~~~f~~~~~l~~H~~~~h  180 (360)
                      |.+|+..|.+...|..||...|
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H   23 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKH   23 (100)
T ss_dssp             ----------------------
T ss_pred             cccccccccccccccccccccc
Confidence            4444444444444444444433


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.64  E-value=2.7e-05  Score=41.95  Aligned_cols=25  Identities=32%  Similarity=0.699  Sum_probs=15.7

Q ss_pred             cccccccccccCChHHHHHHHHHhC
Q psy6525         321 DYKCYICGNRYATQKYLEEHIRLHQ  345 (360)
Q Consensus       321 ~~~C~~C~~~f~~~~~l~~H~~~h~  345 (360)
                      ||+|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4566666666666666666666554


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.61  E-value=3.8e-05  Score=39.98  Aligned_cols=23  Identities=43%  Similarity=0.996  Sum_probs=13.6

Q ss_pred             cccccchhhhcCHHHHHHHHhhh
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRRH  317 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~h  317 (360)
                      |.|++|++.|.+...|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666654


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.50  E-value=4.6e-05  Score=41.05  Aligned_cols=25  Identities=32%  Similarity=0.689  Sum_probs=16.1

Q ss_pred             ccccccchhhhcCHHHHHHHHhhhc
Q psy6525         294 KYQCAMCKKQYASKKMLEKHIRRHE  318 (360)
Q Consensus       294 ~~~C~~C~~~f~~~~~L~~H~~~h~  318 (360)
                      ||.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4666666666666666666666553


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.40  E-value=4.2e-05  Score=65.27  Aligned_cols=27  Identities=30%  Similarity=0.670  Sum_probs=22.5

Q ss_pred             Cccccccc--ccccccCHHHHHHHHHHcC
Q psy6525         154 WVRFKCDL--CSRTFNSQSYLQQHKKHDH  180 (360)
Q Consensus       154 ~~~~~C~~--C~~~f~~~~~l~~H~~~~h  180 (360)
                      .+||+|++  |+|.|.+...|+.|+..-|
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH  375 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGH  375 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccc
Confidence            57888887  8899999999998887755


No 36 
>KOG1146|consensus
Probab=97.32  E-value=4.1e-05  Score=77.25  Aligned_cols=50  Identities=18%  Similarity=0.263  Sum_probs=35.9

Q ss_pred             Cccccccchhhhc-CHHHHHHHHhhh-------cCCcccccccccccCChHHHHHHHH
Q psy6525         293 NKYQCAMCKKQYA-SKKMLEKHIRRH-------EGQDYKCYICGNRYATQKYLEEHIR  342 (360)
Q Consensus       293 ~~~~C~~C~~~f~-~~~~L~~H~~~h-------~~~~~~C~~C~~~f~~~~~l~~H~~  342 (360)
                      +.+.|-+|..--. +...|+.|..+-       .|..|.|.+|.+.-..+.++..|.+
T Consensus       733 k~~~civcd~~st~~l~~l~~h~~~~rs~ke~v~g~~~~c~l~~y~t~~kanfqlh~K  790 (1406)
T KOG1146|consen  733 KVFDCIVCDVFSTDRLDQLWFHNTRERSRKEQVPGDVPSCKLKPYATNTKANFQLHNK  790 (1406)
T ss_pred             HHHHHhhhhhhhhhhHHHHhhcchhhhhhhhcccCCCCcceecccccccchhhhhhcc
Confidence            3477888876443 566777786543       2356899999988888888888854


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.29  E-value=6.1e-05  Score=64.29  Aligned_cols=51  Identities=29%  Similarity=0.751  Sum_probs=41.0

Q ss_pred             CCcccccc--chhhhcCHHHHHHHHhh-h-------------------cCCcccccccccccCChHHHHHHHH
Q psy6525         292 PNKYQCAM--CKKQYASKKMLEKHIRR-H-------------------EGQDYKCYICGNRYATQKYLEEHIR  342 (360)
Q Consensus       292 ~~~~~C~~--C~~~f~~~~~L~~H~~~-h-------------------~~~~~~C~~C~~~f~~~~~l~~H~~  342 (360)
                      ++||+|++  |.|.|.+...|+.|+.- |                   ..+||+|++|+|.+++...|+.|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            58888877  88888888888888763 3                   1258999999999999999998864


No 38 
>KOG2231|consensus
Probab=97.09  E-value=0.001  Score=63.86  Aligned_cols=23  Identities=30%  Similarity=0.686  Sum_probs=13.6

Q ss_pred             ccccccccccCHHHHHHHHHHcCC
Q psy6525         158 KCDLCSRTFNSQSYLQQHKKHDHE  181 (360)
Q Consensus       158 ~C~~C~~~f~~~~~l~~H~~~~h~  181 (360)
                      .|..| -.|.+...|+.|+...|.
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~  139 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHK  139 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhh
Confidence            45566 556666666666655443


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.05  E-value=0.00051  Score=36.21  Aligned_cols=24  Identities=38%  Similarity=0.908  Sum_probs=14.1

Q ss_pred             ccccccccccCChHHHHHHHHHhC
Q psy6525         322 YKCYICGNRYATQKYLEEHIRLHQ  345 (360)
Q Consensus       322 ~~C~~C~~~f~~~~~l~~H~~~h~  345 (360)
                      |+|+.|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            356666666666666666665543


No 40 
>KOG2231|consensus
Probab=97.02  E-value=0.0017  Score=62.45  Aligned_cols=97  Identities=24%  Similarity=0.484  Sum_probs=59.0

Q ss_pred             ccCChHHHHHHHhhccCCCCCcccccccc---------ccccChHHHHHHHHHcCC------cccccccccccccCHHHH
Q psy6525         108 ILKDIDDLRYHGLLHATPLGTQFQCNVCF---------LMLNNRCYTRFHLLKHNW------VRFKCDLCSRTFNSQSYL  172 (360)
Q Consensus       108 ~f~~~~~l~~H~~~~~~~~~~~~~C~~C~---------~~f~~~~~l~~H~~~h~~------~~~~C~~C~~~f~~~~~l  172 (360)
                      .|+++..|+.|+...|.    .+.|.+|-         ....++..|..|+..-..      ..-.|..|...|-....|
T Consensus       123 ~~~s~~~Lk~H~~~~H~----~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el  198 (669)
T KOG2231|consen  123 EFKSVENLKNHMRDQHK----LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDEL  198 (669)
T ss_pred             chhHHHHHHHHHHHhhh----hhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHH
Confidence            33477788888765443    35555552         223455566666654321      124677788778777888


Q ss_pred             HHHHHHcCCCceeecccc------cccccChhHHHHHHHhcCCCCCcCc
Q psy6525         173 QQHKKHDHEGVKYKCKEC------GKCYTQNTNLKQHMLSHKGIFFICF  215 (360)
Q Consensus       173 ~~H~~~~h~~~~~~C~~C------~~~f~~~~~l~~H~~~h~~~~~~C~  215 (360)
                      ..|++..|    |.|..|      +..|.....|..|.+.++   |.|.
T Consensus       199 ~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H---flCE  240 (669)
T KOG2231|consen  199 YRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH---FLCE  240 (669)
T ss_pred             HHhhccce----eheeecCcccccchhcccchHHHHHhhhcC---cccc
Confidence            87777755    445555      344666777777777765   4555


No 41 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.93  E-value=0.00053  Score=35.64  Aligned_cols=24  Identities=29%  Similarity=0.659  Sum_probs=13.6

Q ss_pred             ccccccccccCChHHHHHHHHHhCC
Q psy6525         322 YKCYICGNRYATQKYLEEHIRLHQG  346 (360)
Q Consensus       322 ~~C~~C~~~f~~~~~l~~H~~~h~g  346 (360)
                      |+|+.|+.... ...|..|++.|+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            45666666665 6666666666543


No 42 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.83  E-value=0.0011  Score=34.88  Aligned_cols=23  Identities=43%  Similarity=0.957  Sum_probs=15.1

Q ss_pred             cccccchhhhcCHHHHHHHHhhh
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRRH  317 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~h  317 (360)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45666666666666666666654


No 43 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.76  E-value=0.00062  Score=41.49  Aligned_cols=28  Identities=25%  Similarity=0.504  Sum_probs=15.7

Q ss_pred             CcccccccccccCChHHHHHHHHHhCCC
Q psy6525         320 QDYKCYICGNRYATQKYLEEHIRLHQGH  347 (360)
Q Consensus       320 ~~~~C~~C~~~f~~~~~l~~H~~~h~g~  347 (360)
                      .|-.|++|+..+.+..+|++|+.++|+.
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            4666777777777777777777666553


No 44 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.70  E-value=0.0021  Score=55.85  Aligned_cols=127  Identities=19%  Similarity=0.353  Sum_probs=79.2

Q ss_pred             ceeccc--chhccCChHHHHHHHhhccCCCCCcccccccc---ccc------cChHHHHHHHHHcCC-----cccccccc
Q psy6525          99 NVLCYI--CDEILKDIDDLRYHGLLHATPLGTQFQCNVCF---LML------NNRCYTRFHLLKHNW-----VRFKCDLC  162 (360)
Q Consensus        99 ~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~---~~f------~~~~~l~~H~~~h~~-----~~~~C~~C  162 (360)
                      .|.|+.  |......+..|..|....|+    .+.|.+|-   +.|      .+...|+.|...-..     ..-.|..|
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~----~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC  226 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHG----FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFC  226 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcC----cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhc
Confidence            367875  77777778899999887665    36787772   223      234455555443221     12358888


Q ss_pred             cccccCHHHHHHHHHHcCCCceeeccccccc-------ccChhHHHHHHHhcCCCCCcCcc--cc----ccccCHHHHHH
Q psy6525         163 SRTFNSQSYLQQHKKHDHEGVKYKCKECGKC-------YTQNTNLKQHMLSHKGIFFICFH--CN----KNFTHRALLVR  229 (360)
Q Consensus       163 ~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~-------f~~~~~l~~H~~~h~~~~~~C~~--C~----~~f~~~~~l~~  229 (360)
                      ...|-+...|.+|++..|.    .|.+|++.       |.+...|..|.+.-+   |.|..  |-    .+|.....|..
T Consensus       227 ~~~FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h---y~ct~qtc~~~k~~vf~~~~el~~  299 (493)
T COG5236         227 KIYFYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH---YCCTFQTCRVGKCYVFPYHTELLE  299 (493)
T ss_pred             cceecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhcCc---eEEEEEEEecCcEEEeccHHHHHH
Confidence            8888888888888887664    35555433       667777777766532   33332  21    35677777777


Q ss_pred             HHhhcCC
Q psy6525         230 HMQKHSS  236 (360)
Q Consensus       230 H~~~h~~  236 (360)
                      |+..-|+
T Consensus       300 h~~~~h~  306 (493)
T COG5236         300 HLTRFHK  306 (493)
T ss_pred             HHHHHhh
Confidence            7665443


No 45 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.54  E-value=0.0013  Score=34.42  Aligned_cols=22  Identities=27%  Similarity=0.818  Sum_probs=15.0

Q ss_pred             ccccccccccCChHHHHHHHHH
Q psy6525         322 YKCYICGNRYATQKYLEEHIRL  343 (360)
Q Consensus       322 ~~C~~C~~~f~~~~~l~~H~~~  343 (360)
                      |.|.+|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4577777777777777777654


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.44  E-value=0.0016  Score=51.68  Aligned_cols=34  Identities=26%  Similarity=0.512  Sum_probs=17.4

Q ss_pred             cccccccccccCChHHHHHHHHHhCCC-CccCCCccccc
Q psy6525         321 DYKCYICGNRYATQKYLEEHIRLHQGH-TYMCNAKFSFN  358 (360)
Q Consensus       321 ~~~C~~C~~~f~~~~~l~~H~~~h~g~-~~~C~~c~~~f  358 (360)
                      +|.|. |+.   ....+..|.++|+|+ +|.|..|+..|
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCcee
Confidence            45554 544   444455555555554 45555555544


No 47 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.43  E-value=0.0025  Score=38.87  Aligned_cols=19  Identities=21%  Similarity=0.670  Sum_probs=5.9

Q ss_pred             ccccchhhhcCHHHHHHHH
Q psy6525         296 QCAMCKKQYASKKMLEKHI  314 (360)
Q Consensus       296 ~C~~C~~~f~~~~~L~~H~  314 (360)
                      .|++|+..+.+..+|++|+
T Consensus        26 tCP~C~a~~~~srnLrRHl   44 (54)
T PF09237_consen   26 TCPICGAVIRQSRNLRRHL   44 (54)
T ss_dssp             E-TTT--EESSHHHHHHHH
T ss_pred             CCCcchhhccchhhHHHHH
Confidence            3333333333333333333


No 48 
>KOG2785|consensus
Probab=96.43  E-value=0.0086  Score=53.12  Aligned_cols=23  Identities=26%  Similarity=0.520  Sum_probs=19.7

Q ss_pred             ccccccccccccChHHHHHHHHH
Q psy6525         129 QFQCNVCFLMLNNRCYTRFHLLK  151 (360)
Q Consensus       129 ~~~C~~C~~~f~~~~~l~~H~~~  151 (360)
                      -|.|.-|...|.+....+.|+++
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKS   25 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKS   25 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhh
Confidence            48899999999998888888865


No 49 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.39  E-value=0.0021  Score=33.35  Aligned_cols=23  Identities=35%  Similarity=0.873  Sum_probs=12.0

Q ss_pred             cccccchhhhcCHHHHHHHHhhhc
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRRHE  318 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~h~  318 (360)
                      |+|+.|+.... ...|..|++.|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666665555 556666665543


No 50 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.23  E-value=0.0025  Score=33.35  Aligned_cols=20  Identities=35%  Similarity=0.934  Sum_probs=8.6

Q ss_pred             ccccchhhhcCHHHHHHHHh
Q psy6525         296 QCAMCKKQYASKKMLEKHIR  315 (360)
Q Consensus       296 ~C~~C~~~f~~~~~L~~H~~  315 (360)
                      .|++|++.|.+...|..|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            34444444444444444443


No 51 
>PRK04860 hypothetical protein; Provisional
Probab=96.13  E-value=0.0029  Score=50.24  Aligned_cols=26  Identities=15%  Similarity=0.415  Sum_probs=12.0

Q ss_pred             hhHHHHhHhhhcCCCccccccchhhh
Q psy6525         279 KRSLQDHMQRHEEPNKYQCAMCKKQY  304 (360)
Q Consensus       279 ~~~l~~H~~~h~~~~~~~C~~C~~~f  304 (360)
                      ...+++|.++|+++++|.|..|+..|
T Consensus       128 ~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        128 QLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             eCHHHHHHHHhcCCccEECCCCCcee
Confidence            33444444444444444444444444


No 52 
>KOG2785|consensus
Probab=96.11  E-value=0.018  Score=51.14  Aligned_cols=50  Identities=22%  Similarity=0.523  Sum_probs=36.5

Q ss_pred             ccccccchhhhcCHHHHHHHHhhhcC------------------------Ccccccccc---cccCChHHHHHHHHH
Q psy6525         294 KYQCAMCKKQYASKKMLEKHIRRHEG------------------------QDYKCYICG---NRYATQKYLEEHIRL  343 (360)
Q Consensus       294 ~~~C~~C~~~f~~~~~L~~H~~~h~~------------------------~~~~C~~C~---~~f~~~~~l~~H~~~  343 (360)
                      |-.|-.|++.+.+...-..||..+||                        ..|.|-.|+   +.|.+..+.+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            45566677777776666677766654                        127788888   888999999999864


No 53 
>KOG2482|consensus
Probab=95.76  E-value=0.012  Score=51.28  Aligned_cols=137  Identities=18%  Similarity=0.300  Sum_probs=78.6

Q ss_pred             Cceecccchhcc-CChHHHHHHHh-hccCCCCC-------------------ccccccccccccChHHHHHHHHHcCCc-
Q psy6525          98 KNVLCYICDEIL-KDIDDLRYHGL-LHATPLGT-------------------QFQCNVCFLMLNNRCYTRFHLLKHNWV-  155 (360)
Q Consensus        98 ~~~~C~~C~~~f-~~~~~l~~H~~-~~~~~~~~-------------------~~~C~~C~~~f~~~~~l~~H~~~h~~~-  155 (360)
                      ....|-.|...+ .+++....|+. .|.-..+.                   .+.|-.|.+.|.++..|+.||+.-+.+ 
T Consensus       143 fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrr  222 (423)
T KOG2482|consen  143 FSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRR  222 (423)
T ss_pred             eeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCcc
Confidence            346799998888 55666777764 33322221                   357888888888888888888764211 


Q ss_pred             --c-------c-c--cccccccccCH-HHHHHHHHHc-------------CCCc--eeecccccccccChhHHHHHHHhc
Q psy6525         156 --R-------F-K--CDLCSRTFNSQ-SYLQQHKKHD-------------HEGV--KYKCKECGKCYTQNTNLKQHMLSH  207 (360)
Q Consensus       156 --~-------~-~--C~~C~~~f~~~-~~l~~H~~~~-------------h~~~--~~~C~~C~~~f~~~~~l~~H~~~h  207 (360)
                        |       | .  -..=+++.... ..+.+-....             ++..  ...|-.|.....+...|..||...
