Query         psy6546
Match_columns 294
No_of_seqs    171 out of 1539
Neff          10.8
Searched_HMMs 46136
Date          Fri Aug 16 20:46:24 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6546.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6546hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 4.2E-28 9.1E-33  186.2   4.9  127  151-278   131-263 (279)
  2 KOG2462|consensus               99.9 2.5E-27 5.5E-32  181.9   7.0  137   29-199   127-265 (279)
  3 KOG1074|consensus               99.9 3.9E-28 8.5E-33  210.4   2.0  142  151-292   606-941 (958)
  4 KOG3608|consensus               99.9 5.5E-26 1.2E-30  179.2  10.4  232   27-283   129-377 (467)
  5 KOG3608|consensus               99.9 1.2E-23 2.6E-28  166.0  13.5  183   99-282   139-345 (467)
  6 KOG1074|consensus               99.9 1.8E-22 3.9E-27  175.6   7.9  161   95-255   604-931 (958)
  7 KOG3623|consensus               99.8 1.2E-21 2.6E-26  168.0   6.9  116   30-145   208-331 (1007)
  8 KOG3623|consensus               99.8 3.2E-19   7E-24  153.2   8.1  102   97-198   211-330 (1007)
  9 KOG3576|consensus               99.6 3.5E-17 7.6E-22  120.0   1.2   77  151-227   118-196 (267)
 10 KOG3576|consensus               99.6   9E-16 1.9E-20  112.7   3.1  106  124-229   118-237 (267)
 11 PLN03086 PRLI-interacting fact  99.3   2E-12 4.4E-17  112.2   7.4  145  124-283   408-565 (567)
 12 PLN03086 PRLI-interacting fact  99.2 1.2E-10 2.5E-15  101.5  12.0  154   30-225   405-561 (567)
 13 PHA00733 hypothetical protein   99.1 3.7E-11 8.1E-16   85.4   3.3   79  204-283    40-124 (128)
 14 PHA02768 hypothetical protein;  99.0 1.5E-10 3.2E-15   67.5   2.2   43  232-275     6-48  (55)
 15 KOG3993|consensus               98.9 1.1E-10 2.5E-15   95.4  -0.3  160  124-283   268-483 (500)
 16 PHA00733 hypothetical protein   98.9 1.2E-09 2.6E-14   77.7   4.4   60  168-228    64-123 (128)
 17 PHA02768 hypothetical protein;  98.9 8.2E-10 1.8E-14   64.4   2.1   43  204-247     5-47  (55)
 18 KOG3993|consensus               98.8 3.3E-10 7.1E-15   92.8  -1.7  163   91-253   262-480 (500)
 19 PHA00616 hypothetical protein   98.5 2.8E-08   6E-13   55.1   0.8   32  258-289     1-32  (44)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.4 1.9E-07 4.2E-12   46.5   1.9   24  246-269     1-25  (26)
 21 PHA00732 hypothetical protein   98.3 7.1E-07 1.5E-11   57.5   2.7   47  204-255     1-48  (79)
 22 PHA00732 hypothetical protein   98.3   8E-07 1.7E-11   57.2   2.9   43  178-225     2-45  (79)
 23 PF13465 zf-H2C2_2:  Zinc-finge  98.2 1.2E-06 2.6E-11   43.6   2.3   24  219-242     1-25  (26)
 24 PHA00616 hypothetical protein   98.1 1.2E-06 2.7E-11   48.6   1.7   27  204-230     1-27  (44)
 25 PF05605 zf-Di19:  Drought indu  98.1 3.1E-06 6.8E-11   50.6   3.3   49  232-283     3-54  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  97.9 1.1E-05 2.3E-10   38.9   2.4   22  205-226     1-22  (23)
 27 PF12756 zf-C2H2_2:  C2H2 type   97.9 5.5E-06 1.2E-10   56.8   1.3   71  207-280     2-72  (100)
 28 PF00096 zf-C2H2:  Zinc finger,  97.8 1.1E-05 2.5E-10   38.8   1.9   22  259-280     1-22  (23)
 29 PF05605 zf-Di19:  Drought indu  97.8 4.7E-05   1E-09   45.5   4.3   46  205-253     3-51  (54)
 30 PF12756 zf-C2H2_2:  C2H2 type   97.8 2.4E-05 5.1E-10   53.6   3.1   72  153-227     2-73  (100)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.8 9.9E-06 2.2E-10   39.4   0.9   24  259-282     1-24  (24)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.8E-05   4E-10   39.8   1.2   26  258-283     1-26  (27)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.7 5.6E-05 1.2E-09   36.7   2.8   23  205-227     1-23  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.5 7.5E-05 1.6E-09   37.5   1.7   24  204-227     1-24  (27)
 35 COG5189 SFP1 Putative transcri  97.5 6.1E-05 1.3E-09   60.2   1.9   72   28-116   345-418 (423)
 36 PF13909 zf-H2C2_5:  C2H2-type   97.2 0.00011 2.4E-09   35.7   0.5   24  259-283     1-24  (24)
 37 PF09237 GAGA:  GAGA factor;  I  97.0 0.00022 4.9E-09   40.5   0.2   39  248-286    12-52  (54)
 38 KOG2231|consensus               96.9  0.0051 1.1E-07   55.4   8.6   50  206-255   184-236 (669)
 39 smart00355 ZnF_C2H2 zinc finge  96.8   0.001 2.3E-08   32.6   2.2   19  234-252     3-21  (26)
 40 smart00355 ZnF_C2H2 zinc finge  96.8  0.0014 3.1E-08   32.1   2.5   24  205-228     1-24  (26)
 41 COG5189 SFP1 Putative transcri  96.8 0.00036 7.9E-09   55.9   0.4   68  202-279   347-419 (423)
 42 PF12874 zf-met:  Zinc-finger o  96.7  0.0012 2.6E-08   32.3   1.6   22  205-226     1-22  (25)
 43 KOG2231|consensus               96.6  0.0092   2E-07   53.8   7.8  102   98-201   117-236 (669)
 44 PF13909 zf-H2C2_5:  C2H2-type   96.6   0.002 4.4E-08   31.1   2.2   22  205-227     1-22  (24)
 45 PF09237 GAGA:  GAGA factor;  I  96.5  0.0035 7.7E-08   35.7   2.9   28  203-230    23-50  (54)
 46 PF12874 zf-met:  Zinc-finger o  96.4  0.0014 3.1E-08   32.0   0.8   22  259-280     1-22  (25)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.3  0.0021 4.5E-08   32.1   1.2   22  259-280     2-23  (27)
 48 KOG1146|consensus               96.2  0.0026 5.6E-08   60.8   2.3  104   31-145   464-611 (1406)
 49 KOG1146|consensus               96.2  0.0011 2.4E-08   63.1  -0.3   99  126-226   439-540 (1406)
 50 PRK04860 hypothetical protein;  95.3  0.0081 1.8E-07   44.5   1.4   36  204-243   119-155 (160)
 51 PRK04860 hypothetical protein;  95.3   0.013 2.7E-07   43.5   2.2   35  232-270   120-155 (160)
 52 KOG2785|consensus               95.1   0.016 3.4E-07   48.2   2.5   82   32-119     3-91  (390)
 53 PF12171 zf-C2H2_jaz:  Zinc-fin  95.0    0.01 2.3E-07   29.5   0.8   21  232-252     2-22  (27)
 54 PF13913 zf-C2HC_2:  zinc-finge  94.7   0.038 8.2E-07   26.9   2.4   22   32-54      2-23  (25)
 55 COG5236 Uncharacterized conser  94.5   0.048   1E-06   44.7   3.7   79  206-284   222-307 (493)
 56 KOG2482|consensus               94.5    0.33 7.2E-06   39.9   8.4   63  111-173   130-218 (423)
 57 COG5236 Uncharacterized conser  94.3    0.15 3.3E-06   41.9   6.2  137   32-175   151-306 (493)
 58 PF13913 zf-C2HC_2:  zinc-finge  94.2   0.053 1.2E-06   26.4   2.2   19  206-225     4-22  (25)
 59 KOG2785|consensus               94.2    0.18   4E-06   42.1   6.5   49  204-252   166-241 (390)
 60 smart00451 ZnF_U1 U1-like zinc  94.1   0.049 1.1E-06   28.9   2.1   23  204-226     3-25  (35)
 61 smart00451 ZnF_U1 U1-like zinc  92.1    0.14 3.1E-06   27.0   2.1   23   96-118     3-25  (35)
 62 KOG2482|consensus               91.0    0.39 8.4E-06   39.6   4.3   53   94-146   142-218 (423)
 63 COG4049 Uncharacterized protei  90.9    0.14 3.1E-06   29.8   1.3   30   28-57     13-42  (65)
 64 KOG4173|consensus               90.9    0.17 3.7E-06   38.4   2.1   46  151-198    80-127 (253)
 65 cd00350 rubredoxin_like Rubred  90.8    0.12 2.6E-06   27.1   0.8   11  205-215     2-12  (33)
 66 KOG2893|consensus               90.1   0.092   2E-06   40.7   0.1   42   98-142    12-53  (341)
 67 PF12013 DUF3505:  Protein of u  88.9    0.46   1E-05   32.9   2.9   80  203-283    10-109 (109)
 68 COG5048 FOG: Zn-finger [Genera  87.0   0.099 2.1E-06   45.9  -1.8   53  124-176   290-349 (467)
 69 TIGR00622 ssl1 transcription f  86.9    0.67 1.5E-05   31.9   2.6   20   31-50     14-33  (112)
 70 KOG2893|consensus               86.3    0.21 4.5E-06   38.9  -0.1   47  204-254    11-58  (341)
 71 KOG2186|consensus               84.3    0.57 1.2E-05   37.0   1.4   45  124-170     4-48  (276)
 72 COG5048 FOG: Zn-finger [Genera  83.8    0.34 7.3E-06   42.5   0.0   58  231-288   289-353 (467)
 73 TIGR00622 ssl1 transcription f  83.5     2.3   5E-05   29.3   3.9   49   98-147    57-105 (112)
 74 PF06524 NOA36:  NOA36 protein;  83.5     0.5 1.1E-05   37.4   0.8   26  256-281   207-232 (314)
 75 PF10571 UPF0547:  Uncharacteri  83.1    0.74 1.6E-05   22.6   1.1    6  207-212    17-22  (26)
 76 COG2888 Predicted Zn-ribbon RN  82.8    0.94   2E-05   27.0   1.6   31  232-266    28-58  (61)
 77 KOG2186|consensus               82.1    0.93   2E-05   35.8   1.8   47  178-226     4-50  (276)
 78 PF12013 DUF3505:  Protein of u  82.0     3.4 7.4E-05   28.5   4.5   27   31-57     79-109 (109)
 79 cd00729 rubredoxin_SM Rubredox  81.6     0.7 1.5E-05   24.4   0.7    9  258-266    18-26  (34)
 80 KOG4173|consensus               81.6    0.72 1.6E-05   35.1   1.0   81  177-259    79-176 (253)
 81 smart00659 RPOLCX RNA polymera  79.9     0.9   2E-05   25.6   0.8   11  205-215     3-13  (44)
 82 COG4049 Uncharacterized protei  79.8       1 2.2E-05   26.3   1.0   25  204-228    17-41  (65)
 83 PF09538 FYDLN_acid:  Protein o  79.5     1.8 3.9E-05   29.8   2.4   11   59-69      9-19  (108)
 84 PF06524 NOA36:  NOA36 protein;  78.2    0.76 1.7E-05   36.4   0.3   20  121-140   207-226 (314)
 85 PF14353 CpXC:  CpXC protein     77.7     1.1 2.3E-05   32.1   0.9   20   94-113    36-55  (128)
 86 PRK00464 nrdR transcriptional   77.2     1.3 2.8E-05   32.7   1.2   18   96-113    28-45  (154)
 87 PF05443 ROS_MUCR:  ROS/MUCR tr  76.3     2.2 4.8E-05   30.5   2.1   33   23-58     63-95  (132)
 88 TIGR00373 conserved hypothetic  75.7     3.2 6.8E-05   31.0   2.9   17  204-220   109-125 (158)
 89 PF13719 zinc_ribbon_5:  zinc-r  75.0     1.5 3.3E-05   23.5   0.8   11   96-106    25-35  (37)
 90 PF13717 zinc_ribbon_4:  zinc-r  74.0     1.9 4.2E-05   23.0   1.1   10   97-106    26-35  (36)
 91 PF12907 zf-met2:  Zinc-binding  73.8       2 4.3E-05   23.6   1.1   29  259-287     2-33  (40)
 92 TIGR02098 MJ0042_CXXC MJ0042 f  73.4     2.1 4.6E-05   23.0   1.2   10   97-106    26-35  (38)
 93 smart00834 CxxC_CXXC_SSSS Puta  73.1    0.58 1.3E-05   25.7  -1.2   11   33-43      6-16  (41)
 94 PF13878 zf-C2H2_3:  zinc-finge  72.6     6.6 0.00014   21.7   3.0   25   32-56     13-39  (41)
 95 COG1996 RPC10 DNA-directed RNA  72.3     1.6 3.5E-05   25.1   0.5   10  232-241     7-16  (49)
 96 cd00730 rubredoxin Rubredoxin;  70.2     4.7  0.0001   23.4   2.1   12   60-71      2-13  (50)
 97 TIGR02605 CxxC_CxxC_SSSS putat  69.1    0.85 1.8E-05   26.6  -1.1   29   33-67      6-34  (52)
