BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy6538
         (153 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4FYE|A Chain A, Crystal Structure Of A Legionella Phosphoinositide
           Phosphatase, Sidf
 pdb|4FYF|A Chain A, Structural Basis For Substrate Recognition By A Novel
           Legionella Phosphoinositide Phosphatase
 pdb|4FYG|A Chain A, Structural Basis For Substrate Recognition By A Novel
           Legionella Phosphoinositide Phosphatase
          Length = 761

 Score = 26.6 bits (57), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 84  KKHNDAVSEMGEQIDQLNKLKTNKEEATTEKVLKQLKHQLNEV 126
           KK   A+ E+  QID L K    + +    K L++LK Q++ V
Sbjct: 540 KKQESAIYELHNQIDALRKAYYTEHKGQINKALQELKEQISPV 582


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.306    0.120    0.296 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,439,388
Number of Sequences: 62578
Number of extensions: 73308
Number of successful extensions: 407
Number of sequences better than 100.0: 43
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 35
Number of HSP's that attempted gapping in prelim test: 396
Number of HSP's gapped (non-prelim): 44
length of query: 153
length of database: 14,973,337
effective HSP length: 90
effective length of query: 63
effective length of database: 9,341,317
effective search space: 588502971
effective search space used: 588502971
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 47 (22.7 bits)