T Consensus       223 inPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~v  302 (423)
T KOG2482|consen  223 INPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKIV  302 (423)
T ss_pred             cCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHHH
Confidence              1       0 0  00011111100 0000000000             0111  147888888888788888887753


Q ss_pred             CC----------------------------CCCcCccccccccCHHHHHHHHhhc
Q psy6525         208 KG----------------------------IFFICFHCNKNFTHRALLVRHMQKH  234 (360)
Q Consensus       208 ~~----------------------------~~~~C~~C~~~f~~~~~l~~H~~~h  234 (360)
                      +.                            ....|-.|...|.....|..||..+
T Consensus       303 He~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  303 HEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             HHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence            21                            0245888999999999999998754


No 54 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.70  E-value=0.021  Score=49.79  Aligned_cols=127  Identities=26%  Similarity=0.479  Sum_probs=78.8

Q ss_pred             cccccc--ccccccCHHHHHHHHHHcCCCceeecccccc---ccc------ChhHHHHHHHhcCCC-----CCcCccccc
Q psy6525         156 RFKCDL--CSRTFNSQSYLQQHKKHDHEGVKYKCKECGK---CYT------QNTNLKQHMLSHKGI-----FFICFHCNK  219 (360)
Q Consensus       156 ~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~---~f~------~~~~l~~H~~~h~~~-----~~~C~~C~~  219 (360)
                      .|.|+.  |..+......|..|.+..|+.  +.|.+|-.   .|.      +...|..|...-...     --.|..|..
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~  228 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKI  228 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccc
Confidence            388877  777777788899999887753  66777632   232      334555554432111     136888888


Q ss_pred             cccCHHHHHHHHhhcCCCCcccCCCC----CccCCHHHHHHHHHHhcCCCcccccc--cc----cccCChhHHHHhHhh
Q psy6525         220 NFTHRALLVRHMQKHSSERFKCDLCG----KVTPYYQHYLRHMRIHQGLEVHECNL--CA----KLFACKRSLQDHMQR  288 (360)
Q Consensus       220 ~f~~~~~l~~H~~~h~~~~~~C~~C~----~~f~~~~~l~~H~~~h~~~~~~~C~~--C~----~~f~~~~~l~~H~~~  288 (360)
                      .|..-..|..|++..|..-+.|+.-+    .-|.+...|..|.+.-+    |.|.+  |.    ..|.....|..|+..
T Consensus       229 ~FYdDDEL~~HcR~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~~~k~~vf~~~~el~~h~~~  303 (493)
T COG5236         229 YFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCRVGKCYVFPYHTELLEHLTR  303 (493)
T ss_pred             eecChHHHHHHHHhhhhhhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEecCcEEEeccHHHHHHHHHH
Confidence            88888888888887776534443322    23666677777765432    44433  32    356677777777654


No 55 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.56  E-value=0.0034  Score=33.57  Aligned_cols=21  Identities=19%  Similarity=0.763  Sum_probs=13.0

Q ss_pred             ccccccccccCChHHHHHHHH
Q psy6525         322 YKCYICGNRYATQKYLEEHIR  342 (360)
Q Consensus       322 ~~C~~C~~~f~~~~~l~~H~~  342 (360)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666666654


No 56 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.54  E-value=0.0054  Score=32.79  Aligned_cols=22  Identities=32%  Similarity=0.788  Sum_probs=12.6

Q ss_pred             ccccccccccCChhHHHHhHhh
Q psy6525         267 HECNLCAKLFACKRSLQDHMQR  288 (360)
Q Consensus       267 ~~C~~C~~~f~~~~~l~~H~~~  288 (360)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4555666666666666555543


No 57 
>KOG2482|consensus
Probab=95.34  E-value=0.062  Score=46.98  Aligned_cols=147  Identities=20%  Similarity=0.306  Sum_probs=91.2

Q ss_pred             HHHHHHhhccCCCCCccccccccccc-cChHHHHHHHH-HcC---Cc-------------------ccccccccccccCH
Q psy6525         114 DLRYHGLLHATPLGTQFQCNVCFLML-NNRCYTRFHLL-KHN---WV-------------------RFKCDLCSRTFNSQ  169 (360)
Q Consensus       114 ~l~~H~~~~~~~~~~~~~C~~C~~~f-~~~~~l~~H~~-~h~---~~-------------------~~~C~~C~~~f~~~  169 (360)
                      .|+.|++.-.+ .....+|-.|+..+ .+++....|+. .|+   ..                   .+.|-.|.+.|+++
T Consensus       130 aLeqqQ~Ered-t~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdk  208 (423)
T KOG2482|consen  130 ALEQQQKERED-TIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDK  208 (423)
T ss_pred             HHHHHHHHhcC-CeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCc
Confidence            34455543322 24567899998765 45677777774 343   11                   37899999999999


Q ss_pred             HHHHHHHHHcCCCc--e--------eecc--cccccccCh-hHHH-----HHHH---------hcCCC--CCcCcccccc
Q psy6525         170 SYLQQHKKHDHEGV--K--------YKCK--ECGKCYTQN-TNLK-----QHML---------SHKGI--FFICFHCNKN  220 (360)
Q Consensus       170 ~~l~~H~~~~h~~~--~--------~~C~--~C~~~f~~~-~~l~-----~H~~---------~h~~~--~~~C~~C~~~  220 (360)
                      ..|+.||+.....+  |        |.=.  .=|++.... +.+.     .+..         .+...  ...|-.|...
T Consensus       209 ntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~  288 (423)
T KOG2482|consen  209 NTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNF  288 (423)
T ss_pred             HHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccc
Confidence            99999998643221  1        1110  011211110 0010     0000         00111  2589999999


Q ss_pred             ccCHHHHHHHHhhcCCC----------------------------CcccCCCCCccCCHHHHHHHHHHh
Q psy6525         221 FTHRALLVRHMQKHSSE----------------------------RFKCDLCGKVTPYYQHYLRHMRIH  261 (360)
Q Consensus       221 f~~~~~l~~H~~~h~~~----------------------------~~~C~~C~~~f~~~~~l~~H~~~h  261 (360)
                      ..+...|..||+..|.-                            ...|-.|...|.....|..||..+
T Consensus       289 ~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  289 YENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             hhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence            99999999999865520                            135889999999999999998743


No 58 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.79  E-value=0.025  Score=29.58  Aligned_cols=21  Identities=33%  Similarity=0.849  Sum_probs=13.0

Q ss_pred             ccccccccccCChHHHHHHHHH
Q psy6525         322 YKCYICGNRYATQKYLEEHIRL  343 (360)
Q Consensus       322 ~~C~~C~~~f~~~~~l~~H~~~  343 (360)
                      ..|+.||+.| ..+.|..|+++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3566777776 55566666653


No 59 
>KOG1146|consensus
Probab=94.59  E-value=0.004  Score=63.59  Aligned_cols=24  Identities=29%  Similarity=0.393  Sum_probs=16.5

Q ss_pred             CCCcCccccccccCHHHHHHHHhh
Q psy6525         210 IFFICFHCNKNFTHRALLVRHMQK  233 (360)
Q Consensus       210 ~~~~C~~C~~~f~~~~~l~~H~~~  233 (360)
                      .+|.|..|...+....+|..|++.
T Consensus       517 ~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  517 KPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CcccceeeeeeeecchHHHHHHHH
Confidence            466777777777777777777653


No 60 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=93.66  E-value=0.051  Score=28.36  Aligned_cols=18  Identities=28%  Similarity=0.737  Sum_probs=8.1

Q ss_pred             cccccccccCChhHHHHhH
Q psy6525         268 ECNLCAKLFACKRSLQDHM  286 (360)
Q Consensus       268 ~C~~C~~~f~~~~~l~~H~  286 (360)
                      .|+.||+.| ....|.+|+
T Consensus         4 ~C~~CgR~F-~~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHE   21 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHH
Confidence            344444444 334444443


No 61 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.34  E-value=0.014  Score=54.96  Aligned_cols=116  Identities=24%  Similarity=0.449  Sum_probs=65.6

Q ss_pred             CcccCCCCCccCCHHHHHHHHH--HhcCC--Cccccc--ccccccCChhHHHHhHhhhcCCCccc---------------
Q psy6525         238 RFKCDLCGKVTPYYQHYLRHMR--IHQGL--EVHECN--LCAKLFACKRSLQDHMQRHEEPNKYQ---------------  296 (360)
Q Consensus       238 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~---------------  296 (360)
                      ++.|..|...|.....|..|.+  .|.++  +++.|+  .|++.|.+...+..|...|.+..++.               
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLLN  368 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCccccccccC
Confidence            3455555555555555555555  45555  555555  45555555555555555554433322               


Q ss_pred             --------------------ccc--chhhhcCHHHHHHHHhhhcC---CcccccccccccCChHHHHHHHHHhCCC-Ccc
Q psy6525         297 --------------------CAM--CKKQYASKKMLEKHIRRHEG---QDYKCYICGNRYATQKYLEEHIRLHQGH-TYM  350 (360)
Q Consensus       297 --------------------C~~--C~~~f~~~~~L~~H~~~h~~---~~~~C~~C~~~f~~~~~l~~H~~~h~g~-~~~  350 (360)
                                          +..  |...+.+...+..|...|..   ..+.+..|.+.|.....+..|++.|.-. +..
T Consensus       369 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  448 (467)
T COG5048         369 NEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAPLL  448 (467)
T ss_pred             CCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCCcee
Confidence                                211  44444444445555444433   2466778888888888888888887766 333


Q ss_pred             CCC
Q psy6525         351 CNA  353 (360)
Q Consensus       351 C~~  353 (360)
                      |..