 98 PRK06266 transcription initiat  69.1     2.3   5E-05   32.4   0.9   31  204-242   117-147 (178)
 99 TIGR00373 conserved hypothetic  68.6     3.7 8.1E-05   30.6   1.9   30  177-214   109-138 (158)
100 smart00531 TFIIE Transcription  68.5     5.8 0.00013   29.1   2.9   12  232-243   100-111 (147)
101 smart00734 ZnF_Rad18 Rad18-lik  68.2     5.5 0.00012   19.4   1.9   19  206-225     3-21  (26)
102 COG4957 Predicted transcriptio  67.5      10 0.00022   27.0   3.6   34   22-58     66-99  (148)
103 COG1592 Rubrerythrin [Energy p  67.3     2.7 5.9E-05   31.4   1.0    9  205-213   135-143 (166)
104 PF03604 DNA_RNApol_7kD:  DNA d  66.9     1.9 4.2E-05   22.3   0.1    7  232-238    18-24  (32)
105 PF02892 zf-BED:  BED zinc fing  65.8     2.3   5E-05   23.8   0.3   20  259-278    17-40  (45)
106 PRK14890 putative Zn-ribbon RN  65.3     4.1   9E-05   24.4   1.3    8  204-211    48-55  (59)
107 PF09986 DUF2225:  Uncharacteri  65.0       1 2.3E-05   35.4  -1.7   11  124-134    49-59  (214)
108 PF08274 PhnA_Zn_Ribbon:  PhnA   64.9     2.3   5E-05   21.7   0.1   11  256-266    17-27  (30)
109 smart00614 ZnF_BED BED zinc fi  64.7     6.3 0.00014   22.7   2.0   21  205-225    19-44  (50)
110 PRK00398 rpoP DNA-directed RNA  63.8     4.4 9.6E-05   22.9   1.2   11   59-69      3-13  (46)
111 PRK06266 transcription initiat  63.6     5.1 0.00011   30.5   1.8   30  177-214   117-146 (178)
112 PF09788 Tmemb_55A:  Transmembr  63.4     6.7 0.00015   31.3   2.5   32   31-69     64-95  (256)
113 PF00301 Rubredoxin:  Rubredoxi  62.1     3.4 7.4E-05   23.6   0.5   11   95-105    33-43  (47)
114 TIGR02300 FYDLN_acid conserved  60.2     8.2 0.00018   27.2   2.2   10   60-69     10-19  (129)
115 PHA00626 hypothetical protein   59.3     4.2 9.1E-05   24.0   0.5   16   30-45     21-36  (59)
116 PF09723 Zn-ribbon_8:  Zinc rib  59.0     6.3 0.00014   21.8   1.2   10   60-69      6-15  (42)
117 COG1998 RPS31 Ribosomal protei  58.4     6.4 0.00014   22.5   1.2   14  227-240    33-46  (51)
118 KOG4167|consensus               57.3     8.5 0.00018   35.6   2.4   27   94-120   790-816 (907)
119 PF15269 zf-C2H2_7:  Zinc-finge  57.2      15 0.00033   20.5   2.5   26   30-55     18-43  (54)
120 PF05290 Baculo_IE-1:  Baculovi  57.2     3.3 7.1E-05   29.4  -0.1   10  178-187    81-90  (140)
121 PF05443 ROS_MUCR:  ROS/MUCR tr  56.3     5.4 0.00012   28.6   0.8   24  259-285    73-96  (132)
122 KOG4377|consensus               56.3     5.1 0.00011   34.2   0.8  102  151-255   272-427 (480)
123 COG1997 RPL43A Ribosomal prote  55.2     8.4 0.00018   25.1   1.5   14   95-108    52-65  (89)
124 COG1198 PriA Primosomal protei  53.4      11 0.00024   35.5   2.5   10  123-132   475-484 (730)
125 PF07754 DUF1610:  Domain of un  52.7     5.6 0.00012   19.1   0.3    7  232-238    17-23  (24)
126 PF04959 ARS2:  Arsenite-resist  52.4     4.3 9.4E-05   31.8  -0.2   21  232-252    78-98  (214)
127 PRK04023 DNA polymerase II lar  49.6      21 0.00045   34.8   3.6    9  124-132   627-635 (1121)
128 PF02176 zf-TRAF:  TRAF-type zi  49.5     9.7 0.00021   22.7   1.1    7  111-117    25-31  (60)
129 KOG4167|consensus               48.5      14 0.00031   34.2   2.4   27   30-56    790-816 (907)
130 PRK04023 DNA polymerase II lar  48.3      19 0.00042   34.9   3.3   11  232-242   664-674 (1121)
131 KOG2593|consensus               47.9      11 0.00024   32.6   1.5   11   59-69    128-138 (436)
132 PF04959 ARS2:  Arsenite-resist  47.7      17 0.00036   28.6   2.4   26  204-229    77-102 (214)
133 KOG2807|consensus               46.4      26 0.00056   29.2   3.3   17  204-220   290-306 (378)
134 PRK09678 DNA-binding transcrip  45.6       3 6.5E-05   26.3  -1.6   18  257-274    26-45  (72)
135 smart00440 ZnF_C2C2 C2C2 Zinc   45.0      14 0.00031   20.2   1.2   13   95-107    27-39  (40)
136 PF01096 TFIIS_C:  Transcriptio  44.7     8.3 0.00018   21.0   0.2   12   95-106    27-38  (39)
137 KOG1701|consensus               44.7     5.2 0.00011   34.4  -0.8   11  259-269   428-438 (468)
138 KOG2272|consensus               43.7      18 0.00038   28.9   1.9   15  123-137    99-113 (332)
139 COG1773 Rubredoxin [Energy pro  43.5      21 0.00045   21.2   1.7    9   96-104    36-44  (55)
140 KOG2071|consensus               41.9      22 0.00048   32.2   2.5   31   27-57    413-443 (579)
141 PF09845 DUF2072:  Zn-ribbon co  39.8      16 0.00034   26.1   1.0   12  205-216     2-13  (131)
142 COG3091 SprT Zn-dependent meta  39.8      13 0.00029   27.2   0.7   33  204-240   117-149 (156)
143 PRK03824 hypA hydrogenase nick  39.2      21 0.00045   25.8   1.6   13   96-108    70-82  (135)
144 PF12760 Zn_Tnp_IS1595:  Transp  38.8      23 0.00051   19.9   1.5    9  257-265    36-44  (46)
145 KOG4377|consensus               38.5      18 0.00039   31.1   1.3   79  205-288   272-375 (480)
146 PF13451 zf-trcl:  Probable zin  37.5      18 0.00039   20.9   0.9   12  232-243     5-16  (49)
147 COG3364 Zn-ribbon containing p  36.2      24 0.00052   23.8   1.4   12  205-216     3-14  (112)
148 KOG2593|consensus               34.4      24 0.00051   30.7   1.5   39   91-131   123-161 (436)
149 KOG3408|consensus               34.2      26 0.00056   24.5   1.3   29   91-119    52-80  (129)
150 PF14369 zf-RING_3:  zinc-finge  34.0      19 0.00041   19.0   0.6   11   33-43      3-13  (35)
151 KOG2907|consensus               33.6      27 0.00058   24.1   1.3   11  259-269   103-113 (116)
152 COG1198 PriA Primosomal protei  31.4      13 0.00029   35.0  -0.4   12  256-267   473-484 (730)
153 PF13453 zf-TFIIB:  Transcripti  31.2      37 0.00081   18.5   1.5   19  204-222    19-37  (41)
154 PF03811 Zn_Tnp_IS1:  InsA N-te  30.8      34 0.00073   18.3   1.2   15   88-102    21-35  (36)
155 PRK12496 hypothetical protein;  30.6      13 0.00029   27.8  -0.5   10  205-214   128-137 (164)
156 TIGR01206 lysW lysine biosynth  30.3      24 0.00052   20.9   0.6    9   98-106     4-12  (54)
157 PF03145 Sina:  Seven in absent  30.1      34 0.00074   26.5   1.7   48  236-285    23-74  (198)
158 COG5151 SSL1 RNA polymerase II  30.1      54  0.0012   27.2   2.7   26   94-119   386-411 (421)
159 KOG3408|consensus               30.0      29 0.00063   24.3   1.1   21  232-252    58-78  (129)
160 PF04780 DUF629:  Protein of un  29.3      48   0.001   29.5   2.5   25  203-227    56-80  (466)
161 PTZ00255 60S ribosomal protein  29.3      28  0.0006   23.1   0.8   14   95-108    53-66  (90)
162 KOG1280|consensus               28.9      64  0.0014   27.3   3.0   39   28-66     75-116 (381)
163 PF01780 Ribosomal_L37ae:  Ribo  28.6      17 0.00037   24.1  -0.2   13   95-107    52-64  (90)
164 PF14446 Prok-RING_1:  Prokaryo  28.6      34 0.00074   20.2   1.0   10   97-106    22-31  (54)
165 PF04216 FdhE:  Protein involve  28.0       6 0.00013   32.8  -3.0   10  151-160   198-207 (290)
166 KOG4727|consensus               28.0      26 0.00056   26.2   0.6   22  257-278    74-95  (193)
167 TIGR00280 L37a ribosomal prote  27.4      29 0.00062   23.1   0.7   14   95-108    52-65  (91)
168 PRK00432 30S ribosomal protein  27.3      25 0.00055   20.4   0.4   10  231-240    37-46  (50)
169 PRK04351 hypothetical protein;  27.1      31 0.00068   25.4   0.9   31  204-241   112-142 (149)
170 PF04423 Rad50_zn_hook:  Rad50   26.9      23  0.0005   20.7   0.2   14   34-47     22-35  (54)
171 smart00154 ZnF_AN1 AN1-like Zi  26.6      38 0.00083   18.4   1.0   14  204-217    12-25  (39)
172 PF10013 DUF2256:  Uncharacteri  26.5      26 0.00057   19.4   0.3   13  260-272    10-22  (42)
173 COG0068 HypF Hydrogenase matur  26.5      30 0.00064   32.3   0.8   83   30-132    99-182 (750)
174 COG1656 Uncharacterized conser  25.9      82  0.0018   23.6   2.8   17  204-220   130-146 (165)
175 COG1675 TFA1 Transcription ini  25.8      91   0.002   23.7   3.2   13  204-216   113-125 (176)
176 KOG1280|consensus               25.6      61  0.0013   27.4   2.4   21  124-144    80-100 (381)
177 TIGR00100 hypA hydrogenase nic  25.5      26 0.00056   24.5   0.2   12  205-216    71-82  (115)
178 PRK12380 hydrogenase nickel in  25.4      25 0.00054   24.5   0.1   10  205-214    71-80  (113)
179 PF07975 C1_4:  TFIIH C1-like d  25.0      16 0.00035   21.3  -0.7   23  232-254    22-44  (51)
180 PF01155 HypA:  Hydrogenase exp  24.8      22 0.00047   24.8  -0.3   12  205-216    71-82  (113)
181 PRK03976 rpl37ae 50S ribosomal  24.4      34 0.00073   22.7   0.6   14   95-108    53-66  (90)
182 PF10263 SprT-like:  SprT-like   24.1      20 0.00044   26.4  -0.5   31  204-241   123-153 (157)
183 PF12773 DZR:  Double zinc ribb  24.0      45 0.00097   19.0   1.0    6  179-184    31-36  (50)
184 PF09963 DUF2197:  Uncharacteri  23.8      19 0.00042   21.4  -0.5    8  123-130    31-38  (56)
185 COG2879 Uncharacterized small   23.7      45 0.00097   20.3   1.0   21  267-287    21-41  (65)
186 PF08790 zf-LYAR:  LYAR-type C2  23.6      39 0.00084   16.9   0.6    9  260-268     2-10  (28)
187 PF01363 FYVE:  FYVE zinc finge  23.5      43 0.00094   20.6   1.0    8  180-187    12-19  (69)
188 PF01927 Mut7-C:  Mut7-C RNAse   23.5      50  0.0011   24.2   1.5   12  124-135   125-136 (147)
189 PF08271 TF_Zn_Ribbon:  TFIIB z  23.1      37  0.0008   18.7   0.5   14   94-107    17-30  (43)
190 PF13824 zf-Mss51:  Zinc-finger  22.8      70  0.0015   19.0   1.6   18   28-45     10-27  (55)
191 TIGR00244 transcriptional regu  22.6      55  0.0012   24.0   1.4   16   97-112    29-44  (147)
192 COG0068 HypF Hydrogenase matur  21.7      23 0.00049   33.0  -0.8   57  152-213   125-182 (750)
193 PF01428 zf-AN1:  AN1-like Zinc  20.9      42  0.0009   18.6   0.4   13  204-216    13-25  (43)
194 smart00731 SprT SprT homologue  20.9      37  0.0008   24.8   0.3   32  204-241   112-143 (146)
195 PF06220 zf-U1:  U1 zinc finger  20.6      97  0.0021   16.7   1.8   21   32-52      3-25  (38)
196 PF07282 OrfB_Zn_ribbon:  Putat  20.6      95  0.0021   19.0   2.1   12  204-215    46-57  (69)
197 TIGR00686 phnA alkylphosphonat  20.4      62  0.0013   22.2   1.2   11  204-214    19-29  (109)
198 KOG4124|consensus               20.4      18 0.00039   30.3  -1.5   70   29-115   346-417 (442)

