Query         psy6545
Match_columns 59
No_of_seqs    25 out of 27
Neff          2.0 
Searched_HMMs 46136
Date          Fri Aug 16 20:45:39 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6545.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6545hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3582|consensus               99.9 4.5E-28 9.7E-33  196.4   2.0   43    3-45     98-140 (856)
  2 PF08550 DUF1752:  Fungal prote  92.5   0.022 4.9E-07   29.7  -0.8   27   11-37      2-28  (29)
  3 COG1696 DltB Predicted membran  47.7     7.9 0.00017   30.2   0.6   13   29-41    274-286 (425)
  4 PF10494 Stk19:  Serine-threoni  35.2      14 0.00031   26.4   0.3   20    2-21    207-226 (250)
  5 PHA01474 nonstructural protein  31.7      28  0.0006   20.9   1.1   19    6-25     26-44  (52)
  6 PF03937 Sdh5:  Flavinator of s  21.5      27 0.00058   20.5  -0.3   12   26-37      1-12  (74)
  7 cd00672 CysRS_core catalytic c  20.1      35 0.00075   23.4   0.0   21   34-54    112-139 (213)
  8 PF06006 DUF905:  Bacterial pro  18.0      27 0.00059   21.9  -0.8   11   29-39     43-53  (70)
  9 PF12550 GCR1_C:  Transcription  17.3      48   0.001   19.5   0.2   18   29-47     12-29  (81)
 10 KOG0893|consensus               16.1      50  0.0011   22.2   0.1   11   23-33     63-73  (125)

No 1  
>KOG3582|consensus
Probab=99.94  E-value=4.5e-28  Score=196.39  Aligned_cols=43  Identities=67%  Similarity=1.279  Sum_probs=41.6

Q ss_pred             CCCccCCCCCCCCcceEEeeccceechhhhhhhhhhhhccCce
Q psy6545           3 PQKLTSPKWNRFKGIRLRWKDKIRLNNVIWRCWYMQSIKVETH   45 (59)
Q Consensus         3 s~KL~SPKWK~Fkglkl~wkdkIRLNN~IWRaWhiQfvk~~~~   45 (59)
                      ||||||||||||||+||+|||||||||+|||||||||+|||+.
T Consensus        98 s~KltsPKWk~FKGlrL~wkdkiRLNNvIWRawyiqf~kkrk~  140 (856)
T KOG3582|consen   98 SGKLTSPKWKNFKGLRLLWKDKIRLNNVIWRAWYIQFVKKRKS  140 (856)
T ss_pred             ccccCCcccccccceeeeehhhhhhhhHHHHHHHHHHHHhccC
Confidence            7999999999999999999999999999999999999999874


No 2  
>PF08550 DUF1752:  Fungal protein of unknown function (DUF1752);  InterPro: IPR013860  This entry represents fungal proteins of unknown function. This short section domain is bounded by two highly conserved tryptophans. The entry contains P34072 from SWISSPROT that is thought to be a negative regulator of RAS-cAMP pathway in S. cerevisiae and the S. pombe member is a GAF1 transcription factor Q10280 from SWISSPROT that is also associated with the zinc finger family GATA PF00320 from PFAM. 
Probab=92.51  E-value=0.022  Score=29.65  Aligned_cols=27  Identities=26%  Similarity=0.668  Sum_probs=21.0

Q ss_pred             CCCCCcceEEeeccceechhhhhhhhh
Q psy6545          11 WNRFKGIRLRWKDKIRLNNVIWRCWYM   37 (59)
Q Consensus        11 WK~Fkglkl~wkdkIRLNN~IWRaWhi   37 (59)
                      |+-|-.-+-.-.+.-||.|+-||-|+.
T Consensus         2 Wk~~~~~k~~l~~~~RLeN~sWR~w~~   28 (29)
T PF08550_consen    2 WKMYTKCKDSLPNGERLENLSWRLWNK   28 (29)
T ss_pred             hhHHhhhhhhcCcchhHHHHHHHHHhc
Confidence            555555555667889999999999975


No 3  
>COG1696 DltB Predicted membrane protein involved in D-alanine export [Cell envelope biogenesis, outer membrane]
Probab=47.65  E-value=7.9  Score=30.17  Aligned_cols=13  Identities=31%  Similarity=0.726  Sum_probs=10.2

Q ss_pred             hhhhhhhhhhhhc
Q psy6545          29 NVIWRCWYMQSIK   41 (59)
Q Consensus        29 N~IWRaWhiQfvk   41 (59)
                      ++-||.|||-+-.
T Consensus       274 ~~FWrRWHmSLS~  286 (425)
T COG1696         274 KDFWRRWHMSLST  286 (425)
T ss_pred             HHHHHHHHhhHHH
Confidence            5689999997643


No 4  
>PF10494 Stk19:  Serine-threonine protein kinase 19;  InterPro: IPR018865  This serine-threonine protein kinase number 19 is expressed from the MHC and predominantly in the nucleus. Protein kinases are involved in signal transduction pathways and play fundamental roles in the regulation of cell functions. This is a novel Ser/Thr protein kinase, that has Mn2+-dependent protein kinase activity that phosphorylates alpha -casein at Ser/Thr residues and histone at Ser residues. It can be covalently modified by the reactive ATP analogue 5'-p-fluorosulphonylbenzoyladenosine in the absence of ATP, and this modification is prevented in the presence of 1 mM ATP, indicating that the kinase domain of is capable of binding ATP []. 
Probab=35.18  E-value=14  Score=26.36  Aligned_cols=20  Identities=30%  Similarity=0.775  Sum_probs=15.6