T Consensus       449 ~~~  451 (467)
T COG5048         449 CSI  451 (467)
T ss_pred             ecc
Confidence            433


No 62 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.96  E-value=0.066  Score=30.42  Aligned_cols=22  Identities=18%  Similarity=0.683  Sum_probs=16.5

Q ss_pred             cccccccccccCChHHHHHHHH
Q psy6525         321 DYKCYICGNRYATQKYLEEHIR  342 (360)
Q Consensus       321 ~~~C~~C~~~f~~~~~l~~H~~  342 (360)
                      +|.|.+|++.|.+...+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4677888888887777777765


No 63 
>KOG4173|consensus
Probab=92.45  E-value=0.13  Score=41.71  Aligned_cols=78  Identities=18%  Similarity=0.391  Sum_probs=59.1

Q ss_pred             Cceeccc--chhccCChHHHHHHHhhccCCCCCccccccccccccChHHHHHHHHHcC-----------Cccccccc--c
Q psy6525          98 KNVLCYI--CDEILKDIDDLRYHGLLHATPLGTQFQCNVCFLMLNNRCYTRFHLLKHN-----------WVRFKCDL--C  162 (360)
Q Consensus        98 ~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-----------~~~~~C~~--C  162 (360)
                      ..+.|.+  |...|........|...-|+     -.|.+|.+.|.+...|..|+...+           ...|.|-+  |
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~-----~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgC  152 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG-----NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGC  152 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc-----chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhh
Confidence            4577886  89999999999999876665     359999999999999999986532           23466754  7


Q ss_pred             cccccCHHHHHHHHHHcC
Q psy6525         163 SRTFNSQSYLQQHKKHDH  180 (360)
Q Consensus       163 ~~~f~~~~~l~~H~~~~h  180 (360)
                      +..|.+...-..||-..|
T Consensus       153 t~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  153 TEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhhhhhHHHHhc
Confidence            777777777777776555


No 64 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.42  E-value=0.085  Score=29.96  Aligned_cols=23  Identities=17%  Similarity=0.670  Sum_probs=17.7

Q ss_pred             ccccccchhhhcCHHHHHHHHhh
Q psy6525         294 KYQCAMCKKQYASKKMLEKHIRR  316 (360)
Q Consensus       294 ~~~C~~C~~~f~~~~~L~~H~~~  316 (360)
                      +|.|++|++.|.+...+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57788888888888888888763


No 65 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.78  E-value=0.026  Score=53.03  Aligned_cols=49  Identities=20%  Similarity=0.333  Sum_probs=34.0

Q ss_pred             cccccCChhHHHHhHhhhcCCC--ccccccchhhhcCHHHHHHHHhhhcCC
Q psy6525         272 CAKLFACKRSLQDHMQRHEEPN--KYQCAMCKKQYASKKMLEKHIRRHEGQ  320 (360)
Q Consensus       272 C~~~f~~~~~l~~H~~~h~~~~--~~~C~~C~~~f~~~~~L~~H~~~h~~~  320 (360)
                      |...+.....+..|...|...+  .+.+..|.+.+.....+..|++.|...
T Consensus       394 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  444 (467)
T COG5048         394 CIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNH  444 (467)
T ss_pred             hhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccC
Confidence            5566666666777766666555  355667888888877787887777664


No 66 
>KOG2893|consensus
Probab=91.74  E-value=0.06  Score=44.51  Aligned_cols=42  Identities=36%  Similarity=0.691  Sum_probs=23.7

Q ss_pred             ccccccccccCHHHHHHHHHHcCCCceeecccccccccChhHHHHH
Q psy6525         158 KCDLCSRTFNSQSYLQQHKKHDHEGVKYKCKECGKCYTQNTNLKQH  203 (360)
Q Consensus       158 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H  203 (360)
                      .|-.|++.|.+..-|..|++..|    |+|.+|.+..-+--.|..|
T Consensus        12 wcwycnrefddekiliqhqkakh----fkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAKH----FKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhhhcc----ceeeeehhhhccCCCceee
Confidence            45566666666666666655533    5566666555555455444


No 67 
>KOG4173|consensus
Probab=89.92  E-value=0.12  Score=41.86  Aligned_cols=76  Identities=21%  Similarity=0.542  Sum_probs=41.0

Q ss_pred             ccccc--ccccccCHHHHHHHHHHcCCCceeecccccccccChhHHHHHHHhcCC-----------CCCcCcc--ccccc
Q psy6525         157 FKCDL--CSRTFNSQSYLQQHKKHDHEGVKYKCKECGKCYTQNTNLKQHMLSHKG-----------IFFICFH--CNKNF  221 (360)
Q Consensus       157 ~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-----------~~~~C~~--C~~~f  221 (360)
                      |.|++  |...|.+...+..|+..-|+.   .|..|.+.|.+...|..|+...+.           ..|.|-.  |+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            55555  555666666666666555543   366666666666666666544321           1344433  55555


Q ss_pred             cCHHHHHHHHhhcC
Q psy6525         222 THRALLVRHMQKHS  235 (360)
Q Consensus       222 ~~~~~l~~H~~~h~  235 (360)
                      .+...-..|+...|
T Consensus       157 kT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  157 KTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhHHHHhc
Confidence            55555555554433


No 68 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.75  E-value=0.17  Score=28.40  Aligned_cols=6  Identities=50%  Similarity=1.586  Sum_probs=2.3

Q ss_pred             cCCCCC
Q psy6525         241 CDLCGK  246 (360)
Q Consensus       241 C~~C~~  246 (360)
                      |..||.
T Consensus         4 C~~CGy    9 (33)
T cd00350           4 CPVCGY    9 (33)
T ss_pred             CCCCCC
Confidence            333333


No 69 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=89.42  E-value=0.35  Score=35.57  Aligned_cols=48  Identities=19%  Similarity=0.389  Sum_probs=25.8

Q ss_pred             cccchhhhcCHHHHHHHHhhhcCCcccccccccccCChHHHHHHHHHhC
Q psy6525         297 CAMCKKQYASKKMLEKHIRRHEGQDYKCYICGNRYATQKYLEEHIRLHQ  345 (360)
Q Consensus       297 C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~  345 (360)
                      |--|...|........=. .-....|+|+.|...|=-.-++-.|..+|.
T Consensus        58 C~~C~~~f~~~~~~~~~~-~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        58 CFGCQGPFPKPPVSPFDE-LKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             ccCcCCCCCCcccccccc-cccccceeCCCCCCccccccchhhhhhccC
Confidence            666777666543111000 011135777777777766666666665554


No 70 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=89.09  E-value=0.59  Score=34.67  Aligned_cols=25  Identities=32%  Similarity=0.696  Sum_probs=23.3

Q ss_pred             ccc----cccccccCChHHHHHHHHHhCC
Q psy6525         322 YKC----YICGNRYATQKYLEEHIRLHQG  346 (360)
Q Consensus       322 ~~C----~~C~~~f~~~~~l~~H~~~h~g  346 (360)
                      |.|    ..|++...+...|..|++.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999998886


No 71 
>KOG2893|consensus
Probab=88.88  E-value=0.11  Score=43.06  Aligned_cols=46  Identities=24%  Similarity=0.400  Sum_probs=27.4

Q ss_pred             cccccccccChHHHHHHHHHcCCcccccccccccccCHHHHHHHHHHcC
Q psy6525         132 CNVCFLMLNNRCYTRFHLLKHNWVRFKCDLCSRTFNSQSYLQQHKKHDH  180 (360)
Q Consensus       132 C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~h  180 (360)
                      |=+|++.|.+...|..|++.-   .|+|-+|-+...+--.|..|....|
T Consensus        13 cwycnrefddekiliqhqkak---hfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAK---HFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeecccccchhhhhhhhhhhc---cceeeeehhhhccCCCceeehhhhh
Confidence            556666666666666665432   2667777666665666666654444


No 72 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=88.74  E-value=0.39  Score=35.36  Aligned_cols=17  Identities=24%  Similarity=0.374  Sum_probs=8.4

Q ss_pred             ccccccccccccChHHH
Q psy6525         129 QFQCNVCFLMLNNRCYT  145 (360)
Q Consensus       129 ~~~C~~C~~~f~~~~~l  145 (360)
                      |..|++|+...-+...|
T Consensus        15 P~~CpiCgLtLVss~HL   31 (112)
T TIGR00622        15 PVECPICGLTLILSTHL   31 (112)
T ss_pred             CCcCCcCCCEEeccchH
Confidence            45555555555444333


No 73 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=88.32  E-value=0.75  Score=34.10  Aligned_cols=25  Identities=40%  Similarity=0.761  Sum_probs=23.0

Q ss_pred             ccc----ccchhhhcCHHHHHHHHhhhcC
Q psy6525         295 YQC----AMCKKQYASKKMLEKHIRRHEG  319 (360)
Q Consensus       295 ~~C----~~C~~~f~~~~~L~~H~~~h~~  319 (360)
                      |.|    ..|++.+.+...+..|++.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999998765


No 74 
>KOG2186|consensus
Probab=87.05  E-value=0.37  Score=40.49  Aligned_cols=46  Identities=22%  Similarity=0.632  Sum_probs=24.6

Q ss_pred             cccccchhhhcCHHHHHHHHhhhcCCcccccccccccCChHHHHHHHH
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRRHEGQDYKCYICGNRYATQKYLEEHIR  342 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~  342 (360)
                      |.|..||....-. .+.+|+.+.++.-|.|-.|++.|.+ ..+..|..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccCCeeEEeeccccccc-chhhhhhh
Confidence            4555555554332 3444655555555666666666655 44555543


No 75 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=84.37  E-value=0.69  Score=28.89  Aligned_cols=27  Identities=15%  Similarity=0.463  Sum_probs=16.0

Q ss_pred             cCCCccccccchhhhcCHHHHHHHHhh
Q psy6525         290 EEPNKYQCAMCKKQYASKKMLEKHIRR  316 (360)
Q Consensus       290 ~~~~~~~C~~C~~~f~~~~~L~~H~~~  316 (360)
                      .|+.-+.|+.|+..|.......+|+..
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            344555666666666666666666554


No 76 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=84.03  E-value=0.45  Score=29.70  Aligned_cols=27  Identities=22%  Similarity=0.439  Sum_probs=23.8

Q ss_pred             cccccccccccCChHHHHHHHHHhCCC
Q psy6525         321 DYKCYICGNRYATQKYLEEHIRLHQGH  347 (360)
Q Consensus       321 ~~~C~~C~~~f~~~~~l~~H~~~h~g~  347 (360)
                      -++|+-||..|....++.+|+..-||-
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVNKaH~~   43 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVNKAHGW   43 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhhHHhhh
Confidence            579999999999999999999876653


No 77 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.34  E-value=0.8  Score=33.74  Aligned_cols=11  Identities=18%  Similarity=0.325  Sum_probs=5.4

Q ss_pred             ccccccccccc
Q psy6525         130 FQCNVCFLMLN  140 (360)
Q Consensus       130 ~~C~~C~~~f~  140 (360)
                      ..|+.||..|.
T Consensus        10 R~Cp~CG~kFY   20 (108)
T PF09538_consen   10 RTCPSCGAKFY   20 (108)
T ss_pred             ccCCCCcchhc
Confidence            44555555544


No 78 
>KOG2186|consensus
Probab=82.12  E-value=0.75  Score=38.76  Aligned_cols=46  Identities=24%  Similarity=0.722  Sum_probs=27.3

Q ss_pred             eecccccccccChhHHHHHHHhcCCCCCcCccccccccCHHHHHHHHh
Q psy6525         185 YKCKECGKCYTQNTNLKQHMLSHKGIFFICFHCNKNFTHRALLVRHMQ  232 (360)
Q Consensus       185 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~  232 (360)
                      |.|..||..... ..+.+|+...++..|.|--|++.|.. ..+..|..
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccCCeeEEeeccccccc-chhhhhhh
Confidence            566666666543 33455666666666666666666665 45555554


No 79 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=79.36  E-value=0.94  Score=25.59  Aligned_cols=6  Identities=50%  Similarity=1.586  Sum_probs=2.2

Q ss_pred             cCCCCC
Q psy6525         241 CDLCGK  246 (360)
Q Consensus       241 C~~C~~  246 (360)
                      |..||.
T Consensus         5 C~~CG~   10 (34)
T cd00729           5 CPVCGY   10 (34)
T ss_pred             CCCCCC
Confidence            333333


No 80 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=78.15  E-value=1.4  Score=23.15  Aligned_cols=8  Identities=38%  Similarity=0.825  Sum_probs=3.6

Q ss_pred             cCCCCCcc
Q psy6525         241 CDLCGKVT  248 (360)
Q Consensus       241 C~~C~~~f  248 (360)
                      |+.||..|
T Consensus        17 Cp~CG~~F   24 (26)
T PF10571_consen   17 CPHCGYDF   24 (26)
T ss_pred             CCCCCCCC
Confidence            44444444


No 81 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=77.07  E-value=1.8  Score=27.61  Aligned_cols=32  Identities=28%  Similarity=0.607  Sum_probs=16.1

Q ss_pred             ccccccchhhhcCHHHHHHHHhhhcCCccccccccc
Q psy6525         294 KYQCAMCKKQYASKKMLEKHIRRHEGQDYKCYICGN  329 (360)
Q Consensus       294 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~  329 (360)
                      .|.|+.||..-..+..-    -+-.+.+|+|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc~~----CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCAK----CRKLGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhhh----HHHcCCceECCCcCc
Confidence            36677777544433221    112345666666664


No 82 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=76.56  E-value=0.34  Score=40.84  Aligned_cols=42  Identities=29%  Similarity=0.615  Sum_probs=22.9

Q ss_pred             CccccccchhhhcCHHHHHHHHhh-h--c-------C-C-----cccccccccccCCh
Q psy6525         293 NKYQCAMCKKQYASKKMLEKHIRR-H--E-------G-Q-----DYKCYICGNRYATQ  334 (360)
Q Consensus       293 ~~~~C~~C~~~f~~~~~L~~H~~~-h--~-------~-~-----~~~C~~C~~~f~~~  334 (360)
                      +.+.||+|++.|.+...+....+. .  .       + .     ...|+.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            345666666666655444444332 1  1       1 1     25688888877644


No 83 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=75.60  E-value=3.8  Score=32.66  Aligned_cols=17  Identities=18%  Similarity=0.313  Sum_probs=8.3

Q ss_pred             eeecccccccccChhHH
Q psy6525         184 KYKCKECGKCYTQNTNL  200 (360)
Q Consensus       184 ~~~C~~C~~~f~~~~~l  200 (360)
                      -|.|+.|+..|+...++
T Consensus       109 ~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAM  125 (158)
T ss_pred             eEECCCCCcEeeHHHHH
Confidence            45555555555444444


No 84 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=74.87  E-value=1.8  Score=34.55  Aligned_cols=11  Identities=27%  Similarity=0.785  Sum_probs=6.6

Q ss_pred             CCCcccccccc
Q psy6525         263 GLEVHECNLCA  273 (360)
Q Consensus       263 ~~~~~~C~~C~  273 (360)
                      |+.|-+||+||
T Consensus       146 ge~P~~CPiCg  156 (166)
T COG1592         146 GEAPEVCPICG  156 (166)
T ss_pred             CCCCCcCCCCC
Confidence            45566666665


No 85 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=74.63  E-value=2.1  Score=33.64  Aligned_cols=14  Identities=29%  Similarity=0.831  Sum_probs=7.3

Q ss_pred             ccccccchhhhcCH
Q psy6525         294 KYQCAMCKKQYASK  307 (360)
Q Consensus       294 ~~~C~~C~~~f~~~  307 (360)
                      -|.|+.|+..|...