No 1  
>KOG2462|consensus
Probab=99.94  E-value=4.2e-28  Score=186.19  Aligned_cols=127  Identities=28%  Similarity=0.694  Sum_probs=79.6

Q ss_pred             ccCCCCCcccCCHHHHHHHHHhhcC----CCcccCcchhccCCchHHHhHHhhcCCCceeCCCCccccCCHHHHHHHHHH
Q psy6546         151 YICHACPREFSSEATMKAHVASHNG----VQHACDQCDRTFSCMPYLRQHQKLHSGITYSCPSCSKSFNRKDRYRMHLKL  226 (294)
Q Consensus       151 ~~C~~C~~~f~~~~~l~~H~~~~~~----~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~  226 (294)
                      |.|+.||+.+.+.+.|.+|.+.|-.    ..+.|++|++++.+...|..|+++|. -+++|.+||+.|.+..-|+.|+++
T Consensus       131 ~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~-l~c~C~iCGKaFSRPWLLQGHiRT  209 (279)
T KOG2462|consen  131 YKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT-LPCECGICGKAFSRPWLLQGHIRT  209 (279)
T ss_pred             eeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC-CCcccccccccccchHHhhccccc
Confidence            5555555555555555555555432    24566666666666666666666665 266666666666666666666666


Q ss_pred             hCCCc-cccccccccccCHHHHHHHHhhhc-ccccccccccccccchhhhhhhh
Q psy6546         227 HQGVR-HTCKECSKEFSNEYNLKNHMVLHD-VRAYVCELCARQFTRVDHFNHHR  278 (294)
Q Consensus       227 h~~~~-~~C~~C~~~f~~~~~l~~H~~~h~-~~~~~C~~C~~~f~~~~~l~~H~  278 (294)
                      |+|++ |.|+.|+++|.++++|+.|+++|. .+.|+|..|++.|..++.|.+|.
T Consensus       210 HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  210 HTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             ccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhh
Confidence            66665 666666666666666666666664 56666666666666666666664


No 2  
>KOG2462|consensus
Probab=99.94  E-value=2.5e-27  Score=181.90  Aligned_cols=137  Identities=28%  Similarity=0.677  Sum_probs=119.9

Q ss_pred             CCCCccCccchhccCCHHHHHHHHHHhCCcccCCccCccchhccccCCCCCCCccchhhcccCCCCCcccCCccCccccC
Q psy6546          29 TPTRHPCPQCSRDFATVKILKTHLKTHEGIIYPCPECDKTFLSTLTGTPQGARGRAVYLSRMSTTLTRHPCPQCSRDFAT  108 (294)
Q Consensus        29 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~  108 (294)
                      ....|+|+.||+.|++...|.+|.+.|-.      .                           ...+.+.|+.|++.|.+
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~------~---------------------------~s~ka~~C~~C~K~YvS  173 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRS------L---------------------------DSKKAFSCKYCGKVYVS  173 (279)
T ss_pred             cCCceeccccccccccccccchhhccccc------c---------------------------cccccccCCCCCceeee
Confidence            34569999999999999999999988731      0                           11456889999999999


Q ss_pred             hHHHHHHHhhccCcccCCcccccccCChHhHHHHHhhhCCCC-ccCCCCCcccCCHHHHHHHHHhhcCC-CcccCcchhc
Q psy6546         109 VKILKTHLKTHEGIIYPCPECDKTFLSTSGLREHRKVHAGVR-YICHACPREFSSEATMKAHVASHNGV-QHACDQCDRT  186 (294)
Q Consensus       109 ~~~l~~H~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~-~~C~~C~~~f~~~~~l~~H~~~~~~~-~~~C~~C~~~  186 (294)
                      ...|..|+++|. .+.+|.+||+.|...+.|+.|++.|+|++ |.|+.|++.|.++++|+.||++|.+. +|.|..|+|.
T Consensus       174 mpALkMHirTH~-l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~Ks  252 (279)
T KOG2462|consen  174 MPALKMHIRTHT-LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKS  252 (279)
T ss_pred             hHHHhhHhhccC-CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhH
Confidence            999999999988 67999999999999999999999999988 99999999999999999999999885 8888888888


Q ss_pred             cCCchHHHhHHhh
Q psy6546         187 FSCMPYLRQHQKL  199 (294)
Q Consensus       187 f~~~~~l~~H~~~  199 (294)
                      |...+.|..|...
T Consensus       253 Fsl~SyLnKH~ES  265 (279)
T KOG2462|consen  253 FALKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHHHhhhh
Confidence            8888888888654


No 3  
>KOG1074|consensus
Probab=99.94  E-value=3.9e-28  Score=210.37  Aligned_cols=142  Identities=27%  Similarity=0.596  Sum_probs=128.6

Q ss_pred             ccCCCCCcccCCHHHHHHHHHhhcCC-CcccCcchhccCCchHHHhHHhhcCCC-----ceeCC---CCccccCCHHHHH
Q psy6546         151 YICHACPREFSSEATMKAHVASHNGV-QHACDQCDRTFSCMPYLRQHQKLHSGI-----TYSCP---SCSKSFNRKDRYR  221 (294)
Q Consensus       151 ~~C~~C~~~f~~~~~l~~H~~~~~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~-----~~~C~---~C~~~f~~~~~l~  221 (294)
                      ..|-.|.+++.-.+.|+.|.++|+|+ ||+|.+|++.|..+.+|+.|+-.|..+     .+.|+   +|.+.|...-.|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            67999999999999999999999998 999999999999999999999999775     58899   9999999999999


Q ss_pred             HHHHHhCC------------------------------------------------------------------------
Q psy6546         222 MHLKLHQG------------------------------------------------------------------------  229 (294)
Q Consensus       222 ~H~~~h~~------------------------------------------------------------------------  229 (294)
                      +|+++|.+                                                                        
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence            99888740                                                                        


Q ss_pred             --------------------------------------------------------------------------------
Q psy6546         230 --------------------------------------------------------------------------------  229 (294)
Q Consensus       230 --------------------------------------------------------------------------------  229 (294)
                                                                                                      
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence                                                                                            


Q ss_pred             --------------------------C------ccccccccccccCHHHHHHHHhhhc-ccccccccccccccchhhhhh
Q psy6546         230 --------------------------V------RHTCKECSKEFSNEYNLKNHMVLHD-VRAYVCELCARQFTRVDHFNH  276 (294)
Q Consensus       230 --------------------------~------~~~C~~C~~~f~~~~~l~~H~~~h~-~~~~~C~~C~~~f~~~~~l~~  276 (294)
                                                +      +..|..||+.|...++|..|+++|. ++||.|..|+++|+.+.+|+.
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKv  925 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKV  925 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhh
Confidence                                      0      1679999999999999999999997 999999999999999999999


Q ss_pred             hhhhccCccccccccc
Q psy6546         277 HRRLQHDPEEFEKVGA  292 (294)
Q Consensus       277 H~~~~h~~~~~~~~~~  292 (294)
                      ||.+|+-..+.--+++
T Consensus       926 HMgtH~w~q~~srrG~  941 (958)
T KOG1074|consen  926 HMGTHMWVQPPSRRGP  941 (958)
T ss_pred             hhccccccCCCccCCC
Confidence            9999998887755544


No 4  
>KOG3608|consensus
Probab=99.93  E-value=5.5e-26  Score=179.17  Aligned_cols=232  Identities=22%  Similarity=0.495  Sum_probs=192.8

Q ss_pred             CCCCCCccCc--cchhccCCHHHHHHHHHHhCCcccCCccCccchhccccCCCCCCCccchhhcccCCCC---CcccCCc
Q psy6546          27 STTPTRHPCP--QCSRDFATVKILKTHLKTHEGIIYPCPECDKTFLSTLTGTPQGARGRAVYLSRMSTTL---TRHPCPQ  101 (294)
Q Consensus        27 ~~~~~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~C~~  101 (294)
                      +.-+..|.|.  .|++.|.+...|..|+..|...   |   ...+                  ......+   .+-.+..
T Consensus       129 p~~g~~f~C~WedCe~~F~s~~ef~dHV~~H~l~---c---eyd~------------------~~~~~D~~pv~~C~W~~  184 (467)
T KOG3608|consen  129 PALGQNFRCGWEDCEREFVSIVEFQDHVVKHALF---C---EYDI------------------QKTPEDERPVTMCNWAM  184 (467)
T ss_pred             ccchhhhccChhhcCCcccCHHHHHHHHHHhhhh---h---hhhh------------------hhCCCCCCceeeccchh
Confidence            3345568886  4999999999999999887531   1   1110                  0011111   2234568


Q ss_pred             cCccccChHHHHHHHhhccCc-ccCCcccccccCChHhHHHHHhhhCCC---CccCCCCCcccCCHHHHHHHHHhhcCCC
Q psy6546         102 CSRDFATVKILKTHLKTHEGI-IYPCPECDKTFLSTSGLREHRKVHAGV---RYICHACPREFSSEATMKAHVASHNGVQ  177 (294)
Q Consensus       102 C~~~f~~~~~l~~H~~~~~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~---~~~C~~C~~~f~~~~~l~~H~~~~~~~~  177 (294)
                      |-+.+.++..|..|++.|.++ ...|+.|+..|.+...|-.|++..+..   .|.|..|.+.|.++..|..|+..|-. -
T Consensus       185 Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn-~  263 (467)
T KOG3608|consen  185 CTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN-C  263 (467)
T ss_pred             hhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh-c
Confidence            999999999999999999986 789999999999999999999876653   39999999999999999999999877 7


Q ss_pred             cccCcchhccCCchHHHhHHhhcCC--CceeCCCCccccCCHHHHHHHHHHhCCCcccccc--ccccccCHHHHHHHHhh
Q psy6546         178 HACDQCDRTFSCMPYLRQHQKLHSG--ITYSCPSCSKSFNRKDRYRMHLKLHQGVRHTCKE--CSKEFSNEYNLKNHMVL  253 (294)
Q Consensus       178 ~~C~~C~~~f~~~~~l~~H~~~h~~--~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~  253 (294)
                      |.|+.|+......+.|..|++.-+.  +||+|+.|.+.|.+.+.|.+|+..|....|.|..  |.+.|.+..+|++|.+.
T Consensus       264 ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~e  343 (467)
T KOG3608|consen  264 YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLE  343 (467)
T ss_pred             ccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHHH
Confidence            9999999999999999999986655  5999999999999999999999999855599988  99999999999999766


Q ss_pred             hc----ccccccccccccccchhhhhhhhhhccC
Q psy6546         254 HD----VRAYVCELCARQFTRVDHFNHHRRLQHD  283 (294)
Q Consensus       254 h~----~~~~~C~~C~~~f~~~~~l~~H~~~~h~  283 (294)
                      ++    +-+|.|-.|++-|+.=-+|..|++..|+
T Consensus       344 vhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  344 VHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             hccCCCCCceeeecchhhhccchhHHHHHHHhhc
Confidence            63    5689999999999999999999866554


No 5  
>KOG3608|consensus
Probab=99.91  E-value=1.2e-23  Score=166.03  Aligned_cols=183  Identities=23%  Similarity=0.506  Sum_probs=165.5

Q ss_pred             CCccCccccChHHHHHHHhhccC-------------c-ccCCc--ccccccCChHhHHHHHhhhCCCC-ccCCCCCcccC
Q psy6546          99 CPQCSRDFATVKILKTHLKTHEG-------------I-IYPCP--ECDKTFLSTSGLREHRKVHAGVR-YICHACPREFS  161 (294)
Q Consensus        99 C~~C~~~f~~~~~l~~H~~~~~~-------------~-~~~C~--~C~~~f~~~~~l~~H~~~h~~~~-~~C~~C~~~f~  161 (294)
                      +..|++.|.+...+..|+..|.-             + .+.|.  .|.+.|.++..|+.|++.|.+++ ..|+.||..|.
T Consensus       139 WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~  218 (467)
T KOG3608|consen  139 WEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFR  218 (467)
T ss_pred             hhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhc
Confidence            36899999999999999887731             1 24555  48999999999999999999999 89999999999


Q ss_pred             CHHHHHHHHHhhcC---CCcccCcchhccCCchHHHhHHhhcCCCceeCCCCccccCCHHHHHHHHHHh-CCCc-ccccc
Q psy6546         162 SEATMKAHVASHNG---VQHACDQCDRTFSCMPYLRQHQKLHSGITYSCPSCSKSFNRKDRYRMHLKLH-QGVR-HTCKE  236 (294)
Q Consensus       162 ~~~~l~~H~~~~~~---~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h-~~~~-~~C~~  236 (294)
                      ++..|..|.+..+.   .+|.|..|.+.|..+..|..|+..|-. -|+|+.|.......++|..|++.- ...+ |+|..
T Consensus       219 ~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn-~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~  297 (467)
T KOG3608|consen  219 TKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN-CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDE  297 (467)
T ss_pred             cccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh-cccccccccCCCChHHHHHHHHhhhccCCCccccc
Confidence            99999999987765   389999999999999999999999876 899999999999999999999874 4433 99999