Q ss_pred             CCCCccCCCCCCCCcceEEe
Q psy6545           2 GPQKLTSPKWNRFKGIRLRW   21 (59)
Q Consensus         2 gs~KL~SPKWK~Fkglkl~w   21 (59)
                      +.++.-+.|||+|-|+.+.|
T Consensus       207 ~~~~~~~~k~k~~~gl~~~w  226 (250)
T PF10494_consen  207 DDSPGRTRKWKPFYGLGFRW  226 (250)
T ss_pred             cccchhhcccccccCcChhh
Confidence            34466788999999998854


No 5  
>PHA01474 nonstructural protein
Probab=31.74  E-value=28  Score=20.86  Aligned_cols=19  Identities=37%  Similarity=1.139  Sum_probs=14.8

Q ss_pred             ccCCCCCCCCcceEEeeccc
Q psy6545           6 LTSPKWNRFKGIRLRWKDKI   25 (59)
Q Consensus         6 L~SPKWK~Fkglkl~wkdkI   25 (59)
                      +.|| |+.|+..++.|+...
T Consensus        26 ilsp-wnsfrsfriswrtet   44 (52)
T PHA01474         26 ILSP-WNSFRSFRISWRTET   44 (52)
T ss_pred             eeCc-cccceeEEEEEeecc
Confidence            3444 999999999997543


No 6  
>PF03937 Sdh5:  Flavinator of succinate dehydrogenase;  InterPro: IPR005631 This entry represents a group of uncharacterised small proteins found in both eukaryotes and prokaryotes, including NMA1147 from Neisseria meningitidis [] and YgfY from Escherichia coli []. YgfY may be involved in transcriptional regulation. The structure of these proteins consists of a complex bundle of five alpha-helices, which is composed of an up-down 3-helix bundle plus an orthogonal 2-helix bundle. ; PDB: 2LM4_A 1PUZ_A 2JR5_A 1X6I_A 1X6J_A.
Probab=21.47  E-value=27  Score=20.50  Aligned_cols=12  Identities=33%  Similarity=0.734  Sum_probs=8.1

Q ss_pred             eechhhhhhhhh
Q psy6545          26 RLNNVIWRCWYM   37 (59)
Q Consensus        26 RLNN~IWRaWhi   37 (59)
                      |.+..+|||||-
T Consensus         1 r~kRl~~r~~rR   12 (74)
T PF03937_consen    1 RRKRLRWRCKRR   12 (74)
T ss_dssp             HHHHHHHHHSS-
T ss_pred             CcHHHHHHhhcc
Confidence            455678999874


No 7  
>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase. Cysteinyl tRNA synthetase (CysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=20.10  E-value=35  Score=23.39  Aligned_cols=21  Identities=14%  Similarity=0.300  Sum_probs=13.9

Q ss_pred             hhhhhhhc-------cCceeeeeehhhh
Q psy6545          34 CWYMQSIK-------VETHYHVTSRELM   54 (59)
Q Consensus        34 aWhiQfvk-------~~~~~~~~~~~~~   54 (59)
                      +|||||.-       ..-.+|+...+|+
T Consensus       112 tWh~ec~am~~~~lg~~~dih~~G~Dl~  139 (213)
T cd00672         112 VWHIECSAMAMKYLGETFDIHGGGVDLI  139 (213)
T ss_pred             ehhHHHHHHHHHHcCCCccEEeecCCCC
Confidence            39999753       3356777776654


No 8  
>PF06006 DUF905:  Bacterial protein of unknown function (DUF905);  InterPro: IPR009253 This family consists of several short hypothetical proteobacterial proteins of unknown function.; PDB: 2HJJ_A.
Probab=18.01  E-value=27  Score=21.91  Aligned_cols=11  Identities=27%  Similarity=1.250  Sum_probs=7.7

Q ss_pred             hhhhhhhhhhh
Q psy6545          29 NVIWRCWYMQS   39 (59)
Q Consensus        29 N~IWRaWhiQf   39 (59)
                      .-|||+|-.+.
T Consensus        43 ~mvWRaWNFEp   53 (70)
T PF06006_consen   43 QMVWRAWNFEP   53 (70)
T ss_dssp             -EEEEEESSST
T ss_pred             cEEEEeeccCC
Confidence            35899997654


No 9  
>PF12550 GCR1_C:  Transcriptional activator of glycolytic enzymes;  InterPro: IPR022210  This domain family is found in eukaryotes, and is approximately 80 amino acids in length. This family is activates the transcription of glycolytic enzymes. 
Probab=17.33  E-value=48  Score=19.47  Aligned_cols=18  Identities=17%  Similarity=0.628  Sum_probs=12.5

Q ss_pred             hhhhhhhhhhhhccCceee
Q psy6545          29 NVIWRCWYMQSIKVETHYH   47 (59)
Q Consensus        29 N~IWRaWhiQfvk~~~~~~   47 (59)
                      ..||+.|+.- ..++|+|+
T Consensus        12 ~dlw~Ew~~g-~~g~psI~   29 (81)
T PF12550_consen   12 YDLWREWFTG-LNGQPSIR   29 (81)
T ss_pred             HHHHHHHhcC-CCCCCCHH
Confidence            4689999976 45566554


No 10 
>KOG0893|consensus
Probab=16.14  E-value=50  Score=22.15  Aligned_cols=11  Identities=36%  Similarity=0.851  Sum_probs=8.7

Q ss_pred             ccceechhhhh
Q psy6545          23 DKIRLNNVIWR   33 (59)
Q Consensus        23 dkIRLNN~IWR   33 (59)
                      .-.|||++||-
T Consensus        63 ~Dt~lnkavwa   73 (125)
T KOG0893|consen   63 VDTRLNKAVWE   73 (125)
T ss_pred             ecchhhHHHHH
Confidence            34699999995


Done!