T Consensus        99 ~Y~Cp~C~~~y~~~  112 (147)
T smart00531       99 YYKCPNCQSKYTFL  112 (147)
T ss_pred             EEECcCCCCEeeHH
Confidence            35555555555543


No 86 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=73.77  E-value=2.5  Score=31.18  Aligned_cols=11  Identities=27%  Similarity=0.573  Sum_probs=4.5

Q ss_pred             ccccccccccc
Q psy6525         266 VHECNLCAKLF  276 (360)
Q Consensus       266 ~~~C~~C~~~f  276 (360)
                      |..|+.||..|
T Consensus        26 PivCP~CG~~~   36 (108)
T PF09538_consen   26 PIVCPKCGTEF   36 (108)
T ss_pred             CccCCCCCCcc
Confidence            33444444433


No 87 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=73.02  E-value=2.9  Score=33.32  Aligned_cols=30  Identities=17%  Similarity=0.466  Sum_probs=15.6

Q ss_pred             CccccccchhhhcCHHHHHHHHhhhcCCcccccccccc
Q psy6525         293 NKYQCAMCKKQYASKKMLEKHIRRHEGQDYKCYICGNR  330 (360)
Q Consensus       293 ~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~  330 (360)
                      .-|.|+.|+..|+.-.++.        ..|.|+.||..
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~  137 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME--------LNFTCPRCGAM  137 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH--------cCCcCCCCCCE
Confidence            3455555555555555553        13556666554


No 88 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=72.84  E-value=1.2  Score=37.79  Aligned_cols=26  Identities=23%  Similarity=0.373  Sum_probs=16.3

Q ss_pred             CCccccccchhhhcCHHHHHHHHhhh
Q psy6525         292 PNKYQCAMCKKQYASKKMLEKHIRRH  317 (360)
Q Consensus       292 ~~~~~C~~C~~~f~~~~~L~~H~~~h  317 (360)
                      .+++.|+.|+........|..-.|+|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            35677777777666666665555554


No 89 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=72.28  E-value=3.3  Score=23.71  Aligned_cols=33  Identities=21%  Similarity=0.486  Sum_probs=17.7

Q ss_pred             eecccchhccCChHHHHHHHhhccCCCCCccccccccccc
Q psy6525         100 VLCYICDEILKDIDDLRYHGLLHATPLGTQFQCNVCFLML  139 (360)
Q Consensus       100 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~~~f  139 (360)
                      +.|+.|+..|.-..+..       ...+...+|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~i-------p~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKI-------PPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHHC-------CCCCcEEECCCCCCEe
Confidence            45777776665444421       1123456666666655


No 90 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=72.19  E-value=2  Score=25.86  Aligned_cols=25  Identities=28%  Similarity=0.708  Sum_probs=13.1

Q ss_pred             cccccchhhhcCHHHHHHHHhhhcCCccccccccc
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRRHEGQDYKCYICGN  329 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~  329 (360)
                      |.|..||..|.-.          .+.+.+|+.||.
T Consensus         3 Y~C~~Cg~~~~~~----------~~~~irC~~CG~   27 (44)
T smart00659        3 YICGECGRENEIK----------SKDVVRCRECGY   27 (44)
T ss_pred             EECCCCCCEeecC----------CCCceECCCCCc
Confidence            5566666655422          224556666654


No 91 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=71.39  E-value=2.3  Score=24.53  Aligned_cols=6  Identities=33%  Similarity=1.160  Sum_probs=2.2

Q ss_pred             cccccc
Q psy6525         268 ECNLCA  273 (360)
Q Consensus       268 ~C~~C~  273 (360)
                      +|+.|+
T Consensus        27 rC~~C~   32 (37)
T PF13719_consen   27 RCPKCG   32 (37)
T ss_pred             ECCCCC
Confidence            333333


No 92 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=71.37  E-value=2.8  Score=25.20  Aligned_cols=20  Identities=30%  Similarity=0.615  Sum_probs=8.6

Q ss_pred             ccccccccccCCh----HHHHHHH
Q psy6525         322 YKCYICGNRYATQ----KYLEEHI  341 (360)
Q Consensus       322 ~~C~~C~~~f~~~----~~l~~H~  341 (360)
                      .+|.+|++.+...    +.|..|+
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhh
Confidence            4455555555432    4555555


No 93 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=71.13  E-value=0.83  Score=36.08  Aligned_cols=12  Identities=42%  Similarity=0.877  Sum_probs=5.5

Q ss_pred             ccccccccccCC
Q psy6525         267 HECNLCAKLFAC  278 (360)
Q Consensus       267 ~~C~~C~~~f~~  278 (360)
                      ++|+-||++|.+
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            444444444443


No 94 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=70.93  E-value=3.3  Score=25.68  Aligned_cols=10  Identities=30%  Similarity=0.952  Sum_probs=4.8

Q ss_pred             ccccchhhhc
Q psy6525         296 QCAMCKKQYA  305 (360)
Q Consensus       296 ~C~~C~~~f~  305 (360)
                      .|..|++.++
T Consensus        20 ~C~~C~~~l~   29 (50)
T smart00614       20 KCKYCGKKLS   29 (50)
T ss_pred             EecCCCCEee
Confidence            4555555443


No 95 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=70.76  E-value=1  Score=37.94  Aligned_cols=43  Identities=19%  Similarity=0.420  Sum_probs=26.7

Q ss_pred             CcccccccccccCChhHHHHhHhh---h-------cCCCc-----cccccchhhhcCH
Q psy6525         265 EVHECNLCAKLFACKRSLQDHMQR---H-------EEPNK-----YQCAMCKKQYASK  307 (360)
Q Consensus       265 ~~~~C~~C~~~f~~~~~l~~H~~~---h-------~~~~~-----~~C~~C~~~f~~~  307 (360)
                      +.+.||+|+..|..+.-+....+.   .       .+..|     ..|+.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            456777777777766544444432   1       22334     4699999988754


No 96 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=69.97  E-value=3.8  Score=21.48  Aligned_cols=19  Identities=16%  Similarity=0.595  Sum_probs=12.6

Q ss_pred             cccccccccCChHHHHHHHH
Q psy6525         323 KCYICGNRYATQKYLEEHIR  342 (360)
Q Consensus       323 ~C~~C~~~f~~~~~l~~H~~  342 (360)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777776 5566666664


No 97 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=69.80  E-value=2.7  Score=33.59  Aligned_cols=24  Identities=25%  Similarity=0.599  Sum_probs=18.1

Q ss_pred             cccccccccccCChhHHHHhHhhhcCCCccccccchh
Q psy6525         266 VHECNLCAKLFACKRSLQDHMQRHEEPNKYQCAMCKK  302 (360)
Q Consensus       266 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  302 (360)
                      .|.|++||..+             .|+.|-+||+||.
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCCC
Confidence            68888888654             3567888888873


No 98 
>KOG2272|consensus
Probab=69.70  E-value=4.6  Score=34.10  Aligned_cols=125  Identities=22%  Similarity=0.423  Sum_probs=56.2

Q ss_pred             CcccccccccccccCHHHHHHH---H------HHcC-CCceeecccccccccChhHHHHHHHhcCCCCCcCccccccccC
Q psy6525         154 WVRFKCDLCSRTFNSQSYLQQH---K------KHDH-EGVKYKCKECGKCYTQNTNLKQHMLSHKGIFFICFHCNKNFTH  223 (360)
Q Consensus       154 ~~~~~C~~C~~~f~~~~~l~~H---~------~~~h-~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~  223 (360)
                      +.-|.|++|++...+...++.-   +      +... +...|.|..|..-... ..|.---..-++--|.|..|++...+
T Consensus        97 p~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~-~~l~fr~d~yH~yHFkCt~C~keL~s  175 (332)
T KOG2272|consen   97 PACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDE-QPLTFRGDPYHPYHFKCTTCGKELTS  175 (332)
T ss_pred             cccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhccc-ccccccCCCCCccceecccccccccc
Confidence            5567888888776666555421   1      1001 1125777777655443 22211111122234678888777665


Q ss_pred             HHHHHHHHh---hcCCCCcccCCCCCccCCH-HHHHHHHHHhcCCCcccccccccccCChh
Q psy6525         224 RALLVRHMQ---KHSSERFKCDLCGKVTPYY-QHYLRHMRIHQGLEVHECNLCAKLFACKR  280 (360)
Q Consensus       224 ~~~l~~H~~---~h~~~~~~C~~C~~~f~~~-~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  280 (360)
                      .+.-..--.   ..+ ..+.+++|+.--+-. .....-|..|....-|.|..|.+-|..-.
T Consensus       176 daRevk~eLyClrCh-D~mgipiCgaC~rpIeervi~amgKhWHveHFvCa~CekPFlGHr  235 (332)
T KOG2272|consen  176 DAREVKGELYCLRCH-DKMGIPICGACRRPIEERVIFAMGKHWHVEHFVCAKCEKPFLGHR  235 (332)
T ss_pred             hhhhhccceeccccc-cccCCcccccccCchHHHHHHHhccccchhheeehhcCCcccchh
Confidence            432111000   000 124455554321111 11111222333444577888877776543


No 99 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=69.08  E-value=3.1  Score=31.31  Aligned_cols=12  Identities=8%  Similarity=0.027  Sum_probs=5.7

Q ss_pred             cccccccccccc
Q psy6525         156 RFKCDLCSRTFN  167 (360)
Q Consensus       156 ~~~C~~C~~~f~  167 (360)
                      |..|+.||..|.
T Consensus        26 p~vcP~cg~~~~   37 (129)
T TIGR02300        26 PAVSPYTGEQFP   37 (129)
T ss_pred             CccCCCcCCccC
Confidence            444555554443


No 100
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=68.75  E-value=6  Score=32.21  Aligned_cols=16  Identities=19%  Similarity=0.478  Sum_probs=8.2

Q ss_pred             eeecccccccccChhH
Q psy6525         184 KYKCKECGKCYTQNTN  199 (360)
Q Consensus       184 ~~~C~~C~~~f~~~~~  199 (360)
                      -|.|+.|+..|+....
T Consensus       117 ~Y~Cp~C~~rytf~eA  132 (178)
T PRK06266        117 FFFCPNCHIRFTFDEA  132 (178)
T ss_pred             EEECCCCCcEEeHHHH
Confidence            4555555555554444


No 101
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=68.66  E-value=6  Score=31.10  Aligned_cols=14  Identities=21%  Similarity=0.645  Sum_probs=7.7

Q ss_pred             ccccccccccccCH
Q psy6525         156 RFKCDLCSRTFNSQ  169 (360)
Q Consensus       156 ~~~C~~C~~~f~~~  169 (360)
                      -|.|+.|+..|...