Q ss_pred             ccccccCHHHHHHHHhhhccccccccc--ccccccchhhhhhhhhhcc
Q psy6546         237 CSKEFSNEYNLKNHMVLHDVRAYVCEL--CARQFTRVDHFNHHRRLQH  282 (294)
Q Consensus       237 C~~~f~~~~~l~~H~~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~~h  282 (294)
                      |.+.|...+.|.+|+.+|.+-.|+|..  |.++|.+..+|.+|++.+|
T Consensus       298 Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  298 CDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             hhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            999999999999999999999999976  9999999999999999988


No 6  
>KOG1074|consensus
Probab=99.87  E-value=1.8e-22  Score=175.60  Aligned_cols=161  Identities=28%  Similarity=0.590  Sum_probs=136.0

Q ss_pred             CcccCCccCccccChHHHHHHHhhccCc-ccCCcccccccCChHhHHHHHhhhCCCC-----ccCC---CCCcccCCHHH
Q psy6546          95 TRHPCPQCSRDFATVKILKTHLKTHEGI-IYPCPECDKTFLSTSGLREHRKVHAGVR-----YICH---ACPREFSSEAT  165 (294)
Q Consensus        95 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~~-----~~C~---~C~~~f~~~~~  165 (294)
                      .+-+|-.|.++..-+..|+.|.++|.+. ||+|.+|++.|.++.+|+.||..|....     +.|+   +|-+.|...-.
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccc
Confidence            4457999999999999999999999996 9999999999999999999999887643     8899   99999999999


Q ss_pred             HHHHHHhhcCC--------------CcccCcchhccCCchHHHhHHhhc-------------------------------
Q psy6546         166 MKAHVASHNGV--------------QHACDQCDRTFSCMPYLRQHQKLH-------------------------------  200 (294)
Q Consensus       166 l~~H~~~~~~~--------------~~~C~~C~~~f~~~~~l~~H~~~h-------------------------------  200 (294)
                      |..|+++|.+.              .-.|..|.+.|.....+..++-.+                               
T Consensus       684 lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~  763 (958)
T KOG1074|consen  684 LPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSC  763 (958)
T ss_pred             ccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccc
Confidence            99999998732              135777777776555555443322                               


Q ss_pred             --------------------------------------------------------------------------------
Q psy6546         201 --------------------------------------------------------------------------------  200 (294)
Q Consensus       201 --------------------------------------------------------------------------------  200 (294)
                                                                                                      
T Consensus       764 ~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t  843 (958)
T KOG1074|consen  764 GRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLAT  843 (958)
T ss_pred             ccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccc
Confidence                                                                                            


Q ss_pred             --------------------------CCC------ceeCCCCccccCCHHHHHHHHHHhCCCc-cccccccccccCHHHH
Q psy6546         201 --------------------------SGI------TYSCPSCSKSFNRKDRYRMHLKLHQGVR-HTCKECSKEFSNEYNL  247 (294)
Q Consensus       201 --------------------------~~~------~~~C~~C~~~f~~~~~l~~H~~~h~~~~-~~C~~C~~~f~~~~~l  247 (294)
                                                .++      ...|.+|++.|.++++|+.|+++|++++ |.|..|++.|...++|
T Consensus       844 ~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnL  923 (958)
T KOG1074|consen  844 KTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNL  923 (958)
T ss_pred             ccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhh
Confidence                                      000      1669999999999999999999999988 9999999999999999


Q ss_pred             HHHHhhhc
Q psy6546         248 KNHMVLHD  255 (294)
Q Consensus       248 ~~H~~~h~  255 (294)
                      +.|+.+|.
T Consensus       924 KvHMgtH~  931 (958)
T KOG1074|consen  924 KVHMGTHM  931 (958)
T ss_pred             hhhhcccc
Confidence            99999995


No 7  
>KOG3623|consensus
Probab=99.85  E-value=1.2e-21  Score=167.99  Aligned_cols=116  Identities=26%  Similarity=0.517  Sum_probs=89.2

Q ss_pred             CCCccCccchhccCCHHHHHHHHHHhCCc---ccCCccCccchhccccCC----CCCCCccchhhcccCCCCCcccCCcc
Q psy6546          30 PTRHPCPQCSRDFATVKILKTHLKTHEGI---IYPCPECDKTFLSTLTGT----PQGARGRAVYLSRMSTTLTRHPCPQC  102 (294)
Q Consensus        30 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~---~~~c~~c~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~C~~C  102 (294)
                      .....|+.|.+.+.....|+.|++.-+..   -+.|..|...|..+....    .+..................|+|..|
T Consensus       208 sqlltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtEC  287 (1007)
T KOG3623|consen  208 SQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTEC  287 (1007)
T ss_pred             hhhhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhcccccccc
Confidence            44689999999999999999999865443   688999999997665211    11111111111222234678999999


Q ss_pred             CccccChHHHHHHHhhccCc-ccCCcccccccCChHhHHHHHhh
Q psy6546         103 SRDFATVKILKTHLKTHEGI-IYPCPECDKTFLSTSGLREHRKV  145 (294)
Q Consensus       103 ~~~f~~~~~l~~H~~~~~~~-~~~C~~C~~~f~~~~~l~~H~~~  145 (294)
                      +|.|+-+-.|+.|+++|.|. ||.|+.|++.|.....+..||..
T Consensus       288 gKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  288 GKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             chhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            99999999999999999995 99999999999999998888853


No 8  
>KOG3623|consensus
Probab=99.78  E-value=3.2e-19  Score=153.22  Aligned_cols=102  Identities=26%  Similarity=0.594  Sum_probs=87.6

Q ss_pred             ccCCccCccccChHHHHHHHhhccCc---ccCCcccccccCChHhHHHHHhhhCCC--------------CccCCCCCcc
Q psy6546          97 HPCPQCSRDFATVKILKTHLKTHEGI---IYPCPECDKTFLSTSGLREHRKVHAGV--------------RYICHACPRE  159 (294)
Q Consensus        97 ~~C~~C~~~f~~~~~l~~H~~~~~~~---~~~C~~C~~~f~~~~~l~~H~~~h~~~--------------~~~C~~C~~~  159 (294)
                      ..|++|.+.+....+|..|++.-+.+   .|.|..|.+.|-.+..|.+||..|...              +|+|..||+.
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            46999999999999999998877654   688999999999999999999887421              3999999999


Q ss_pred             cCCHHHHHHHHHhhcCC-CcccCcchhccCCchHHHhHHh
Q psy6546         160 FSSEATMKAHVASHNGV-QHACDQCDRTFSCMPYLRQHQK  198 (294)
Q Consensus       160 f~~~~~l~~H~~~~~~~-~~~C~~C~~~f~~~~~l~~H~~  198 (294)
                      |+.+..|+.|+++|.|+ ||.|+.|.+.|..+..+..|+.
T Consensus       291 FKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            99999999999999997 8999999999988888888854


No 9  
>KOG3576|consensus
Probab=99.64  E-value=3.5e-17  Score=120.02  Aligned_cols=77  Identities=29%  Similarity=0.719  Sum_probs=45.4

Q ss_pred             ccCCCCCcccCCHHHHHHHHHhhcCC-CcccCcchhccCCchHHHhHHhhcCCC-ceeCCCCccccCCHHHHHHHHHHh
Q psy6546         151 YICHACPREFSSEATMKAHVASHNGV-QHACDQCDRTFSCMPYLRQHQKLHSGI-TYSCPSCSKSFNRKDRYRMHLKLH  227 (294)
Q Consensus       151 ~~C~~C~~~f~~~~~l~~H~~~~~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~h  227 (294)
                      |.|.+|++.|.-...|.+|++-|... .|-|..||+.|...-+|++|.++|++. ||+|..|++.|+..-.|..|++.-
T Consensus       118 ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kv  196 (267)
T KOG3576|consen  118 FTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKV  196 (267)
T ss_pred             eeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHH
Confidence            66666666666555566666655553 555666666666666666666666553 566666666666655566665433


No 10 
>KOG3576|consensus
Probab=99.58  E-value=9e-16  Score=112.71  Aligned_cols=106  Identities=32%  Similarity=0.649  Sum_probs=57.9

Q ss_pred             cCCcccccccCChHhHHHHHhhhCCCC-ccCCCCCcccCCHHHHHHHHHhhcCC-CcccCcchhccCCchHHHhHHhhcC
Q psy6546         124 YPCPECDKTFLSTSGLREHRKVHAGVR-YICHACPREFSSEATMKAHVASHNGV-QHACDQCDRTFSCMPYLRQHQKLHS  201 (294)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~-~~C~~C~~~f~~~~~l~~H~~~~~~~-~~~C~~C~~~f~~~~~l~~H~~~h~  201 (294)
                      |.|.+|++.|.-..-|.+|++-|...+ +.|..||+.|.+.-+|.+|+++|+|. ||.|..|++.|...-.|..|.+.-+
T Consensus       118 ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvh  197 (267)
T KOG3576|consen  118 FTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVH  197 (267)
T ss_pred             eeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHc
Confidence            445555555555555555555554433 55555555555555555555555554 5555555555555555555543222


Q ss_pred             C------------CceeCCCCccccCCHHHHHHHHHHhCC
Q psy6546         202 G------------ITYSCPSCSKSFNRKDRYRMHLKLHQG  229 (294)
Q Consensus       202 ~------------~~~~C~~C~~~f~~~~~l~~H~~~h~~  229 (294)
                      +            +.|.|..||+.-.....+..|++.|+.
T Consensus       198 gv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  198 GVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             CchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            2            357777777777666667777766554


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.35  E-value=2e-12  Score=112.23  Aligned_cols=145  Identities=19%  Similarity=0.448  Sum_probs=107.3

Q ss_pred             cCCcccccccCChHhHHHHHhhhCCCCccCCC--CCcccCCHHHHHHHHHhhcCCCcccCcchhccCCchHHHhHHhhcC
Q psy6546         124 YPCPECDKTFLSTSGLREHRKVHAGVRYICHA--CPREFSSEATMKAHVASHNGVQHACDQCDRTFSCMPYLRQHQKLHS  201 (294)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  201 (294)
                      -.|+.|... ....+|..|..........|+.  |+..|.. ..+..|        +.|+.|++.|. ...|..|+..++
T Consensus       408 V~C~NC~~~-i~l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r-~el~~H--------~~C~~Cgk~f~-~s~LekH~~~~H  476 (567)
T PLN03086        408 VECRNCKHY-IPSRSIALHEAYCSRHNVVCPHDGCGIVLRV-EEAKNH--------VHCEKCGQAFQ-QGEMEKHMKVFH  476 (567)
T ss_pred             EECCCCCCc-cchhHHHHHHhhCCCcceeCCcccccceeec-cccccC--------ccCCCCCCccc-hHHHHHHHHhcC
Confidence            457777665 3345666777776666677874  8888842 233333        48999988885 577889988875


Q ss_pred             CCceeCCCCccccCCHHHHHHHHHHhCCCc-ccccccccccc----------CHHHHHHHHhhhcccccccccccccccc
Q psy6546         202 GITYSCPSCSKSFNRKDRYRMHLKLHQGVR-HTCKECSKEFS----------NEYNLKNHMVLHDVRAYVCELCARQFTR  270 (294)
Q Consensus       202 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~-~~C~~C~~~f~----------~~~~l~~H~~~h~~~~~~C~~C~~~f~~  270 (294)
                       +++.|+ |++.+ .+..|..|+.+|-+.+ +.|..|+..|.          ....|..|......+++.|..|++.+..
T Consensus       477 -kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~CG~rt~~C~~Cgk~Vrl  553 (567)
T PLN03086        477 -EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESICGSRTAPCDSCGRSVML  553 (567)
T ss_pred             -CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhcCCcceEccccCCeeee
Confidence             688998 98654 6688999988887766 89999998884          2457889988888999999999998876


Q ss_pred             hhhhhhhhhhccC
Q psy6546         271 VDHFNHHRRLQHD  283 (294)
Q Consensus       271 ~~~l~~H~~~~h~  283 (294)
                      + .|..|+..-|.
T Consensus       554 r-dm~~H~~~~h~  565 (567)
T PLN03086        554 K-EMDIHQIAVHQ  565 (567)
T ss_pred             h-hHHHHHHHhhc
Confidence            5 47778765543


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.23  E-value=1.2e-10  Score=101.47  Aligned_cols=154  Identities=17%  Similarity=0.376  Sum_probs=78.2