T Consensus        99 ~Y~Cp~C~~~y~~~  112 (147)
T smart00531       99 YYKCPNCQSKYTFL  112 (147)
T ss_pred             EEECcCCCCEeeHH
Confidence            45566666555543


No 102
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=67.75  E-value=1.3  Score=26.08  Aligned_cols=29  Identities=21%  Similarity=0.628  Sum_probs=14.4

Q ss_pred             cccccchhhhcCHHHHHHHHhhhcCCccccccccc
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRRHEGQDYKCYICGN  329 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~  329 (360)
                      |+|..||..|.-.....      .+..-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~------~~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKIS------DDPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEecC------CCCCCCCCCCCC
Confidence            56666666655332221      134455666665


No 103
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=67.60  E-value=3.4  Score=23.80  Aligned_cols=10  Identities=30%  Similarity=1.198  Sum_probs=4.2

Q ss_pred             eecccccccc
Q psy6525         185 YKCKECGKCY  194 (360)
Q Consensus       185 ~~C~~C~~~f  194 (360)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            3444444433


No 104
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=66.89  E-value=3.8  Score=33.39  Aligned_cols=16  Identities=13%  Similarity=0.632  Sum_probs=7.7

Q ss_pred             cccccchhhhcCHHHH
Q psy6525         295 YQCAMCKKQYASKKML  310 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L  310 (360)
                      |.|+.|+..|+.-.++
T Consensus       118 Y~Cp~C~~rytf~eA~  133 (178)
T PRK06266        118 FFCPNCHIRFTFDEAM  133 (178)
T ss_pred             EECCCCCcEEeHHHHh
Confidence            4455555544444443


No 105
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=65.83  E-value=3.8  Score=22.76  Aligned_cols=8  Identities=38%  Similarity=1.045  Sum_probs=3.7

Q ss_pred             cccccccc
Q psy6525         321 DYKCYICG  328 (360)
Q Consensus       321 ~~~C~~C~  328 (360)
                      +.+|+.||
T Consensus        17 ~irC~~CG   24 (32)
T PF03604_consen   17 PIRCPECG   24 (32)
T ss_dssp             TSSBSSSS
T ss_pred             cEECCcCC
Confidence            34444444


No 106
>PHA00626 hypothetical protein
Probab=64.58  E-value=1.7  Score=27.26  Aligned_cols=12  Identities=17%  Similarity=0.343  Sum_probs=5.9

Q ss_pred             cccccccccccc
Q psy6525         129 QFQCNVCFLMLN  140 (360)
Q Consensus       129 ~~~C~~C~~~f~  140 (360)
                      .|.|+.||..|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            355555554443


No 107
>KOG4167|consensus
Probab=63.94  E-value=11  Score=37.14  Aligned_cols=25  Identities=20%  Similarity=0.323  Sum_probs=14.1

Q ss_pred             ccccccccccccChHHHHHHHHHcC
Q psy6525         129 QFQCNVCFLMLNNRCYTRFHLLKHN  153 (360)
Q Consensus       129 ~~~C~~C~~~f~~~~~l~~H~~~h~  153 (360)
                      .|.|..|+++|....++..||+.|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            3555555555555555555555553


No 108
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=63.68  E-value=2.3  Score=26.59  Aligned_cols=11  Identities=36%  Similarity=1.319  Sum_probs=5.5

Q ss_pred             eeccccccccc
Q psy6525         185 YKCKECGKCYT  195 (360)
Q Consensus       185 ~~C~~C~~~f~  195 (360)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            44555555444


No 109
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=63.40  E-value=4.3  Score=31.11  Aligned_cols=25  Identities=36%  Similarity=0.834  Sum_probs=16.3

Q ss_pred             CcccccccccccCChHHHHHHHHHhCCC
Q psy6525         320 QDYKCYICGNRYATQKYLEEHIRLHQGH  347 (360)
Q Consensus       320 ~~~~C~~C~~~f~~~~~l~~H~~~h~g~  347 (360)
                      .-..|-+||+.|+.   |.+|++.|+|-
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             CeeEEccCCcccch---HHHHHHHccCC
Confidence            34679999999984   58999999885


No 110
>PF14353 CpXC:  CpXC protein
Probab=63.04  E-value=6.2  Score=30.13  Aligned_cols=12  Identities=33%  Similarity=0.933  Sum_probs=5.4

Q ss_pred             cccccccccccC
Q psy6525         157 FKCDLCSRTFNS  168 (360)
Q Consensus       157 ~~C~~C~~~f~~  168 (360)
                      |.|+.||..|.-
T Consensus        39 ~~CP~Cg~~~~~   50 (128)
T PF14353_consen   39 FTCPSCGHKFRL   50 (128)
T ss_pred             EECCCCCCceec
Confidence            444444444433


No 111
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=62.82  E-value=2.3  Score=36.03  Aligned_cols=100  Identities=23%  Similarity=0.388  Sum_probs=55.4

Q ss_pred             cccccccccccCHHHHHHHHHHcCCCceeecccccccccChhHHHHHHHhc---CCCCCcCccccccccCHHHHHHHHhh
Q psy6525         157 FKCDLCSRTFNSQSYLQQHKKHDHEGVKYKCKECGKCYTQNTNLKQHMLSH---KGIFFICFHCNKNFTHRALLVRHMQK  233 (360)
Q Consensus       157 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h---~~~~~~C~~C~~~f~~~~~l~~H~~~  233 (360)
                      -.|..|.+..-           .|+++.|+|..|.. |.-...--.|+.+-   ....|+|.-|++.=            
T Consensus       126 a~C~EC~R~vw-----------~hGGrif~CsfC~~-flCEDDQFEHQAsCQvLe~E~~KC~SCNrlG------------  181 (314)
T PF06524_consen  126 AVCIECERGVW-----------DHGGRIFKCSFCDN-FLCEDDQFEHQASCQVLESETFKCQSCNRLG------------  181 (314)
T ss_pred             cEeeeeecccc-----------cCCCeEEEeecCCC-eeeccchhhhhhhhhhhhccccccccccccc------------
Confidence            45667776532           47888999999975 33444444555443   23467777776531            


Q ss_pred             cCCCCcccCCCCCccCCHHHHHHHHHHh----cCCCcccccccccccCChhHHHHhHhhh
Q psy6525         234 HSSERFKCDLCGKVTPYYQHYLRHMRIH----QGLEVHECNLCAKLFACKRSLQDHMQRH  289 (360)
Q Consensus       234 h~~~~~~C~~C~~~f~~~~~l~~H~~~h----~~~~~~~C~~C~~~f~~~~~l~~H~~~h  289 (360)
                          .|.|..|...|-.     .|.+..    ...+++.|+.|+........|..-.|+|
T Consensus       182 ----q~sCLRCK~cfCd-----dHvrrKg~ky~k~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  182 ----QYSCLRCKICFCD-----DHVRRKGFKYEKGKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             ----chhhhheeeeehh-----hhhhhcccccccCCCCCCCCCCCcccccccceeeeecc
Confidence                1444444444432     233221    2235677777776666655555555544


No 112
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=61.54  E-value=5.5  Score=34.79  Aligned_cols=24  Identities=25%  Similarity=0.544  Sum_probs=15.4

Q ss_pred             CcccCCCCCccCCHHHHHHHHHHh
Q psy6525         238 RFKCDLCGKVTPYYQHYLRHMRIH  261 (360)
Q Consensus       238 ~~~C~~C~~~f~~~~~l~~H~~~h  261 (360)
                      +|.|+.|...|-..-+.-.|-..|
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHHh
Confidence            577777777776666666665544


No 113
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=61.46  E-value=2.9  Score=25.76  Aligned_cols=10  Identities=40%  Similarity=1.172  Sum_probs=4.8

Q ss_pred             cccccchhhh
Q psy6525         295 YQCAMCKKQY  304 (360)
Q Consensus       295 ~~C~~C~~~f  304 (360)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            4444444444


No 114
>KOG2807|consensus
Probab=61.32  E-value=15  Score=32.49  Aligned_cols=24  Identities=21%  Similarity=0.365  Sum_probs=14.6

Q ss_pred             CCcCccccccccCHHHHHHHHhhc
Q psy6525         211 FFICFHCNKNFTHRALLVRHMQKH  234 (360)
Q Consensus       211 ~~~C~~C~~~f~~~~~l~~H~~~h  234 (360)
                      .|.|+.|...|-.--..-.|-..|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            466777777776665555554443


No 115
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=61.28  E-value=5.2  Score=25.65  Aligned_cols=10  Identities=40%  Similarity=0.959  Sum_probs=5.4

Q ss_pred             ceecccchhc
Q psy6525          99 NVLCYICDEI  108 (360)
Q Consensus        99 ~~~C~~C~~~  108 (360)
                      .|.|+.|++.
T Consensus        25 ~F~CPnCG~~   34 (59)
T PRK14890         25 KFLCPNCGEV   34 (59)
T ss_pred             EeeCCCCCCe
Confidence            4556666543


No 116
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=60.17  E-value=2.4  Score=25.21  Aligned_cols=11  Identities=45%  Similarity=1.437  Sum_probs=5.4

Q ss_pred             eeccccccccc
Q psy6525         185 YKCKECGKCYT  195 (360)
Q Consensus       185 ~~C~~C~~~f~  195 (360)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            44555554444


No 117
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=58.75  E-value=6.4  Score=25.25  Aligned_cols=6  Identities=33%  Similarity=0.606  Sum_probs=2.3

Q ss_pred             HHHHHH
Q psy6525         172 LQQHKK  177 (360)
Q Consensus       172 l~~H~~  177 (360)
                      |..|..
T Consensus        26 l~~H~~   31 (60)
T PF02176_consen   26 LDDHLE   31 (60)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            333333


No 118
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=57.92  E-value=3.4  Score=22.57  Aligned_cols=9  Identities=33%  Similarity=0.733  Sum_probs=4.5

Q ss_pred             Ccccccccc
Q psy6525         320 QDYKCYICG  328 (360)
Q Consensus       320 ~~~~C~~C~  328 (360)
                      ..|.|+.|+
T Consensus        18 ~~~vCp~C~   26 (30)
T PF08274_consen   18 ELLVCPECG   26 (30)
T ss_dssp             SSEEETTTT
T ss_pred             CEEeCCccc
Confidence            445555554


No 119
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=57.25  E-value=7.6  Score=23.12  Aligned_cols=21  Identities=29%  Similarity=0.683  Sum_probs=14.4

Q ss_pred             ccccccccccCChHHHHHHHH
Q psy6525         322 YKCYICGNRYATQKYLEEHIR  342 (360)
Q Consensus       322 ~~C~~C~~~f~~~~~l~~H~~  342 (360)
                      |+|-.|..+..-++.|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            567777777667777777765


No 120
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=57.13  E-value=4.1  Score=31.71  Aligned_cols=31  Identities=26%  Similarity=0.648  Sum_probs=13.9

Q ss_pred             cccccccccccCChHHHHHHHHHhCCCCccCCCcc
Q psy6525         321 DYKCYICGNRYATQKYLEEHIRLHQGHTYMCNAKF  355 (360)
Q Consensus       321 ~~~C~~C~~~f~~~~~l~~H~~~h~g~~~~C~~c~  355 (360)
                      +|.|. |+..|-+.   ++|-.+-.|+.|.|..|+
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~~YrC~~C~  147 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGEVYRCGKCG  147 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccceEEeccCC
Confidence            45555 55443322   233334444455555554


No 121
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=56.94  E-value=3.4  Score=28.73  Aligned_cols=10  Identities=20%  Similarity=1.055  Sum_probs=4.6

Q ss_pred             cccccchhhh
Q psy6525         295 YQCAMCKKQY  304 (360)
Q Consensus       295 ~~C~~C~~~f  304 (360)
                      +.|..|+..|
T Consensus        54 W~C~kCg~~f   63 (89)
T COG1997          54 WKCRKCGAKF   63 (89)
T ss_pred             EEcCCCCCee
Confidence            4444444444


No 122
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=56.51  E-value=2.5  Score=28.57  Aligned_cols=7  Identities=14%  Similarity=0.634  Sum_probs=2.9

Q ss_pred             cchhhhc
Q psy6525         299 MCKKQYA  305 (360)
Q Consensus       299 ~C~~~f~  305 (360)
                      .||.+|.
T Consensus        34 eCg~tF~   40 (72)
T PRK09678         34 NCSATFI   40 (72)
T ss_pred             CCCCEEE
Confidence            3444443


No 123
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=56.30  E-value=9  Score=28.88  Aligned_cols=11  Identities=9%  Similarity=0.042  Sum_probs=4.6

Q ss_pred             ccccccccccc
Q psy6525         266 VHECNLCAKLF  276 (360)
Q Consensus       266 ~~~C~~C~~~f  276 (360)
                      |..|+.||..|
T Consensus        26 p~vcP~cg~~~   36 (129)
T TIGR02300        26 PAVSPYTGEQF   36 (129)
T ss_pred             CccCCCcCCcc
Confidence            34444444443


No 124
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=55.43  E-value=4.4  Score=24.61  Aligned_cols=11  Identities=18%  Similarity=0.486  Sum_probs=6.2

Q ss_pred             eecccchhccC
Q psy6525         100 VLCYICDEILK  110 (360)
Q Consensus       100 ~~C~~C~~~f~  110 (360)
                      |.|+.|+..|.
T Consensus         4 y~C~~CG~~~~   14 (46)
T PRK00398          4 YKCARCGREVE   14 (46)
T ss_pred             EECCCCCCEEE
Confidence            55666665543


No 125
>PRK04023 DNA polymerase II large subunit; Validated
Probab=53.99  E-value=10  Score=39.04  Aligned_cols=9  Identities=33%  Similarity=0.840  Sum_probs=5.0

Q ss_pred             ccccccccc
Q psy6525         267 HECNLCAKL  275 (360)
Q Consensus       267 ~~C~~C~~~  275 (360)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            456666654


No 126
>KOG1280|consensus
Probab=53.15  E-value=16  Score=32.67  Aligned_cols=38  Identities=18%  Similarity=0.303  Sum_probs=28.1

Q ss_pred             ceecccchhccCChHHHHHHHhhccCCCCCcccccccc
Q psy6525          99 NVLCYICDEILKDIDDLRYHGLLHATPLGTQFQCNVCF  136 (360)
Q Consensus        99 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~  136 (360)
                      .|.|++|+..=-+...|..|....|.+......|++|+
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            68888888888888888888776666555556677775


No 127
>PRK04023 DNA polymerase II large subunit; Validated
Probab=51.33  E-value=12  Score=38.54  Aligned_cols=10  Identities=30%  Similarity=0.899  Sum_probs=5.2

Q ss_pred             eecccccccc
Q psy6525         185 YKCKECGKCY  194 (360)
Q Consensus       185 ~~C~~C~~~f  194 (360)
                      +.|+.||..-
T Consensus       664 y~CPKCG~El  673 (1121)
T PRK04023        664 DECEKCGREP  673 (1121)
T ss_pred             CcCCCCCCCC
Confidence            4455555443


No 128
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=50.47  E-value=5.3  Score=25.28  Aligned_cols=10  Identities=30%  Similarity=0.567  Sum_probs=4.7

Q ss_pred             cccccccccc
Q psy6525         321 DYKCYICGNR  330 (360)
Q Consensus       321 ~~~C~~C~~~  330 (360)
                      ...|+.||..
T Consensus        22 iV~Cp~CGae   31 (54)
T TIGR01206        22 LVICDECGAE   31 (54)
T ss_pred             EEeCCCCCCE
Confidence            3445555443


No 129
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=50.20  E-value=8.9  Score=29.10  Aligned_cols=23  Identities=26%  Similarity=0.545  Sum_probs=19.5

Q ss_pred             ccccccccccCChHHHHHHHHHhCCC
Q psy6525         322 YKCYICGNRYATQKYLEEHIRLHQGH  347 (360)
Q Consensus       322 ~~C~~C~~~f~~~~~l~~H~~~h~g~  347 (360)
                      ..|-.+|+.|+   +|++|+.+|+|-
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gm   99 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGL   99 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCC
Confidence            46999999986   788999999885


No 130
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=46.80  E-value=15  Score=22.25  Aligned_cols=7  Identities=29%  Similarity=0.890  Sum_probs=3.1

Q ss_pred             ccccccc
Q psy6525         267 HECNLCA  273 (360)
Q Consensus       267 ~~C~~C~  273 (360)
                      +.|+.||
T Consensus        19 ~~CP~Cg   25 (46)
T PF12760_consen   19 FVCPHCG   25 (46)
T ss_pred             CCCCCCC
Confidence            3344444


No 131
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=45.76  E-value=12  Score=23.31  Aligned_cols=11  Identities=36%  Similarity=0.703  Sum_probs=7.1

Q ss_pred             eecccchhccC
Q psy6525         100 VLCYICDEILK  110 (360)
Q Consensus       100 ~~C~~C~~~f~  110 (360)
                      |+|.+|+..+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            56677766664


No 132
>KOG2807|consensus
Probab=45.58  E-value=33  Score=30.47  Aligned_cols=86  Identities=19%  Similarity=0.361  Sum_probs=50.1

Q ss_pred             eeecccccccccChhHHHHHHHhcCCCCCcCccccccccCHHHHHHHHhhcCC-CC------------cccCCCCCccCC
Q psy6525         184 KYKCKECGKCYTQNTNLKQHMLSHKGIFFICFHCNKNFTHRALLVRHMQKHSS-ER------------FKCDLCGKVTPY  250 (360)
Q Consensus       184 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-~~------------~~C~~C~~~f~~  250 (360)
                      .|.|+.|+...-+             .|..|++|+.+......|.+-..---+ ++            -.|-.|+-.   
T Consensus       276 Gy~CP~CkakvCs-------------LP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~---  339 (378)
T KOG2807|consen  276 GYFCPQCKAKVCS-------------LPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGE---  339 (378)
T ss_pred             ceeCCcccCeeec-------------CCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccc---
Confidence            4667776554322             367788888877776666543221100 00            115555211   


Q ss_pred             HHHHHHHHHHhcCCCcccccccccccCChhHHHHhHhhhcCCCccccccch
Q psy6525         251 YQHYLRHMRIHQGLEVHECNLCAKLFACKRSLQDHMQRHEEPNKYQCAMCK  301 (360)
Q Consensus       251 ~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  301 (360)
                                -.+...|.|..|...|-.--+.-.|...|.      |+.|.
T Consensus       340 ----------~~~~~~y~C~~Ck~~FCldCDv~iHesLh~------CpgCe  374 (378)
T KOG2807|consen  340 ----------LLSSGRYRCESCKNVFCLDCDVFIHESLHN------CPGCE  374 (378)
T ss_pred             ----------cCCCCcEEchhccceeeccchHHHHhhhhc------CCCcC
Confidence                      123345889999988887777777877663      66664


No 133
>KOG3408|consensus
Probab=44.27  E-value=16  Score=27.20  Aligned_cols=26  Identities=19%  Similarity=0.583  Sum_probs=20.2

Q ss_pred             CCCccccccchhhhcCHHHHHHHHhh
Q psy6525         291 EPNKYQCAMCKKQYASKKMLEKHIRR  316 (360)
Q Consensus       291 ~~~~~~C~~C~~~f~~~~~L~~H~~~  316 (360)
                      |...|.|-.|.+-|.+...|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            33458888888888888888888774


No 134
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=44.18  E-value=16  Score=30.73  Aligned_cols=27  Identities=22%  Similarity=0.742  Sum_probs=14.4

Q ss_pred             cccccccccccccCHHHHHHHHHHcCC
Q psy6525         155 VRFKCDLCSRTFNSQSYLQQHKKHDHE  181 (360)
Q Consensus       155 ~~~~C~~C~~~f~~~~~l~~H~~~~h~  181 (360)
                      ..|.|.+|+|.|.-..-..+|+...|.
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCH
Confidence            346666666666666666666665554


No 135
>KOG2593|consensus
Probab=42.83  E-value=23  Score=32.80  Aligned_cols=35  Identities=17%  Similarity=0.412  Sum_probs=18.9

Q ss_pred             CccccccccccccChHHHHHHHHHcCCcccccccccc
Q psy6525         128 TQFQCNVCFLMLNNRCYTRFHLLKHNWVRFKCDLCSR  164 (360)
Q Consensus       128 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~  164 (360)
                      ..|.|+.|++.|+....++.  ..-....|.|..|+-
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~L--~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQL--LDNETGEFHCENCGG  161 (436)
T ss_pred             ccccCCccccchhhhHHHHh--hcccCceEEEecCCC
Confidence            34677777776665544431  111234566777654


No 136
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=42.80  E-value=21  Score=31.93  Aligned_cols=91  Identities=14%  Similarity=0.185  Sum_probs=0.0

Q ss_pred             CCceecccchhccCChHHHHHHHhhccCCCCCccccc-------------cccccccChHHHHHHHHHcCCcc-------
Q psy6525          97 TKNVLCYICDEILKDIDDLRYHGLLHATPLGTQFQCN-------------VCFLMLNNRCYTRFHLLKHNWVR-------  156 (360)
Q Consensus        97 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~-------------~C~~~f~~~~~l~~H~~~h~~~~-------  156 (360)
                      ...+-|..|+..|.+..-+..|...........-.=.             .|+..++...++..-...-...-       
T Consensus       236 ~~~~YC~~C~r~f~~~~VFe~Hl~gK~H~k~~~~~~~~v~~Ey~l~r~~kyl~d~~s~trs~V~r~la~ta~ER~aei~~  315 (470)
T COG5188         236 FPKVYCVKCGREFSRSKVFEYHLEGKRHCKEGQGKEEFVYSEYVLHRYLKYLGDPVSETRSLVLRSLAITAKERKAEISL  315 (470)
T ss_pred             ccceeeHhhhhHhhhhHHHHHHHhhhhhhhhhhhhhHHHHHHHHHHHHHHHhCChhHHHHHHHHHHHHHHHHHHHHHhHH


Q ss_pred             -----------------------------------------------------------ccccccc-ccccCHHHHHHHH
Q psy6525         157 -----------------------------------------------------------FKCDLCS-RTFNSQSYLQQHK  176 (360)
Q Consensus       157 -----------------------------------------------------------~~C~~C~-~~f~~~~~l~~H~  176 (360)
                                                                                 |.|.+|+ +++.-+..+.+|.
T Consensus       316 l~r~~~~~at~S~e~EGaeq~d~eQ~DE~~~~k~fdmPLG~DG~PmP~WL~klhgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         316 LSRRKKQPATKSSEKEGAEQVDGEQRDEHVSGKSFDMPLGPDGLPMPRWLCKLHGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             HHHHhhccCCCchhhcccccccccccchhhccCcccCCCCCCCCCCchHHHHhcCCCcceeeeecccccccchHHHHhhh


Q ss_pred             HHcCCCceeec
Q psy6525         177 KHDHEGVKYKC  187 (360)
Q Consensus       177 ~~~h~~~~~~C  187 (360)
                      ..........|
T Consensus       396 ~E~rHiygl~c  406 (470)
T COG5188         396 EEDRHIYGLEC  406 (470)
T ss_pred             hhhhhhhheee


No 137
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=42.71  E-value=8.7  Score=38.60  Aligned_cols=8  Identities=38%  Similarity=1.007  Sum_probs=4.4

Q ss_pred             ccCCCCCc
Q psy6525         240 KCDLCGKV  247 (360)
Q Consensus       240 ~C~~C~~~  247 (360)
                      .|..||..
T Consensus       437 ~C~~Cg~v  444 (730)
T COG1198         437 LCRDCGYI  444 (730)
T ss_pred             ecccCCCc
Confidence            46666554


No 138
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=42.06  E-value=15  Score=27.91  Aligned_cols=56  Identities=23%  Similarity=0.459  Sum_probs=30.7

Q ss_pred             CCCcccccccccccCChhHHHHhHhhhcCCCcccc---ccchhhhcCHHHHHHHHhhhcCCcccccccccccCChH
Q psy6525         263 GLEVHECNLCAKLFACKRSLQDHMQRHEEPNKYQC---AMCKKQYASKKMLEKHIRRHEGQDYKCYICGNRYATQK  335 (360)
Q Consensus       263 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C---~~C~~~f~~~~~L~~H~~~h~~~~~~C~~C~~~f~~~~  335 (360)
                      ..+.|+|.+|..+.....-|          +|-.|   .+|+.-   -..|+.|-..|    -+|+.|.-+|++..
T Consensus        77 d~~lYeCnIC~etS~ee~FL----------KPneCCgY~iCn~C---ya~LWK~~~~y----pvCPvCkTSFKss~  135 (140)
T PF05290_consen   77 DPKLYECNICKETSAEERFL----------KPNECCGYSICNAC---YANLWKFCNLY----PVCPVCKTSFKSSS  135 (140)
T ss_pred             CCCceeccCcccccchhhcC----------CcccccchHHHHHH---HHHHHHHcccC----CCCCcccccccccc
Confidence            44667888887776655443          23333   123222   24555554433    25888887777654


No 139
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=42.05  E-value=19  Score=27.68  Aligned_cols=25  Identities=20%  Similarity=0.477  Sum_probs=16.1

Q ss_pred             CCceecccchhccCChHHHHHHHhhccC
Q psy6525          97 TKNVLCYICDEILKDIDDLRYHGLLHAT  124 (360)
Q Consensus        97 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~  124 (360)
                      .+.+.|-+||+.|+..   ++|...|++
T Consensus        70 ~d~i~clecGk~~k~L---krHL~~~~g   94 (132)
T PF05443_consen   70 PDYIICLECGKKFKTL---KRHLRTHHG   94 (132)
T ss_dssp             SS-EE-TBT--EESBH---HHHHHHTT-
T ss_pred             cCeeEEccCCcccchH---HHHHHHccC
Confidence            3457899999998765   889988877


No 140
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=42.03  E-value=14  Score=28.07  Aligned_cols=11  Identities=36%  Similarity=0.896  Sum_probs=5.0

Q ss_pred             ccCCCCCccCC
Q psy6525         240 KCDLCGKVTPY  250 (360)
Q Consensus       240 ~C~~C~~~f~~  250 (360)
                      +|..||+.|.+
T Consensus         3 ~Ct~Cg~~f~d   13 (131)
T PF09845_consen    3 QCTKCGRVFED   13 (131)
T ss_pred             ccCcCCCCcCC
Confidence            44444444443


No 141
>KOG2593|consensus
Probab=41.99  E-value=24  Score=32.62  Aligned_cols=11  Identities=27%  Similarity=0.649  Sum_probs=5.0

Q ss_pred             cccCCCCCccC
Q psy6525         239 FKCDLCGKVTP  249 (360)
Q Consensus       239 ~~C~~C~~~f~  249 (360)
                      |.|+.|.+.|.
T Consensus       129 Y~Cp~C~kkyt  139 (436)
T KOG2593|consen  129 YVCPNCQKKYT  139 (436)
T ss_pred             ccCCccccchh
Confidence            44444444443


No 142
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=41.83  E-value=9.2  Score=33.45  Aligned_cols=24  Identities=25%  Similarity=0.589  Sum_probs=16.7

Q ss_pred             cccccccccccCChHHHHHHHHHh
Q psy6525         321 DYKCYICGNRYATQKYLEEHIRLH  344 (360)
Q Consensus       321 ~~~C~~C~~~f~~~~~l~~H~~~h  344 (360)
                      .|+|+.|...|-...+.-.|...|
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHHh
Confidence            577777777777666666665554


No 143
>KOG4167|consensus
Probab=41.68  E-value=9.6  Score=37.50  Aligned_cols=26  Identities=23%  Similarity=0.528  Sum_probs=23.7

Q ss_pred             ccccccchhhhcCHHHHHHHHhhhcC
Q psy6525         294 KYQCAMCKKQYASKKMLEKHIRRHEG  319 (360)
Q Consensus       294 ~~~C~~C~~~f~~~~~L~~H~~~h~~  319 (360)
                      -|.|..|+|.|-....+..||++|.-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            48999999999999999999999864


No 144
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=39.24  E-value=19  Score=34.73  Aligned_cols=9  Identities=22%  Similarity=0.733  Sum_probs=4.9

Q ss_pred             ccccccccc
Q psy6525         266 VHECNLCAK  274 (360)
Q Consensus       266 ~~~C~~C~~  274 (360)
                      |..|+.|+.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            445666654


No 145
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=39.04  E-value=13  Score=31.15  Aligned_cols=25  Identities=20%  Similarity=0.719  Sum_probs=11.7

Q ss_pred             cccccccccccCChHHHHHHHHHhC
Q psy6525         321 DYKCYICGNRYATQKYLEEHIRLHQ  345 (360)
Q Consensus       321 ~~~C~~C~~~f~~~~~l~~H~~~h~  345 (360)
                      .|.|+.|+|.|+-..-...|+...|
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             EECCCCCCcccCChHHHHHHHhhcC
Confidence            3555555555555555555555433


No 146
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=38.57  E-value=7.3  Score=39.10  Aligned_cols=10  Identities=20%  Similarity=0.564  Sum_probs=6.6

Q ss_pred             cccccccccc
Q psy6525         130 FQCNVCFLML  139 (360)
Q Consensus       130 ~~C~~C~~~f  139 (360)
                      ..|..||..+
T Consensus       436 l~C~~Cg~v~  445 (730)
T COG1198         436 LLCRDCGYIA  445 (730)
T ss_pred             eecccCCCcc
Confidence            4588887554


No 147
>KOG3408|consensus
Probab=37.93  E-value=33  Score=25.60  Aligned_cols=31  Identities=23%  Similarity=0.424  Sum_probs=25.4

Q ss_pred             CCCccCCCceecccchhccCChHHHHHHHhh
Q psy6525          91 DPEIMDTKNVLCYICDEILKDIDDLRYHGLL  121 (360)
Q Consensus        91 ~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  121 (360)
                      ++.+-+...|.|-.|...|.+...|..|.++
T Consensus        49 D~dlPG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   49 DPDLPGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCCCCCceeehhhhhhhhcchHHHHHHHhc
Confidence            4555566779999999999999999999764


No 148
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=37.86  E-value=25  Score=37.40  Aligned_cols=11  Identities=27%  Similarity=0.727  Sum_probs=6.6

Q ss_pred             ccccccchhhh
Q psy6525         294 KYQCAMCKKQY  304 (360)
Q Consensus       294 ~~~C~~C~~~f  304 (360)
                      +|.|+.||...
T Consensus       692 vy~CPsCGaev  702 (1337)
T PRK14714        692 VYVCPDCGAEV  702 (1337)
T ss_pred             ceeCccCCCcc
Confidence            45666666643


No 149
>PF12907 zf-met2:  Zinc-binding
Probab=37.07  E-value=25  Score=20.65  Aligned_cols=26  Identities=27%  Similarity=0.742  Sum_probs=12.6

Q ss_pred             cccccccccc---cCHHHHHHHHHHcCCC
Q psy6525         157 FKCDLCSRTF---NSQSYLQQHKKHDHEG  182 (360)
Q Consensus       157 ~~C~~C~~~f---~~~~~l~~H~~~~h~~  182 (360)
                      +.|.+|..+|   .+...|..|....|..