Q ss_pred             CCCccCccchhccCCHHHHHHHHHHhCCcccCCcc--CccchhccccCCCCCCCccchhhcccCCCCCcccCCccCcccc
Q psy6546          30 PTRHPCPQCSRDFATVKILKTHLKTHEGIIYPCPE--CDKTFLSTLTGTPQGARGRAVYLSRMSTTLTRHPCPQCSRDFA  107 (294)
Q Consensus        30 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~c~~--c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~  107 (294)
                      ...-.|+.|.+... ...|..|.....-....|+.  |+..|....                   ....+.|+.|++.|.
T Consensus       405 ~~~V~C~NC~~~i~-l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~e-------------------l~~H~~C~~Cgk~f~  464 (567)
T PLN03086        405 VDTVECRNCKHYIP-SRSIALHEAYCSRHNVVCPHDGCGIVLRVEE-------------------AKNHVHCEKCGQAFQ  464 (567)
T ss_pred             CCeEECCCCCCccc-hhHHHHHHhhCCCcceeCCcccccceeeccc-------------------cccCccCCCCCCccc
Confidence            34457999999887 44555777554444555653  655552211                   112235666666664


Q ss_pred             ChHHHHHHHhhccCcccCCcccccccCChHhHHHHHhhhCCCC-ccCCCCCcccCCHHHHHHHHHhhcCCCcccCcchhc
Q psy6546         108 TVKILKTHLKTHEGIIYPCPECDKTFLSTSGLREHRKVHAGVR-YICHACPREFSSEATMKAHVASHNGVQHACDQCDRT  186 (294)
Q Consensus       108 ~~~~l~~H~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~-~~C~~C~~~f~~~~~l~~H~~~~~~~~~~C~~C~~~  186 (294)
                       ...|..|++.++ .++.|+ |++.+ ....|..|+..|.+.+ +.|..|++.+......         ..+.       
T Consensus       465 -~s~LekH~~~~H-kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~---------~d~~-------  524 (567)
T PLN03086        465 -QGEMEKHMKVFH-EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSA---------MDVR-------  524 (567)
T ss_pred             -hHHHHHHHHhcC-CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccc---------cchh-------
Confidence             455666666553 455665 65433 3455555555554444 5555555555310000         0000       


Q ss_pred             cCCchHHHhHHhhcCCCceeCCCCccccCCHHHHHHHHH
Q psy6546         187 FSCMPYLRQHQKLHSGITYSCPSCSKSFNRKDRYRMHLK  225 (294)
Q Consensus       187 f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~  225 (294)
                       ...+.|..|...+..+++.|..||+.+..+ .+..|+.
T Consensus       525 -d~~s~Lt~HE~~CG~rt~~C~~Cgk~Vrlr-dm~~H~~  561 (567)
T PLN03086        525 -DRLRGMSEHESICGSRTAPCDSCGRSVMLK-EMDIHQI  561 (567)
T ss_pred             -hhhhhHHHHHHhcCCcceEccccCCeeeeh-hHHHHHH
Confidence             012355566655555566666666655443 2445543


No 13 
>PHA00733 hypothetical protein
Probab=99.12  E-value=3.7e-11  Score=85.38  Aligned_cols=79  Identities=19%  Similarity=0.286  Sum_probs=47.5

Q ss_pred             ceeCCCCccccCCHHHH------HHHHHHhCCCccccccccccccCHHHHHHHHhhhcccccccccccccccchhhhhhh
Q psy6546         204 TYSCPSCSKSFNRKDRY------RMHLKLHQGVRHTCKECSKEFSNEYNLKNHMVLHDVRAYVCELCARQFTRVDHFNHH  277 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l------~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H  277 (294)
                      ++.|.+|...|.....|      .+|+..+...+|.|..|++.|.....|..|++.| ..+|.|+.|++.|.....|..|
T Consensus        40 ~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h-~~~~~C~~CgK~F~~~~sL~~H  118 (128)
T PHA00733         40 RLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT-EHSKVCPVCGKEFRNTDSTLDH  118 (128)
T ss_pred             hHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC-CcCccCCCCCCccCCHHHHHHH
Confidence            44444444444443333      3333333444477777777777777777776655 3457777777777777777777


Q ss_pred             hhhccC
Q psy6546         278 RRLQHD  283 (294)
Q Consensus       278 ~~~~h~  283 (294)
                      +...|+
T Consensus       119 ~~~~h~  124 (128)
T PHA00733        119 VCKKHN  124 (128)
T ss_pred             HHHhcC
Confidence            766665


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.02  E-value=1.5e-10  Score=67.53  Aligned_cols=43  Identities=16%  Similarity=0.346  Sum_probs=30.7

Q ss_pred             cccccccccccCHHHHHHHHhhhcccccccccccccccchhhhh
Q psy6546         232 HTCKECSKEFSNEYNLKNHMVLHDVRAYVCELCARQFTRVDHFN  275 (294)
Q Consensus       232 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~  275 (294)
                      |.|+.||+.|+....|..|+++|. ++|+|..|++.|.+.++|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceecccceeE
Confidence            667777777777777777777776 5777777777777666554


No 15 
>KOG3993|consensus
Probab=98.95  E-value=1.1e-10  Score=95.38  Aligned_cols=160  Identities=21%  Similarity=0.281  Sum_probs=103.9

Q ss_pred             cCCcccccccCChHhHHHHHhhhCCCC-ccCCCCCcccCCHHHHHHHHHhhcCCCccc--C-cchhccCCchHHHhHHh-
Q psy6546         124 YPCPECDKTFLSTSGLREHRKVHAGVR-YICHACPREFSSEATMKAHVASHNGVQHAC--D-QCDRTFSCMPYLRQHQK-  198 (294)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~-~~C~~C~~~f~~~~~l~~H~~~~~~~~~~C--~-~C~~~f~~~~~l~~H~~-  198 (294)
                      |.|+.|...|.+...|.+|.-...-.. |+|+.|+++|.-..+|..|.+.|..++-.-  . .=.+.-.....+..... 
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            789999988988888888887666533 899999999999999999988887642111  0 00000000011111110 


Q ss_pred             h---cCCCceeCCCCccccCCHHHHHHHHHHhCCCc--------------------------------------------
Q psy6546         199 L---HSGITYSCPSCSKSFNRKDRYRMHLKLHQGVR--------------------------------------------  231 (294)
Q Consensus       199 ~---h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~--------------------------------------------  231 (294)
                      .   .....|.|.+|++.|.+...|++|+.+|+...                                            
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~s  427 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGS  427 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeecc
Confidence            0   11126999999999999999999988875210                                            


Q ss_pred             ---cccccccccccCHHHHHHHHhhhc-ccccccccccccccchhhhhhhhhhccC
Q psy6546         232 ---HTCKECSKEFSNEYNLKNHMVLHD-VRAYVCELCARQFTRVDHFNHHRRLQHD  283 (294)
Q Consensus       232 ---~~C~~C~~~f~~~~~l~~H~~~h~-~~~~~C~~C~~~f~~~~~l~~H~~~~h~  283 (294)
                         ..|+.|+..+.++..---+.+.-. ...|-|.+|.-.|.....|.+|+..-|.
T Consensus       428 ael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hp  483 (500)
T KOG3993|consen  428 AELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHP  483 (500)
T ss_pred             ccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcCh
Confidence               235555555544433333332222 4458899999999999999999876665


No 16 
>PHA00733 hypothetical protein
Probab=98.93  E-value=1.2e-09  Score=77.71  Aligned_cols=60  Identities=25%  Similarity=0.389  Sum_probs=32.1

Q ss_pred             HHHHhhcCCCcccCcchhccCCchHHHhHHhhcCCCceeCCCCccccCCHHHHHHHHHHhC
Q psy6546         168 AHVASHNGVQHACDQCDRTFSCMPYLRQHQKLHSGITYSCPSCSKSFNRKDRYRMHLKLHQ  228 (294)
Q Consensus       168 ~H~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~  228 (294)
                      .|+..+...+|.|+.|++.|.....|..|++.+ ..++.|..|++.|.....|..|+...+
T Consensus        64 ~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h-~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         64 KLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT-EHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             hhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC-CcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            333333334555666666666555555555544 234556666666666666666555433


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.89  E-value=8.2e-10  Score=64.44  Aligned_cols=43  Identities=19%  Similarity=0.461  Sum_probs=30.8

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCCccccccccccccCHHHH
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGVRHTCKECSKEFSNEYNL  247 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l  247 (294)
                      .|.|+.||+.|...++|..|+++|+ .+|+|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceeccccee
Confidence            4677777777777777777777777 457777777777766554


No 18 
>KOG3993|consensus
Probab=98.82  E-value=3.3e-10  Score=92.77  Aligned_cols=163  Identities=21%  Similarity=0.338  Sum_probs=103.7

Q ss_pred             CCCCCcccCCccCccccChHHHHHHHhhccC-cccCCcccccccCChHhHHHHHhhhCCC--------------------
Q psy6546          91 STTLTRHPCPQCSRDFATVKILKTHLKTHEG-IIYPCPECDKTFLSTSGLREHRKVHAGV--------------------  149 (294)
Q Consensus        91 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~-~~~~C~~C~~~f~~~~~l~~H~~~h~~~--------------------  149 (294)
                      .....-|.|.+|...|.+.-.|.+|.-...- .-|+|++|+++|+...+|..|.++|...                    
T Consensus       262 ~n~iGdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae  341 (500)
T KOG3993|consen  262 PNVIGDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAE  341 (500)
T ss_pred             cccHHHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhh
Confidence            3344668999999999999999999654433 2699999999999999999999998432                    


Q ss_pred             --------------CccCCCCCcccCCHHHHHHHHHhhcCCC------------------cccCcchhccCCchHHHhHH
Q psy6546         150 --------------RYICHACPREFSSEATMKAHVASHNGVQ------------------HACDQCDRTFSCMPYLRQHQ  197 (294)
Q Consensus       150 --------------~~~C~~C~~~f~~~~~l~~H~~~~~~~~------------------~~C~~C~~~f~~~~~l~~H~  197 (294)
                                    .|.|..|++.|.+..-|+.|+.+|....                  +.+..+.-.+.....--.+.
T Consensus       342 ~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~v  421 (500)
T KOG3993|consen  342 VQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEV  421 (500)
T ss_pred             hhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccce
Confidence                          1677777777777777777777665421                  12233322221111111111


Q ss_pred             hhcCC--CceeCCCCccccCCHHHHHHHHHHhCCCc-cccccccccccCHHHHHHHHhh
Q psy6546         198 KLHSG--ITYSCPSCSKSFNRKDRYRMHLKLHQGVR-HTCKECSKEFSNEYNLKNHMVL  253 (294)
Q Consensus       198 ~~h~~--~~~~C~~C~~~f~~~~~l~~H~~~h~~~~-~~C~~C~~~f~~~~~l~~H~~~  253 (294)
                      ..+.+  .-..|+.||-.+.++..--.+.+.-.... |.|.+|...|.+...|.+|+..
T Consensus       422 l~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  422 LYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             eeeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhh
Confidence            11111  12446777766655543333322222222 8899999999999999998643


No 19 
>PHA00616 hypothetical protein
Probab=98.52  E-value=2.8e-08  Score=55.13  Aligned_cols=32  Identities=19%  Similarity=0.353  Sum_probs=24.1

Q ss_pred             ccccccccccccchhhhhhhhhhccCcccccc
Q psy6546         258 AYVCELCARQFTRVDHFNHHRRLQHDPEEFEK  289 (294)
Q Consensus       258 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~  289 (294)
                      ||+|+.||+.|.++++|..|++.||+++++.+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            57777777777777777777777777777654


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.39  E-value=1.9e-07  Score=46.46  Aligned_cols=24  Identities=38%  Similarity=0.908  Sum_probs=16.1

Q ss_pred             HHHHHHhhhc-cccccccccccccc
Q psy6546         246 NLKNHMVLHD-VRAYVCELCARQFT  269 (294)
Q Consensus       246 ~l~~H~~~h~-~~~~~C~~C~~~f~  269 (294)
                      +|..|+++|. ++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3666777775 66777777777665


No 21 
>PHA00732 hypothetical protein
Probab=98.26  E-value=7.1e-07  Score=57.47  Aligned_cols=47  Identities=21%  Similarity=0.475  Sum_probs=34.1

Q ss_pred             ceeCCCCccccCCHHHHHHHHHH-hCCCccccccccccccCHHHHHHHHhhhc
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKL-HQGVRHTCKECSKEFSNEYNLKNHMVLHD  255 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~C~~C~~~f~~~~~l~~H~~~h~  255 (294)
                      ||.|..|++.|.+.+.|..|++. |.+  +.|..|++.|.   .|..|.+.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~--~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL--TKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC--CccCCCCCEeC---ChhhhhcccC
Confidence            56788888888888888888874 543  57888888887   4677765553


No 22 
>PHA00732 hypothetical protein
Probab=98.25  E-value=8e-07  Score=57.24  Aligned_cols=43  Identities=33%  Similarity=0.649  Sum_probs=21.8

Q ss_pred             cccCcchhccCCchHHHhHHhh-cCCCceeCCCCccccCCHHHHHHHHH
Q psy6546         178 HACDQCDRTFSCMPYLRQHQKL-HSGITYSCPSCSKSFNRKDRYRMHLK  225 (294)
Q Consensus       178 ~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~C~~C~~~f~~~~~l~~H~~  225 (294)
                      |.|++|++.|.....|..|++. |.  ++.|+.|++.|.   .|..|.+
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~---~l~~H~~   45 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR---RLNQHFY   45 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC---Chhhhhc
Confidence            4555555555555555555543 32  235555555554   2444543