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            3455555333   3334455565554443


No 150
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=36.91  E-value=13  Score=19.11  Aligned_cols=8  Identities=25%  Similarity=1.012  Sum_probs=4.0

Q ss_pred             ccccccch
Q psy6525         294 KYQCAMCK  301 (360)
Q Consensus       294 ~~~C~~C~  301 (360)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            35555554


No 151
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=36.15  E-value=7.7  Score=27.41  Aligned_cols=10  Identities=40%  Similarity=0.999  Sum_probs=4.3

Q ss_pred             cccccchhhh
Q psy6525         295 YQCAMCKKQY  304 (360)
Q Consensus       295 ~~C~~C~~~f  304 (360)
                      +.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PTZ00255         55 WRCKGCKKTV   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            4444444443


No 152
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=36.08  E-value=21  Score=22.50  Aligned_cols=11  Identities=27%  Similarity=0.766  Sum_probs=6.9

Q ss_pred             eecccchhccC
Q psy6525         100 VLCYICDEILK  110 (360)
Q Consensus       100 ~~C~~C~~~f~  110 (360)
                      -.|+.|++.|.
T Consensus         6 ~~C~~Cg~~~~   16 (54)
T PF14446_consen    6 CKCPVCGKKFK   16 (54)
T ss_pred             ccChhhCCccc
Confidence            45666766664


No 153
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=34.72  E-value=6.9  Score=27.66  Aligned_cols=10  Identities=30%  Similarity=1.245  Sum_probs=4.4

Q ss_pred             cccccccccc
Q psy6525         322 YKCYICGNRY  331 (360)
Q Consensus       322 ~~C~~C~~~f  331 (360)
                      ++|..|++.|
T Consensus        54 W~C~~C~~~~   63 (91)
T TIGR00280        54 WTCRKCGAKF   63 (91)
T ss_pred             EEcCCCCCEE
Confidence            4444444444


No 154
>KOG4124|consensus
Probab=34.10  E-value=6.2  Score=35.11  Aligned_cols=22  Identities=32%  Similarity=0.754  Sum_probs=15.0

Q ss_pred             CcccccccccccCChHHHHHHH
Q psy6525         320 QDYKCYICGNRYATQKYLEEHI  341 (360)
Q Consensus       320 ~~~~C~~C~~~f~~~~~l~~H~  341 (360)
                      ++|+|++|.+.++....|..|+
T Consensus       397 k~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  397 KPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             CcccChhhhhhhccCCCCCcee
Confidence            4677888887777666565553


No 155
>KOG1280|consensus
Probab=33.59  E-value=44  Score=29.98  Aligned_cols=23  Identities=17%  Similarity=0.392  Sum_probs=11.7

Q ss_pred             cccccccccccCChhHHHHhHhh
Q psy6525         266 VHECNLCAKLFACKRSLQDHMQR  288 (360)
Q Consensus       266 ~~~C~~C~~~f~~~~~l~~H~~~  288 (360)
                      .|.|++|+.+-.+...|..|+..
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s  101 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLS  101 (381)
T ss_pred             cccCCcccccccchhHHHHHhhh
Confidence            34555555555555555555443


No 156
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=32.22  E-value=29  Score=25.10  Aligned_cols=33  Identities=24%  Similarity=0.356  Sum_probs=27.2

Q ss_pred             CCCCCCccCCCceecccchhccCChHHHHHHHh
Q psy6525          88 SPSDPEIMDTKNVLCYICDEILKDIDDLRYHGL  120 (360)
Q Consensus        88 ~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  120 (360)
                      .+-+|...+-..+.|-.|...|.+...|..|.+
T Consensus        44 lp~Dp~lPGlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          44 LPYDPELPGLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCCCCCCCCCceeeeehhHHHHHHHHHHHHHhc
Confidence            345666667778999999999999999999965


No 157
>PRK14873 primosome assembly protein PriA; Provisional
Probab=32.13  E-value=28  Score=34.93  Aligned_cols=10  Identities=20%  Similarity=0.919  Sum_probs=5.7

Q ss_pred             ccccccchhh
Q psy6525         294 KYQCAMCKKQ  303 (360)
Q Consensus       294 ~~~C~~C~~~  303 (360)
                      |..|+.||-.
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            4566666543


No 158
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=31.51  E-value=37  Score=36.14  Aligned_cols=11  Identities=36%  Similarity=0.957  Sum_probs=5.9

Q ss_pred             eeecccccccc
Q psy6525         184 KYKCKECGKCY  194 (360)
Q Consensus       184 ~~~C~~C~~~f  194 (360)
                      +|.|+.||...
T Consensus       692 vy~CPsCGaev  702 (1337)
T PRK14714        692 VYVCPDCGAEV  702 (1337)
T ss_pred             ceeCccCCCcc
Confidence            35566665543


No 159
>PLN02294 cytochrome c oxidase subunit Vb
Probab=31.43  E-value=15  Score=29.31  Aligned_cols=18  Identities=17%  Similarity=0.464  Sum_probs=11.4

Q ss_pred             HHHhCCCCccCCCccccc
Q psy6525         341 IRLHQGHTYMCNAKFSFN  358 (360)
Q Consensus       341 ~~~h~g~~~~C~~c~~~f  358 (360)
                      +..+.|+|++|+.||..|
T Consensus       134 f~L~kGkp~RCpeCG~~f  151 (174)
T PLN02294        134 FWLEKGKSFECPVCTQYF  151 (174)
T ss_pred             EEecCCCceeCCCCCCEE
Confidence            445666666677776665


No 160
>KOG4377|consensus
Probab=31.06  E-value=13  Score=34.05  Aligned_cols=24  Identities=29%  Similarity=0.685  Sum_probs=17.0

Q ss_pred             ccccc--chhhhcCHHHHHHHHhhhc
Q psy6525         295 YQCAM--CKKQYASKKMLEKHIRRHE  318 (360)
Q Consensus       295 ~~C~~--C~~~f~~~~~L~~H~~~h~  318 (360)
                      |-|..  |+.++.+.+.+..|.|.|.
T Consensus       402 fhc~r~Gc~~tl~s~sqm~shkrkhe  427 (480)
T KOG4377|consen  402 FHCDRLGCEATLYSVSQMASHKRKHE  427 (480)
T ss_pred             eeecccCCceEEEehhhhhhhhhhhh
Confidence            44544  7778888888888877764


No 161
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=30.36  E-value=6.9  Score=22.41  Aligned_cols=8  Identities=38%  Similarity=1.277  Sum_probs=3.4

Q ss_pred             cCCCCCcc
Q psy6525         241 CDLCGKVT  248 (360)
Q Consensus       241 C~~C~~~f  248 (360)
                      |+.||.+|
T Consensus         4 C~~Cg~~Y   11 (36)
T PF05191_consen    4 CPKCGRIY   11 (36)
T ss_dssp             ETTTTEEE
T ss_pred             cCCCCCcc
Confidence            44444443


No 162
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=30.06  E-value=5.4  Score=28.15  Aligned_cols=10  Identities=30%  Similarity=1.182  Sum_probs=4.2

Q ss_pred             cccccchhhh
Q psy6525         295 YQCAMCKKQY  304 (360)
Q Consensus       295 ~~C~~C~~~f  304 (360)
                      +.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (90)
T PF01780_consen   54 WKCKKCGKKF   63 (90)
T ss_dssp             EEETTTTEEE
T ss_pred             eecCCCCCEE
Confidence            3444444433


No 163
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=29.09  E-value=38  Score=19.62  Aligned_cols=10  Identities=30%  Similarity=0.836  Sum_probs=3.0

Q ss_pred             cccccccccc
Q psy6525         267 HECNLCAKLF  276 (360)
Q Consensus       267 ~~C~~C~~~f  276 (360)
                      |-|..|...|
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            5566666655


No 164
>KOG4124|consensus
Probab=28.84  E-value=7.6  Score=34.55  Aligned_cols=26  Identities=35%  Similarity=0.807  Sum_probs=20.6

Q ss_pred             ccccccc--ccccccCHHHHHHHHHHcC
Q psy6525         155 VRFKCDL--CSRTFNSQSYLQQHKKHDH  180 (360)
Q Consensus       155 ~~~~C~~--C~~~f~~~~~l~~H~~~~h  180 (360)
                      ++|+|.+  |++.+....+|..|....|
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h  375 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGH  375 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCc
Confidence            4588866  9999999999988876554


No 165
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=28.82  E-value=15  Score=26.43  Aligned_cols=8  Identities=13%  Similarity=-0.043  Sum_probs=2.9

Q ss_pred             CccCCCcc
Q psy6525         348 TYMCNAKF  355 (360)
Q Consensus       348 ~~~C~~c~  355 (360)
                      |++|..||
T Consensus        79 ~~rC~eCG   86 (97)
T cd00924          79 PKRCPECG   86 (97)
T ss_pred             ceeCCCCC
Confidence            33333333


No 166
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=28.74  E-value=46  Score=19.58  Aligned_cols=9  Identities=33%  Similarity=1.069  Sum_probs=4.0

Q ss_pred             ccccccccc
Q psy6525         268 ECNLCAKLF  276 (360)
Q Consensus       268 ~C~~C~~~f  276 (360)
                      .|+.||..|
T Consensus        15 ~C~~CgM~Y   23 (41)
T PF13878_consen   15 TCPTCGMLY   23 (41)
T ss_pred             CCCCCCCEE
Confidence            444444443


No 167
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=28.58  E-value=20  Score=27.73  Aligned_cols=10  Identities=40%  Similarity=0.896  Sum_probs=4.6

Q ss_pred             cccCCCCCcc
Q psy6525         239 FKCDLCGKVT  248 (360)
Q Consensus       239 ~~C~~C~~~f  248 (360)
                      +.|..||..|
T Consensus        71 ~~C~~CG~~~   80 (135)
T PRK03824         71 LKCRNCGNEW   80 (135)
T ss_pred             EECCCCCCEE
Confidence            4444444444


No 168
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=28.57  E-value=24  Score=20.54  Aligned_cols=13  Identities=38%  Similarity=1.027  Sum_probs=9.9

Q ss_pred             cccccccccccCC
Q psy6525         321 DYKCYICGNRYAT  333 (360)
Q Consensus       321 ~~~C~~C~~~f~~  333 (360)
                      ||+|..|+..|=.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            7888888887743


No 169
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=28.27  E-value=37  Score=24.48  Aligned_cols=11  Identities=27%  Similarity=0.908  Sum_probs=4.5

Q ss_pred             cccccccccCC
Q psy6525         268 ECNLCAKLFAC  278 (360)
Q Consensus       268 ~C~~C~~~f~~  278 (360)
                      +|..||..|..
T Consensus         4 ~CtrCG~vf~~   14 (112)
T COG3364           4 QCTRCGEVFDD   14 (112)
T ss_pred             eeccccccccc
Confidence            34444444433


No 170
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=27.96  E-value=9.8  Score=26.89  Aligned_cols=10  Identities=30%  Similarity=1.281  Sum_probs=4.4

Q ss_pred             cccccccccc
Q psy6525         322 YKCYICGNRY  331 (360)
Q Consensus       322 ~~C~~C~~~f  331 (360)
                      +.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PRK03976         55 WECRKCGAKF   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            4444444444


No 171
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.77  E-value=30  Score=25.22  Aligned_cols=12  Identities=0%  Similarity=0.116  Sum_probs=5.8

Q ss_pred             cccccccccccc
Q psy6525         155 VRFKCDLCSRTF  166 (360)
Q Consensus       155 ~~~~C~~C~~~f  166 (360)
                      .|..|+.||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            344455555544


No 172
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=27.59  E-value=40  Score=22.23  Aligned_cols=8  Identities=25%  Similarity=0.716  Sum_probs=1.7

Q ss_pred             cccccccc
Q psy6525         132 CNVCFLML  139 (360)
Q Consensus       132 C~~C~~~f  139 (360)
                      |..|++.|
T Consensus        12 C~~C~~~F   19 (69)
T PF01363_consen   12 CMICGKKF   19 (69)
T ss_dssp             -TTT--B-
T ss_pred             CcCcCCcC
Confidence            44444444


No 173
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=26.30  E-value=11  Score=25.38  Aligned_cols=12  Identities=17%  Similarity=0.692  Sum_probs=4.5

Q ss_pred             ccccccchhhhc
Q psy6525         294 KYQCAMCKKQYA  305 (360)
Q Consensus       294 ~~~C~~C~~~f~  305 (360)
                      ...|..|+...+
T Consensus        41 ~v~Cg~C~~~~~   52 (71)
T PF05495_consen   41 RVICGKCRTEQP   52 (71)
T ss_dssp             EEEETTT--EEE
T ss_pred             CeECCCCCCccC
Confidence            344555544443


No 174
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=26.22  E-value=34  Score=25.49  Aligned_cols=13  Identities=23%  Similarity=0.291  Sum_probs=7.2

Q ss_pred             ccccccccccccC
Q psy6525         129 QFQCNVCFLMLNN  141 (360)
Q Consensus       129 ~~~C~~C~~~f~~  141 (360)
                      .+.|..|+..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (113)
T PRK12380         70 QAWCWDCSQVVEI   82 (113)
T ss_pred             EEEcccCCCEEec
Confidence            4556666655543


No 175
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=25.87  E-value=34  Score=25.54  Aligned_cols=11  Identities=27%  Similarity=0.776  Sum_probs=5.9

Q ss_pred             ccccccccccc
Q psy6525         157 FKCDLCSRTFN  167 (360)
Q Consensus       157 ~~C~~C~~~f~  167 (360)
                      +.|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            45555555544


No 176
>KOG2636|consensus
Probab=25.82  E-value=44  Score=31.09  Aligned_cols=29  Identities=14%  Similarity=0.497  Sum_probs=23.9

Q ss_pred             HHhcCCCcccccccc-cccCChhHHHHhHh
Q psy6525         259 RIHQGLEVHECNLCA-KLFACKRSLQDHMQ  287 (360)
Q Consensus       259 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  287 (360)
                      +.|.-...|.|.+|| +++..+.++.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            445556779999999 89999999999975


No 177
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=25.73  E-value=41  Score=21.15  Aligned_cols=7  Identities=29%  Similarity=1.061  Sum_probs=2.6

Q ss_pred             ccccccc
Q psy6525         268 ECNLCAK  274 (360)
Q Consensus       268 ~C~~C~~  274 (360)
                      +|+.||.