No 23 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.21  E-value=1.2e-06  Score=43.60  Aligned_cols=24  Identities=38%  Similarity=0.798  Sum_probs=15.0

Q ss_pred             HHHHHHHHhCCCc-ccccccccccc
Q psy6546         219 RYRMHLKLHQGVR-HTCKECSKEFS  242 (294)
Q Consensus       219 ~l~~H~~~h~~~~-~~C~~C~~~f~  242 (294)
                      +|.+|+++|++++ |.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3566666666655 66666666664


No 24 
>PHA00616 hypothetical protein
Probab=98.14  E-value=1.2e-06  Score=48.62  Aligned_cols=27  Identities=26%  Similarity=0.450  Sum_probs=13.9

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCC
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGV  230 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~  230 (294)
                      ||+|+.||+.|..++.|..|++.|++.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~   27 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQ   27 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCC
Confidence            345555555555555555555554444


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.12  E-value=3.1e-06  Score=50.57  Aligned_cols=49  Identities=33%  Similarity=0.541  Sum_probs=28.8

Q ss_pred             cccccccccccCHHHHHHHHhh-hc--ccccccccccccccchhhhhhhhhhccC
Q psy6546         232 HTCKECSKEFSNEYNLKNHMVL-HD--VRAYVCELCARQFTRVDHFNHHRRLQHD  283 (294)
Q Consensus       232 ~~C~~C~~~f~~~~~l~~H~~~-h~--~~~~~C~~C~~~f~~~~~l~~H~~~~h~  283 (294)
                      |.|+.|++ -.+...|..|... |.  .+.+.|++|...++  .+|..|++.+|+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            56666666 3445566666433 32  34567777766544  367777766653


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.91  E-value=1.1e-05  Score=38.94  Aligned_cols=22  Identities=41%  Similarity=0.976  Sum_probs=11.6

Q ss_pred             eeCCCCccccCCHHHHHHHHHH
Q psy6546         205 YSCPSCSKSFNRKDRYRMHLKL  226 (294)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~  226 (294)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3455555555555555555544


No 27 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.87  E-value=5.5e-06  Score=56.80  Aligned_cols=71  Identities=23%  Similarity=0.416  Sum_probs=14.0

Q ss_pred             CCCCccccCCHHHHHHHHHHhCCCccccccccccccCHHHHHHHHhhhcccccccccccccccchhhhhhhhhh
Q psy6546         207 CPSCSKSFNRKDRYRMHLKLHQGVRHTCKECSKEFSNEYNLKNHMVLHDVRAYVCELCARQFTRVDHFNHHRRL  280 (294)
Q Consensus       207 C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~  280 (294)
                      |..|+..|.+...|..|+...++....   ....+.....+..+.+.--...+.|.+|++.|.+...|..|++.
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~~---~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDIP---DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             --------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccc---cccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcC
Confidence            556666666666666666554443211   11112223333333222222346666666666666666666654


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.85  E-value=1.1e-05  Score=38.82  Aligned_cols=22  Identities=27%  Similarity=0.807  Sum_probs=11.7

Q ss_pred             cccccccccccchhhhhhhhhh
Q psy6546         259 YVCELCARQFTRVDHFNHHRRL  280 (294)
Q Consensus       259 ~~C~~C~~~f~~~~~l~~H~~~  280 (294)
                      |+|++|++.|.++.+|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4455555555555555555544


No 29 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.79  E-value=4.7e-05  Score=45.46  Aligned_cols=46  Identities=26%  Similarity=0.473  Sum_probs=23.8

Q ss_pred             eeCCCCccccCCHHHHHHHHHH-hCCCc--cccccccccccCHHHHHHHHhh
Q psy6546         205 YSCPSCSKSFNRKDRYRMHLKL-HQGVR--HTCKECSKEFSNEYNLKNHMVL  253 (294)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~-h~~~~--~~C~~C~~~f~~~~~l~~H~~~  253 (294)
                      |.|++|++ -.+...|..|... |...+  +.|++|...+.  ..|..|+..
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~   51 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNS   51 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHH
Confidence            55666666 3444556666544 33222  56666655433  255566543


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.76  E-value=2.4e-05  Score=53.60  Aligned_cols=72  Identities=19%  Similarity=0.425  Sum_probs=16.3

Q ss_pred             CCCCCcccCCHHHHHHHHHhhcCCCcccCcchhccCCchHHHhHHhhcCCCceeCCCCccccCCHHHHHHHHHHh
Q psy6546         153 CHACPREFSSEATMKAHVASHNGVQHACDQCDRTFSCMPYLRQHQKLHSGITYSCPSCSKSFNRKDRYRMHLKLH  227 (294)
Q Consensus       153 C~~C~~~f~~~~~l~~H~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h  227 (294)
                      |..|+..|.....|..|+...++....   ....+.....+..+.+.-....+.|..|++.|.+...|..|++.+
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~~---~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDIP---DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             --------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccccc---cccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            556666666666666666554443211   001111222222232222222567777777777777777777653


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.76  E-value=9.9e-06  Score=39.43  Aligned_cols=24  Identities=25%  Similarity=0.784  Sum_probs=12.5

Q ss_pred             cccccccccccchhhhhhhhhhcc
Q psy6546         259 YVCELCARQFTRVDHFNHHRRLQH  282 (294)
Q Consensus       259 ~~C~~C~~~f~~~~~l~~H~~~~h  282 (294)
                      |+|++|++.|.+...|..|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            455556666665566665555544


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.68  E-value=1.8e-05  Score=39.79  Aligned_cols=26  Identities=19%  Similarity=0.690  Sum_probs=19.8

Q ss_pred             ccccccccccccchhhhhhhhhhccC
Q psy6546         258 AYVCELCARQFTRVDHFNHHRRLQHD  283 (294)
Q Consensus       258 ~~~C~~C~~~f~~~~~l~~H~~~~h~  283 (294)
                      +|.|..|++.|.....|..|++.|+.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57788888888888888888777654


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.67  E-value=5.6e-05  Score=36.66  Aligned_cols=23  Identities=43%  Similarity=1.028  Sum_probs=12.7

Q ss_pred             eeCCCCccccCCHHHHHHHHHHh
Q psy6546         205 YSCPSCSKSFNRKDRYRMHLKLH  227 (294)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h  227 (294)
                      |.|++|++.|.+...|..|+..|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666554


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.46  E-value=7.5e-05  Score=37.49  Aligned_cols=24  Identities=29%  Similarity=0.718  Sum_probs=13.5

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHh
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLH  227 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h  227 (294)
                      +|.|..|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            355555555555555555555544


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.46  E-value=6.1e-05  Score=60.18  Aligned_cols=72  Identities=17%  Similarity=0.304  Sum_probs=48.4

Q ss_pred             CCCCCccCcc--chhccCCHHHHHHHHHHhCCcccCCccCccchhccccCCCCCCCccchhhcccCCCCCcccCCccCcc
Q psy6546          28 TTPTRHPCPQ--CSRDFATVKILKTHLKTHEGIIYPCPECDKTFLSTLTGTPQGARGRAVYLSRMSTTLTRHPCPQCSRD  105 (294)
Q Consensus        28 ~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~  105 (294)
                      .+.+||+|++  |.+.|..+..|+-|+.--+..        .+.....         .......+....+||+|++|+|.
T Consensus       345 ~d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~--------~~~~~~p---------~p~~~~~F~~~~KPYrCevC~KR  407 (423)
T COG5189         345 KDGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQN--------QKLHENP---------SPEKMNIFSAKDKPYRCEVCDKR  407 (423)
T ss_pred             ecCceecCCCCCchhhhccccchhhhhhccccC--------cccCCCC---------CccccccccccCCceeccccchh
Confidence            3469999997  999999999999999743321        1110000         11111222345689999999999


Q ss_pred             ccChHHHHHHH
Q psy6546         106 FATVKILKTHL  116 (294)
Q Consensus       106 f~~~~~l~~H~  116 (294)
                      |+....|+.|.
T Consensus       408 YKNlNGLKYHr  418 (423)
T COG5189         408 YKNLNGLKYHR  418 (423)
T ss_pred             hccCccceecc
Confidence            99888887774


No 36 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.21  E-value=0.00011  Score=35.69  Aligned_cols=24  Identities=21%  Similarity=0.552  Sum_probs=15.6

Q ss_pred             cccccccccccchhhhhhhhhhccC
Q psy6546         259 YVCELCARQFTRVDHFNHHRRLQHD  283 (294)
Q Consensus       259 ~~C~~C~~~f~~~~~l~~H~~~~h~  283 (294)
                      |+|+.|++..+ ...|..|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            56777777776 6677777777664


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.95  E-value=0.00022  Score=40.52  Aligned_cols=39  Identities=10%  Similarity=0.284  Sum_probs=22.3

Q ss_pred             HHHHhhhc--ccccccccccccccchhhhhhhhhhccCccc
Q psy6546         248 KNHMVLHD--VRAYVCELCARQFTRVDHFNHHRRLQHDPEE  286 (294)
Q Consensus       248 ~~H~~~h~--~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  286 (294)
                      ..+.+.+.  +.|-.|++|+..+.+..+|.+|+.+.|..++
T Consensus        12 ~~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   12 TKKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             ----CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            34444443  6778888888888888888888888887664


No 38 
>KOG2231|consensus
Probab=96.93  E-value=0.0051  Score=55.41  Aligned_cols=50  Identities=20%  Similarity=0.418  Sum_probs=30.2

Q ss_pred             eCCCCccccCCHHHHHHHHHHhCCCcccc---ccccccccCHHHHHHHHhhhc
Q psy6546         206 SCPSCSKSFNRKDRYRMHLKLHQGVRHTC---KECSKEFSNEYNLKNHMVLHD  255 (294)
Q Consensus       206 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~C---~~C~~~f~~~~~l~~H~~~h~  255 (294)
                      .|..|...|.....|.+|++.++..-.-|   ..++.-|.....|..|.+.++
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDHEFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccceeheeecCcccccchhcccchHHHHHhhhcC
Confidence            56777777777777777776554433223   233456666677777765553


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.84  E-value=0.001  Score=32.59  Aligned_cols=19  Identities=47%  Similarity=0.896  Sum_probs=7.6

Q ss_pred             cccccccccCHHHHHHHHh
Q psy6546         234 CKECSKEFSNEYNLKNHMV  252 (294)
Q Consensus       234 C~~C~~~f~~~~~l~~H~~  252 (294)
                      |..|++.|.....|..|++
T Consensus         3 C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        3 CPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCcchhCCHHHHHHHHH
Confidence            3344444444444444433


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.80  E-value=0.0014  Score=32.08  Aligned_cols=24  Identities=38%  Similarity=0.952  Sum_probs=18.1

Q ss_pred             eeCCCCccccCCHHHHHHHHHHhC
Q psy6546         205 YSCPSCSKSFNRKDRYRMHLKLHQ  228 (294)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h~  228 (294)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            467788888888888888877554


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.79  E-value=0.00036  Score=55.90  Aligned_cols=68  Identities=24%  Similarity=0.644  Sum_probs=40.6

Q ss_pred             CCceeCCC--CccccCCHHHHHHHHHH-hCCCc-cccccccccccCHHHHHHHH-hhhcccccccccccccccchhhhhh
Q psy6546         202 GITYSCPS--CSKSFNRKDRYRMHLKL-HQGVR-HTCKECSKEFSNEYNLKNHM-VLHDVRAYVCELCARQFTRVDHFNH  276 (294)
Q Consensus       202 ~~~~~C~~--C~~~f~~~~~l~~H~~~-h~~~~-~~C~~C~~~f~~~~~l~~H~-~~h~~~~~~C~~C~~~f~~~~~l~~  276 (294)
                      ++||+|++  |++.+.....|+-|+.. |.... ..=+          .-..|. ..-..+||+|++|++.+...-.|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p----------~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKY  416 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP----------SPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKY  416 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCC----------CccccccccccCCceeccccchhhccCcccee
Confidence            35777744  77777777777777653 21111 0000          000000 0112589999999999999999999


Q ss_pred             hhh
Q psy6546         277 HRR  279 (294)
Q Consensus       277 H~~  279 (294)
                      |+.
T Consensus       417 Hr~  419 (423)
T COG5189         417 HRK  419 (423)
T ss_pred             ccc
Confidence            963


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.66  E-value=0.0012  Score=32.29  Aligned_cols=22  Identities=36%  Similarity=0.836  Sum_probs=12.4

Q ss_pred             eeCCCCccccCCHHHHHHHHHH
Q psy6546         205 YSCPSCSKSFNRKDRYRMHLKL  226 (294)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~  226 (294)
                      |.|.+|+..|.+...|..|+++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4455566666665555555543


No 43 
>KOG2231|consensus
Probab=96.62  E-value=0.0092  Score=53.82  Aligned_cols=102  Identities=20%  Similarity=0.419  Sum_probs=61.7