T Consensus        30 ~C~~Cgh   36 (55)
T PF14311_consen   30 KCPKCGH   36 (55)
T ss_pred             ECCCCCC
Confidence            3333333


No 178
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=25.39  E-value=31  Score=21.38  Aligned_cols=10  Identities=40%  Similarity=1.145  Sum_probs=4.4

Q ss_pred             CcccCCCCCc
Q psy6525         238 RFKCDLCGKV  247 (360)
Q Consensus       238 ~~~C~~C~~~  247 (360)
                      .+.|..||.+
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            3444444443


No 179
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=25.15  E-value=31  Score=24.29  Aligned_cols=26  Identities=19%  Similarity=0.407  Sum_probs=16.2

Q ss_pred             ceecccchhccCChHHHHHHHhhccCCCCCcccccccc
Q psy6525          99 NVLCYICDEILKDIDDLRYHGLLHATPLGTQFQCNVCF  136 (360)
Q Consensus        99 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~C~~C~  136 (360)
                      |-.|..||+.|.+.            ....+-.|+.|.
T Consensus        58 Pa~CkkCGfef~~~------------~ik~pSRCP~CK   83 (97)
T COG3357          58 PARCKKCGFEFRDD------------KIKKPSRCPKCK   83 (97)
T ss_pred             ChhhcccCcccccc------------ccCCcccCCcch
Confidence            45688888777652            114566777774


No 180
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=25.09  E-value=37  Score=28.13  Aligned_cols=37  Identities=19%  Similarity=0.234  Sum_probs=15.3

Q ss_pred             HHHHHHhhhcCCcccccc----cccccCChHHHHHHHHHhCC
Q psy6525         309 MLEKHIRRHEGQDYKCYI----CGNRYATQKYLEEHIRLHQG  346 (360)
Q Consensus       309 ~L~~H~~~h~~~~~~C~~----C~~~f~~~~~l~~H~~~h~g  346 (360)
                      .+..|.....-+|+.|+.    |+..= ....|..|....|+
T Consensus        32 ~~~~HE~~C~~~p~~CP~~~~~C~~~G-~~~~l~~Hl~~~H~   72 (198)
T PF03145_consen   32 EKREHEEECPFRPCSCPFPGSGCDWQG-SYKELLDHLRDKHS   72 (198)
T ss_dssp             GHHHHHHT-TTSEEE-SSSSTT---EE-ECCCHHHHHHHHTT
T ss_pred             ChhhHhccCCCcCCcCCCCCCCccccC-CHHHHHHHHHHHCC
Confidence            444555555445555555    43322 22345555554443


No 181
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=24.74  E-value=11  Score=21.50  Aligned_cols=10  Identities=20%  Similarity=0.444  Sum_probs=3.5

Q ss_pred             cccccccccc
Q psy6525         130 FQCNVCFLML  139 (360)
Q Consensus       130 ~~C~~C~~~f  139 (360)
                      ..|+.||-.+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            4455555443


No 182
>KOG2636|consensus
Probab=24.29  E-value=47  Score=30.90  Aligned_cols=22  Identities=14%  Similarity=0.712  Sum_probs=12.1

Q ss_pred             cccccccc-ccccCHHHHHHHHH
Q psy6525         156 RFKCDLCS-RTFNSQSYLQQHKK  177 (360)
Q Consensus       156 ~~~C~~C~-~~f~~~~~l~~H~~  177 (360)
                      -|.|.+|| +++.-+..+.+|..
T Consensus       401 ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  401 EYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             ccceeeccCccccCcHHHHHHhH
Confidence            35555555 55555555555543


No 183
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=24.19  E-value=49  Score=24.00  Aligned_cols=23  Identities=22%  Similarity=0.553  Sum_probs=19.0

Q ss_pred             CccccccchhhhcCHHHHHHHHh
Q psy6525         293 NKYQCAMCKKQYASKKMLEKHIR  315 (360)
Q Consensus       293 ~~~~C~~C~~~f~~~~~L~~H~~  315 (360)
                      ..+.|-.|.+-|.+...|..|.+
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhc
Confidence            44778889999999888888876


No 184
>KOG0402|consensus
Probab=24.00  E-value=49  Score=22.86  Aligned_cols=10  Identities=50%  Similarity=1.341  Sum_probs=5.9

Q ss_pred             ccccccchhh
Q psy6525         294 KYQCAMCKKQ  303 (360)
Q Consensus       294 ~~~C~~C~~~  303 (360)
                      .|.|+.||+.
T Consensus        36 ky~CsfCGK~   45 (92)
T KOG0402|consen   36 KYTCSFCGKK   45 (92)
T ss_pred             hhhhhhcchh
Confidence            3666666654


No 185
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=23.81  E-value=16  Score=28.83  Aligned_cols=10  Identities=40%  Similarity=1.408  Sum_probs=5.2

Q ss_pred             cccccchhhh
Q psy6525         295 YQCAMCKKQY  304 (360)
Q Consensus       295 ~~C~~C~~~f  304 (360)
                      |.|..|+..+
T Consensus       124 ~~C~~C~~~~  133 (157)
T PF10263_consen  124 YRCPSCGREY  133 (157)
T ss_pred             EEcCCCCCEe
Confidence            4555555444


No 186
>PRK04351 hypothetical protein; Provisional
Probab=23.68  E-value=28  Score=27.44  Aligned_cols=12  Identities=25%  Similarity=0.852  Sum_probs=6.2

Q ss_pred             Cccccccccccc
Q psy6525         320 QDYKCYICGNRY  331 (360)
Q Consensus       320 ~~~~C~~C~~~f  331 (360)
                      ..|.|..|+-.+
T Consensus       131 ~~yrCg~C~g~L  142 (149)
T PRK04351        131 KRYRCGKCRGKL  142 (149)
T ss_pred             CcEEeCCCCcEe
Confidence            445555555443


No 187
>KOG0717|consensus
Probab=23.66  E-value=39  Score=31.64  Aligned_cols=22  Identities=32%  Similarity=0.711  Sum_probs=0.0

Q ss_pred             cccccchhhhcCHHHHHHHHhh
Q psy6525         295 YQCAMCKKQYASKKMLEKHIRR  316 (360)
Q Consensus       295 ~~C~~C~~~f~~~~~L~~H~~~  316 (360)
                      +.|.+|+++|.+..+|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH


No 188
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=23.38  E-value=49  Score=20.41  Aligned_cols=10  Identities=40%  Similarity=1.112  Sum_probs=5.1

Q ss_pred             CcccCCCCCc
Q psy6525         238 RFKCDLCGKV  247 (360)
Q Consensus       238 ~~~C~~C~~~  247 (360)
                      ++.|.-||++
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            4555555543


No 189
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=23.32  E-value=39  Score=22.34  Aligned_cols=10  Identities=30%  Similarity=0.776  Sum_probs=4.6

Q ss_pred             cccccccccc
Q psy6525         321 DYKCYICGNR  330 (360)
Q Consensus       321 ~~~C~~C~~~  330 (360)
                      .|.|+.||..
T Consensus        46 ~~~C~~Cg~~   55 (69)
T PF07282_consen   46 VFTCPNCGFE   55 (69)
T ss_pred             eEEcCCCCCE
Confidence            3444444444


No 190
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=23.07  E-value=61  Score=20.06  Aligned_cols=7  Identities=29%  Similarity=0.757  Sum_probs=2.6

Q ss_pred             ecccchh
Q psy6525         101 LCYICDE  107 (360)
Q Consensus       101 ~C~~C~~  107 (360)
                      .|..|+.
T Consensus         6 ~C~dCg~   12 (49)
T PF13451_consen    6 TCKDCGA   12 (49)
T ss_pred             EcccCCC
Confidence            3333333


No 191
>KOG3507|consensus
Probab=22.60  E-value=32  Score=21.95  Aligned_cols=11  Identities=36%  Similarity=0.860  Sum_probs=7.1

Q ss_pred             Ccccccccccc
Q psy6525         320 QDYKCYICGNR  330 (360)
Q Consensus       320 ~~~~C~~C~~~  330 (360)
                      ..++|..||..
T Consensus        36 D~irCReCG~R   46 (62)
T KOG3507|consen   36 DVIRCRECGYR   46 (62)
T ss_pred             CcEehhhcchH
Confidence            46667777654


No 192
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=22.19  E-value=32  Score=20.21  Aligned_cols=11  Identities=45%  Similarity=1.068  Sum_probs=6.0

Q ss_pred             ccccccccccc
Q psy6525         321 DYKCYICGNRY  331 (360)
Q Consensus       321 ~~~C~~C~~~f  331 (360)
                      +-.|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            34566665554


No 193
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=22.14  E-value=32  Score=25.61  Aligned_cols=12  Identities=25%  Similarity=0.786  Sum_probs=5.7

Q ss_pred             cccccccccccC
Q psy6525         157 FKCDLCSRTFNS  168 (360)
Q Consensus       157 ~~C~~C~~~f~~  168 (360)
                      +.|..|+..|.-
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            455555555543


No 194
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=21.91  E-value=21  Score=27.90  Aligned_cols=11  Identities=36%  Similarity=0.830  Sum_probs=5.6

Q ss_pred             cccccccccCC
Q psy6525         268 ECNLCAKLFAC  278 (360)
Q Consensus       268 ~C~~C~~~f~~  278 (360)
                      .|+.|+..|++
T Consensus        30 eC~~C~~RFTT   40 (156)
T COG1327          30 ECLECGERFTT   40 (156)
T ss_pred             cccccccccch
Confidence            45555555544


No 195
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=21.60  E-value=16  Score=36.12  Aligned_cols=28  Identities=21%  Similarity=0.516  Sum_probs=14.9

Q ss_pred             ccccccccCChhHHHHhHhhhcCCCccccccchh
Q psy6525         269 CNLCAKLFACKRSLQDHMQRHEEPNKYQCAMCKK  302 (360)
Q Consensus       269 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  302 (360)
                      |+.|.+.|.+..+.+-|.      .|..|+.||-
T Consensus       154 C~~C~~EY~dP~nRRfHA------Qp~aCp~CGP  181 (750)
T COG0068         154 CPFCDKEYKDPLNRRFHA------QPIACPKCGP  181 (750)
T ss_pred             CHHHHHHhcCcccccccc------ccccCcccCC
Confidence            666666655555544332      3455666654


No 196
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=21.47  E-value=29  Score=20.63  Aligned_cols=12  Identities=33%  Similarity=1.085  Sum_probs=7.0

Q ss_pred             cccccccccccC
Q psy6525         321 DYKCYICGNRYA  332 (360)
Q Consensus       321 ~~~C~~C~~~f~  332 (360)
                      |+.|..|+..|=
T Consensus        13 ~~~C~~C~~~FC   24 (43)
T PF01428_consen   13 PFKCKHCGKSFC   24 (43)
T ss_dssp             HEE-TTTS-EE-
T ss_pred             CeECCCCCcccC
Confidence            677888887774


No 197
>KOG2907|consensus
Probab=21.45  E-value=50  Score=24.35  Aligned_cols=12  Identities=33%  Similarity=0.827  Sum_probs=6.6

Q ss_pred             eeeccccccccc
Q psy6525         184 KYKCKECGKCYT  195 (360)
Q Consensus       184 ~~~C~~C~~~f~  195 (360)
                      -|.|+.|++.|.
T Consensus       102 FYTC~kC~~k~~  113 (116)
T KOG2907|consen  102 FYTCPKCKYKFT  113 (116)
T ss_pred             EEEcCccceeee
Confidence            355555555554


No 198
>KOG1842|consensus
Probab=21.26  E-value=55  Score=30.50  Aligned_cols=20  Identities=40%  Similarity=0.678  Sum_probs=10.0

Q ss_pred             cccccccccccChHHHHHHH
Q psy6525         130 FQCNVCFLMLNNRCYTRFHL  149 (360)
Q Consensus       130 ~~C~~C~~~f~~~~~l~~H~  149 (360)
                      |.||+|...|.+...|..|+
T Consensus        16 flCPiC~~dl~~~~~L~~H~   35 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHL   35 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHH
Confidence            44555555555555555444


No 199
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=20.98  E-value=1.2e+02  Score=24.68  Aligned_cols=14  Identities=29%  Similarity=0.688  Sum_probs=6.5

Q ss_pred             Cceeeccccccccc
Q psy6525         182 GVKYKCKECGKCYT  195 (360)
Q Consensus       182 ~~~~~C~~C~~~f~  195 (360)
                      ..-|.|+.|...|+
T Consensus       111 ~~~y~C~~~~~r~s  124 (176)
T COG1675         111 NNYYVCPNCHVKYS  124 (176)
T ss_pred             CCceeCCCCCCccc
Confidence            33455555544443


No 200
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=20.55  E-value=13  Score=21.82  Aligned_cols=10  Identities=40%  Similarity=1.315  Sum_probs=4.7

Q ss_pred             eecccccccc
Q psy6525         185 YKCKECGKCY  194 (360)
Q Consensus       185 ~~C~~C~~~f  194 (360)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            4455554443


No 201
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=20.11  E-value=19  Score=25.88  Aligned_cols=7  Identities=29%  Similarity=0.961  Sum_probs=2.8

Q ss_pred             ccccccc
Q psy6525         267 HECNLCA  273 (360)
Q Consensus       267 ~~C~~C~  273 (360)
                      |.|+.|+
T Consensus        23 FtCp~Cg   29 (104)
T COG4888          23 FTCPRCG   29 (104)
T ss_pred             EecCccC
Confidence            3344443


No 202
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=20.03  E-value=54  Score=24.57  Aligned_cols=13  Identities=15%  Similarity=0.644  Sum_probs=7.4

Q ss_pred             ccccccccccccC
Q psy6525         129 QFQCNVCFLMLNN  141 (360)
Q Consensus       129 ~~~C~~C~~~f~~  141 (360)
                      .+.|..|+..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            4566666655543


Done!