Q ss_pred             cCCccCccccChHHHHHHHhhccCcccCCccccc---------ccCChHhHHHHHhhhCC-CC-----ccCCCCCcccCC
Q psy6546          98 PCPQCSRDFATVKILKTHLKTHEGIIYPCPECDK---------TFLSTSGLREHRKVHAG-VR-----YICHACPREFSS  162 (294)
Q Consensus        98 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~C~~C~~---------~f~~~~~l~~H~~~h~~-~~-----~~C~~C~~~f~~  162 (294)
                      .|..| -.|.....|+.|+...+.. +.|.+|-.         ...+...|+.|++.--. .+     -.|..|...|..
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~~-~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld  194 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHKL-HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLD  194 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhhh-hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhcc
Confidence            46666 6667778888888655543 45555432         22345566677653322 22     457777777777


Q ss_pred             HHHHHHHHHhhcCCCcccC---cchhccCCchHHHhHHhhcC
Q psy6546         163 EATMKAHVASHNGVQHACD---QCDRTFSCMPYLRQHQKLHS  201 (294)
Q Consensus       163 ~~~l~~H~~~~~~~~~~C~---~C~~~f~~~~~l~~H~~~h~  201 (294)
                      ...|..|++.++.....|+   .++..|..-..|..|.+..+
T Consensus       195 ~~el~rH~~~~h~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  195 DDELYRHLRFDHEFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             HHHHHHhhccceeheeecCcccccchhcccchHHHHHhhhcC
Confidence            7777777777666544442   34455566667777766654


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.62  E-value=0.002  Score=31.10  Aligned_cols=22  Identities=50%  Similarity=0.928  Sum_probs=11.6

Q ss_pred             eeCCCCccccCCHHHHHHHHHHh
Q psy6546         205 YSCPSCSKSFNRKDRYRMHLKLH  227 (294)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h  227 (294)
                      |+|+.|++... ...|.+|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            45666666665 55666666554


No 45 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.51  E-value=0.0035  Score=35.75  Aligned_cols=28  Identities=21%  Similarity=0.478  Sum_probs=18.2

Q ss_pred             CceeCCCCccccCCHHHHHHHHHHhCCC
Q psy6546         203 ITYSCPSCSKSFNRKDRYRMHLKLHQGV  230 (294)
Q Consensus       203 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~  230 (294)
                      .|..|++|+..+.+..+|++|+...++.
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            4788888888888888888888766553


No 46 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.37  E-value=0.0014  Score=32.00  Aligned_cols=22  Identities=23%  Similarity=0.809  Sum_probs=12.3

Q ss_pred             cccccccccccchhhhhhhhhh
Q psy6546         259 YVCELCARQFTRVDHFNHHRRL  280 (294)
Q Consensus       259 ~~C~~C~~~f~~~~~l~~H~~~  280 (294)
                      |.|.+|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4455555555555555555543


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.31  E-value=0.0021  Score=32.11  Aligned_cols=22  Identities=18%  Similarity=0.726  Sum_probs=17.4

Q ss_pred             cccccccccccchhhhhhhhhh
Q psy6546         259 YVCELCARQFTRVDHFNHHRRL  280 (294)
Q Consensus       259 ~~C~~C~~~f~~~~~l~~H~~~  280 (294)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888888765


No 48 
>KOG1146|consensus
Probab=96.25  E-value=0.0026  Score=60.80  Aligned_cols=104  Identities=18%  Similarity=0.290  Sum_probs=71.5

Q ss_pred             CCccCccchhccCCHHHHHHHHHHhCCcccCCccCccchhccccCCCCCCCccchhhcccCCCCCcccCCccCccccChH
Q psy6546          31 TRHPCPQCSRDFATVKILKTHLKTHEGIIYPCPECDKTFLSTLTGTPQGARGRAVYLSRMSTTLTRHPCPQCSRDFATVK  110 (294)
Q Consensus        31 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~  110 (294)
                      +.++|+.|++.|.....|..||+..+...-. .+|.-.-..          .+...-......-++|.|..|...+....
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~-~~c~~gq~~----------~~~arg~~~~~~~~p~~C~~C~~stttng  532 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQS-AYCKAGQNH----------PRLARGEVYRCPGKPYPCRACNYSTTTNG  532 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccch-hHhHhcccc----------ccccccccccCCCCcccceeeeeeeecch
Confidence            5589999999999999999999864332111 222111100          01222222344568899999999999999


Q ss_pred             HHHHHHhhcc--------------------------------------------CcccCCcccccccCChHhHHHHHhh
Q psy6546         111 ILKTHLKTHE--------------------------------------------GIIYPCPECDKTFLSTSGLREHRKV  145 (294)
Q Consensus       111 ~l~~H~~~~~--------------------------------------------~~~~~C~~C~~~f~~~~~l~~H~~~  145 (294)
                      .|.+|++...                                            ..+|.|.+|++..+-..+|+.||..
T Consensus       533 ~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarnlrihmts  611 (1406)
T KOG1146|consen  533 NLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARNLRIHMTA  611 (1406)
T ss_pred             HHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhcccccccc
Confidence            9999986641                                            0147899998888888888888853


No 49 
>KOG1146|consensus
Probab=96.21  E-value=0.0011  Score=63.14  Aligned_cols=99  Identities=18%  Similarity=0.332  Sum_probs=60.3

Q ss_pred             CcccccccCChHhHHHHHhhh-CCCC-ccCCCCCcccCCHHHHHHHHHhhcCCCcccCcchhccCCchHHHh-HHhhcCC
Q psy6546         126 CPECDKTFLSTSGLREHRKVH-AGVR-YICHACPREFSSEATMKAHVASHNGVQHACDQCDRTFSCMPYLRQ-HQKLHSG  202 (294)
Q Consensus       126 C~~C~~~f~~~~~l~~H~~~h-~~~~-~~C~~C~~~f~~~~~l~~H~~~~~~~~~~C~~C~~~f~~~~~l~~-H~~~h~~  202 (294)
                      |.-++..+.....+..|+..- ...+ +.|+.|+..|+....|..||+..+.+.-. .+|... ..-..+.+ -.....+
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~-~~c~~g-q~~~~~arg~~~~~~~  516 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS-AYCKAG-QNHPRLARGEVYRCPG  516 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccch-hHhHhc-cccccccccccccCCC
Confidence            333444444444444444322 2223 89999999999999999999986664222 333221 11111111 1123334


Q ss_pred             CceeCCCCccccCCHHHHHHHHHH
Q psy6546         203 ITYSCPSCSKSFNRKDRYRMHLKL  226 (294)
Q Consensus       203 ~~~~C~~C~~~f~~~~~l~~H~~~  226 (294)
                      ++|.|..|+..++...+|..|++.
T Consensus       517 ~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  517 KPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CcccceeeeeeeecchHHHHHHHH
Confidence            689999999999999999999864


No 50 
>PRK04860 hypothetical protein; Provisional
Probab=95.34  E-value=0.0081  Score=44.53  Aligned_cols=36  Identities=22%  Similarity=0.607  Sum_probs=24.1

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCCc-cccccccccccC
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGVR-HTCKECSKEFSN  243 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~-~~C~~C~~~f~~  243 (294)
                      +|.|. |+.   ....+.+|.++|.++. |.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            67776 776   4555677777777755 777777766654


No 51 
>PRK04860 hypothetical protein; Provisional
Probab=95.28  E-value=0.013  Score=43.53  Aligned_cols=35  Identities=20%  Similarity=0.562  Sum_probs=20.3

Q ss_pred             cccccccccccCHHHHHHHHhhhc-ccccccccccccccc
Q psy6546         232 HTCKECSKEFSNEYNLKNHMVLHD-VRAYVCELCARQFTR  270 (294)
Q Consensus       232 ~~C~~C~~~f~~~~~l~~H~~~h~-~~~~~C~~C~~~f~~  270 (294)
                      |.|. |+.   ....+..|.++|. +++|.|..|+..|..
T Consensus       120 Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        120 YRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            6665 654   4455566666664 455666666665543


No 52 
>KOG2785|consensus
Probab=95.11  E-value=0.016  Score=48.23  Aligned_cols=82  Identities=18%  Similarity=0.340  Sum_probs=49.7

Q ss_pred             CccCccchhccCCHHHHHHHHHHhCCc------ccC-CccCccchhccccCCCCCCCccchhhcccCCCCCcccCCccCc
Q psy6546          32 RHPCPQCSRDFATVKILKTHLKTHEGI------IYP-CPECDKTFLSTLTGTPQGARGRAVYLSRMSTTLTRHPCPQCSR  104 (294)
Q Consensus        32 ~~~C~~C~~~f~~~~~l~~H~~~~~~~------~~~-c~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~  104 (294)
                      .|.|.-|...|.+...-+.|++.-+..      ... -++-...|.......      ..........+..++.|..|.+
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~------~~~~~~~~e~~~~~~~c~~c~k   76 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSD------DSEKEENLEEAESVVYCEACNK   76 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhh------hhhhhhhhhhcccceehHHhhc
Confidence            589999999999999999999754331      111 111222232221000      0000011234566788999999


Q ss_pred             cccChHHHHHHHhhc
Q psy6546         105 DFATVKILKTHLKTH  119 (294)
Q Consensus       105 ~f~~~~~l~~H~~~~  119 (294)
                      .|........|+..-
T Consensus        77 ~~~s~~a~~~hl~Sk   91 (390)
T KOG2785|consen   77 SFASPKAHENHLKSK   91 (390)
T ss_pred             cccChhhHHHHHHHh
Confidence            999998888887654


No 53 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.99  E-value=0.01  Score=29.51  Aligned_cols=21  Identities=48%  Similarity=0.825  Sum_probs=13.1

Q ss_pred             cccccccccccCHHHHHHHHh
Q psy6546         232 HTCKECSKEFSNEYNLKNHMV  252 (294)
Q Consensus       232 ~~C~~C~~~f~~~~~l~~H~~  252 (294)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666666654


No 54 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.75  E-value=0.038  Score=26.91  Aligned_cols=22  Identities=41%  Similarity=0.797  Sum_probs=18.3

Q ss_pred             CccCccchhccCCHHHHHHHHHH
Q psy6546          32 RHPCPQCSRDFATVKILKTHLKT   54 (294)
Q Consensus        32 ~~~C~~C~~~f~~~~~l~~H~~~   54 (294)
                      ...|+.||+.| ....|..|+..
T Consensus         2 l~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    2 LVPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CCcCCCCCCEE-CHHHHHHHHHh
Confidence            46899999999 68889999764


No 55 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.49  E-value=0.048  Score=44.71  Aligned_cols=79  Identities=20%  Similarity=0.340  Sum_probs=45.9

Q ss_pred             eCCCCccccCCHHHHHHHHHHhCCCcccccccc----ccccCHHHHHHHHhhhc-cccc-cccccc-ccccchhhhhhhh
Q psy6546         206 SCPSCSKSFNRKDRYRMHLKLHQGVRHTCKECS----KEFSNEYNLKNHMVLHD-VRAY-VCELCA-RQFTRVDHFNHHR  278 (294)
Q Consensus       206 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~----~~f~~~~~l~~H~~~h~-~~~~-~C~~C~-~~f~~~~~l~~H~  278 (294)
                      .|..|+..|.+...|..|++..+..-|.|..-+    .-|.+..+|..|-+.-+ .-.| .|.+-. +.|....+|..|+
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~~hy~ct~qtc~~~k~~vf~~~~el~~h~  301 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFRNAHYCCTFQTCRVGKCYVFPYHTELLEHL  301 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhhhhhhhhccCccchhhhhCHHHHHHHhhcCceEEEEEEEecCcEEEeccHHHHHHHH
Confidence            577788888888888888777666556665544    24556666666633221 1111 121111 2567777777777


Q ss_pred             hhccCc
Q psy6546         279 RLQHDP  284 (294)
Q Consensus       279 ~~~h~~  284 (294)
                      ..-|+.
T Consensus       302 ~~~h~~  307 (493)
T COG5236         302 TRFHKV  307 (493)
T ss_pred             HHHhhc
Confidence            666554


No 56 
>KOG2482|consensus
Probab=94.48  E-value=0.33  Score=39.95  Aligned_cols=63  Identities=25%  Similarity=0.395  Sum_probs=39.9

Q ss_pred             HHHHHHhhccCc--ccCCccccccc-CChHhHHHHHhhhCCC-----------------------CccCCCCCcccCCHH
Q psy6546         111 ILKTHLKTHEGI--IYPCPECDKTF-LSTSGLREHRKVHAGV-----------------------RYICHACPREFSSEA  164 (294)
Q Consensus       111 ~l~~H~~~~~~~--~~~C~~C~~~f-~~~~~l~~H~~~h~~~-----------------------~~~C~~C~~~f~~~~  164 (294)
                      .|..+++...+.  ..+|-.|...+ .+++.+..|+-.-++-                       ++.|-.|.+.|+.+.
T Consensus       130 aLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkn  209 (423)
T KOG2482|consen  130 ALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKN  209 (423)
T ss_pred             HHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcH
Confidence            344555554443  56788887654 4567777776432211                       267888888888888


Q ss_pred             HHHHHHHhh
Q psy6546         165 TMKAHVASH  173 (294)
Q Consensus       165 ~l~~H~~~~  173 (294)
                      .|+.||+..
T Consensus       210 tLkeHMrkK  218 (423)
T KOG2482|consen  210 TLKEHMRKK  218 (423)
T ss_pred             HHHHHHHhc
Confidence            888887763


No 57 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.34  E-value=0.15  Score=41.90  Aligned_cols=137  Identities=22%  Similarity=0.336  Sum_probs=83.0

Q ss_pred             CccCcc--chhccCCHHHHHHHHHHhCCcccCCccCc---cchhccccCCCCCCCccchhhcccCC---C-CCcccCCcc
Q psy6546          32 RHPCPQ--CSRDFATVKILKTHLKTHEGIIYPCPECD---KTFLSTLTGTPQGARGRAVYLSRMST---T-LTRHPCPQC  102 (294)
Q Consensus        32 ~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~c~~c~---~~~~~~~~~~~~~~~~~~~~~~~~~~---~-~~~~~C~~C  102 (294)
                      .|.||.  |.........|..|.+..++. +.|..|.   +.|....+...+   ..+..+.....   + .+--.|..|
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~-~~C~~C~~nKk~F~~E~~lF~~---~~Lr~H~~~G~~e~GFKGHP~C~FC  226 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF-VLCSECIGNKKDFWNEIRLFRS---STLRDHKNGGLEEEGFKGHPLCIFC  226 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc-EEhHhhhcCcccCccceeeeec---ccccccccCCccccCcCCCchhhhc
Confidence            378985  888888899999999877664 3355553   233222111100   01111111111   1 222369999


Q ss_pred             CccccChHHHHHHHhhccCcccCCccccc-------ccCChHhHHHHHhhhCCCC--ccCCC-CCcccCCHHHHHHHHHh
Q psy6546         103 SRDFATVKILKTHLKTHEGIIYPCPECDK-------TFLSTSGLREHRKVHAGVR--YICHA-CPREFSSEATMKAHVAS  172 (294)
Q Consensus       103 ~~~f~~~~~l~~H~~~~~~~~~~C~~C~~-------~f~~~~~l~~H~~~h~~~~--~~C~~-C~~~f~~~~~l~~H~~~  172 (294)
                      ..-|.+...|..|++..+..   |-+|++       -|.+...|..|.+.-+.--  -.|.. =-.+|+....|..|+..
T Consensus       227 ~~~FYdDDEL~~HcR~~HE~---ChICD~v~p~~~QYFK~Y~~Le~HF~~~hy~ct~qtc~~~k~~vf~~~~el~~h~~~  303 (493)
T COG5236         227 KIYFYDDDELRRHCRLRHEA---CHICDMVGPIRYQYFKSYEDLEAHFRNAHYCCTFQTCRVGKCYVFPYHTELLEHLTR  303 (493)
T ss_pred             cceecChHHHHHHHHhhhhh---hhhhhccCccchhhhhCHHHHHHHhhcCceEEEEEEEecCcEEEeccHHHHHHHHHH
Confidence            99999999999999998875   555543       4666677777776433211  11221 12578899999999877


Q ss_pred             hcC
Q psy6546         173 HNG  175 (294)
Q Consensus       173 ~~~  175 (294)
                      -++
T Consensus       304 ~h~  306 (493)
T COG5236         304 FHK  306 (493)
T ss_pred             Hhh
Confidence            654


No 58 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.21  E-value=0.053  Score=26.38  Aligned_cols=19  Identities=42%  Similarity=0.945  Sum_probs=12.1

Q ss_pred             eCCCCccccCCHHHHHHHHH
Q psy6546         206 SCPSCSKSFNRKDRYRMHLK  225 (294)
Q Consensus       206 ~C~~C~~~f~~~~~l~~H~~  225 (294)
                      .|+.||+.| ..+.|.+|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            567777777 4555666654


No 59 
>KOG2785|consensus
Probab=94.18  E-value=0.18  Score=42.12  Aligned_cols=49  Identities=22%  Similarity=0.417  Sum_probs=39.7

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCC------------------------cccccccc---ccccCHHHHHHHHh
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGV------------------------RHTCKECS---KEFSNEYNLKNHMV  252 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~------------------------~~~C~~C~---~~f~~~~~l~~H~~  252 (294)
                      |-.|..|+..+.+-..-..||..+||.                        .+.|-.|+   +.|.+..+.+.|+.
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            577999999999988889999887752                        16788888   88888888888863


No 60 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.06  E-value=0.049  Score=28.89  Aligned_cols=23  Identities=26%  Similarity=0.506  Sum_probs=16.8

Q ss_pred             ceeCCCCccccCCHHHHHHHHHH
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKL  226 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~  226 (294)
                      +|.|..|+..|.+...+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            56777888888777777777653


No 61 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.08  E-value=0.14  Score=27.04  Aligned_cols=23  Identities=26%  Similarity=0.479  Sum_probs=16.2

Q ss_pred             cccCCccCccccChHHHHHHHhh
Q psy6546          96 RHPCPQCSRDFATVKILKTHLKT  118 (294)
Q Consensus        96 ~~~C~~C~~~f~~~~~l~~H~~~  118 (294)
                      +|.|..|++.|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46677777777777777777644


No 62 
>KOG2482|consensus
Probab=90.97  E-value=0.39  Score=39.58  Aligned_cols=53  Identities=23%  Similarity=0.416  Sum_probs=38.1

Q ss_pred             CCcccCCccCcccc-ChHHHHHHHhhccC----c-------------------ccCCcccccccCChHhHHHHHhhh
Q psy6546          94 LTRHPCPQCSRDFA-TVKILKTHLKTHEG----I-------------------IYPCPECDKTFLSTSGLREHRKVH  146 (294)
Q Consensus        94 ~~~~~C~~C~~~f~-~~~~l~~H~~~~~~----~-------------------~~~C~~C~~~f~~~~~l~~H~~~h  146 (294)
                      ....+|-.|...+. .++.+..|+-.-++    .                   .++|-.|++.|+++..|+.||+..
T Consensus       142 ~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  142 IFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             eeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhc
Confidence            34567999976554 44556667644332    1                   378999999999999999999753


No 63 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.91  E-value=0.14  Score=29.78  Aligned_cols=30  Identities=23%  Similarity=0.406  Sum_probs=25.3

Q ss_pred             CCCCCccCccchhccCCHHHHHHHHHHhCC
Q psy6546          28 TTPTRHPCPQCSRDFATVKILKTHLKTHEG   57 (294)
Q Consensus        28 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~   57 (294)
                      .+...++||.|+..|+.+.+...|+...++
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            456678999999999999999999975544


No 64 
>KOG4173|consensus
Probab=90.88  E-value=0.17  Score=38.37  Aligned_cols=46  Identities=24%  Similarity=0.574  Sum_probs=20.0

Q ss_pred             ccCCC--CCcccCCHHHHHHHHHhhcCCCcccCcchhccCCchHHHhHHh
Q psy6546         151 YICHA--CPREFSSEATMKAHVASHNGVQHACDQCDRTFSCMPYLRQHQK  198 (294)
Q Consensus       151 ~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  198 (294)
                      +.|..  |-..|........|-.+.++  ..|..|.+.|.+...|-.|+.
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~--~sCs~C~r~~Pt~hLLd~HI~  127 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG--NSCSFCKRAFPTGHLLDAHIL  127 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc--chhHHHHHhCCchhhhhHHHH
Confidence            44444  33444433333333333222  245555555555555555443


No 65 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.77  E-value=0.12  Score=27.10  Aligned_cols=11  Identities=36%  Similarity=1.216  Sum_probs=5.2

Q ss_pred             eeCCCCccccC
Q psy6546         205 YSCPSCSKSFN  215 (294)
Q Consensus       205 ~~C~~C~~~f~  215 (294)
                      |+|..||..+.
T Consensus         2 ~~C~~CGy~y~   12 (33)
T cd00350           2 YVCPVCGYIYD   12 (33)
T ss_pred             EECCCCCCEEC
Confidence            44555554443


No 66 
>KOG2893|consensus
Probab=90.12  E-value=0.092  Score=40.74  Aligned_cols=42  Identities=38%  Similarity=0.709  Sum_probs=34.4

Q ss_pred             cCCccCccccChHHHHHHHhhccCcccCCcccccccCChHhHHHH
Q psy6546          98 PCPQCSRDFATVKILKTHLKTHEGIIYPCPECDKTFLSTSGLREH  142 (294)
Q Consensus        98 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~C~~C~~~f~~~~~l~~H  142 (294)
                      .|=.|++.|.+..-|.+|++.-+   |+|.+|.+.+.+--.|..|
T Consensus        12 wcwycnrefddekiliqhqkakh---fkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAKH---FKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhhhcc---ceeeeehhhhccCCCceee
Confidence            68899999999999999987754   8999998887666666555


No 67 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=88.85  E-value=0.46  Score=32.91  Aligned_cols=80  Identities=16%  Similarity=0.291  Sum_probs=46.3

Q ss_pred             CceeCCCCccccCCHHHHHHHHHH-hCCCc-cccccccccccCHHHH-HHHHhhh----------c---cccccc----c
Q psy6546         203 ITYSCPSCSKSFNRKDRYRMHLKL-HQGVR-HTCKECSKEFSNEYNL-KNHMVLH----------D---VRAYVC----E  262 (294)
Q Consensus       203 ~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~-~~C~~C~~~f~~~~~l-~~H~~~h----------~---~~~~~C----~  262 (294)
                      +-..|..|+....- +.+..|++. |+..+ ..-..=.+.+.....| .....+-          +   ..-|.|    +
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~~   88 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDPP   88 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCCC
Confidence            35789999988876 789999985 43321 1000000111111111 0000000          0   123889    9


Q ss_pred             cccccccchhhhhhhhhhccC
Q psy6546         263 LCARQFTRVDHFNHHRRLQHD  283 (294)
Q Consensus       263 ~C~~~f~~~~~l~~H~~~~h~  283 (294)
                      .|++.+.+...+..|.+.+|+
T Consensus        89 ~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   89 HCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCcEeccHHHHHHHHHHhcC
Confidence            999999999999999998885


No 68 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=86.95  E-value=0.099  Score=45.86  Aligned_cols=53  Identities=26%  Similarity=0.607  Sum_probs=28.2

Q ss_pred             cCCcccccccCChHhHHHHHh--hhCCC--C-ccCC--CCCcccCCHHHHHHHHHhhcCC
Q psy6546         124 YPCPECDKTFLSTSGLREHRK--VHAGV--R-YICH--ACPREFSSEATMKAHVASHNGV  176 (294)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~--~h~~~--~-~~C~--~C~~~f~~~~~l~~H~~~~~~~  176 (294)
                      +.|..|...|.....|..|..  .|.++  + +.|+  .|++.|.....+..|...+++.
T Consensus       290 ~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  349 (467)
T COG5048         290 IKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSI  349 (467)
T ss_pred             CCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCC
Confidence            445555555555555555555  45544  3 5555  4555555555555555555543


No 69 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=86.87  E-value=0.67  Score=31.91  Aligned_cols=20  Identities=20%  Similarity=0.375  Sum_probs=12.2

Q ss_pred             CCccCccchhccCCHHHHHH
Q psy6546          31 TRHPCPQCSRDFATVKILKT   50 (294)
Q Consensus        31 ~~~~C~~C~~~f~~~~~l~~   50 (294)
                      -|..|+.||...-....|.+
T Consensus        14 LP~~CpiCgLtLVss~HLAR   33 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLAR   33 (112)
T ss_pred             CCCcCCcCCCEEeccchHHH
Confidence            35667777776665555553


No 70 
>KOG2893|consensus
Probab=86.27  E-value=0.21  Score=38.87  Aligned_cols=47  Identities=26%  Similarity=0.540  Sum_probs=31.7

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCCccccccccccccCHHHHHHH-Hhhh
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGVRHTCKECSKEFSNEYNLKNH-MVLH  254 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H-~~~h  254 (294)
                      +| |=+|++-|....-|.+|++..   -|+|-+|.+.+-+.-.|..| +.+|
T Consensus        11 pw-cwycnrefddekiliqhqkak---hfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   11 PW-CWYCNREFDDEKILIQHQKAK---HFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             ce-eeecccccchhhhhhhhhhhc---cceeeeehhhhccCCCceeehhhhh
Confidence            44 667788888777777776541   17788887776666666666 4555


No 71 
>KOG2186|consensus
Probab=84.27  E-value=0.57  Score=36.97  Aligned_cols=45  Identities=18%  Similarity=0.522  Sum_probs=24.8

Q ss_pred             cCCcccccccCChHhHHHHHhhhCCCCccCCCCCcccCCHHHHHHHH
Q psy6546         124 YPCPECDKTFLSTSGLREHRKVHAGVRYICHACPREFSSEATMKAHV  170 (294)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~  170 (294)
                      |.|..||.... +..+.+|+...++..|.|-.|++.|.. .....|.
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccCCeeEEeeccccccc-chhhhhh
Confidence            45666665533 234445666666655666666666655 3444443


No 72 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=83.85  E-value=0.34  Score=42.49  Aligned_cols=58  Identities=26%  Similarity=0.509  Sum_probs=43.1

Q ss_pred             ccccccccccccCHHHHHHHHh--hhc-c--cccccc--cccccccchhhhhhhhhhccCccccc
Q psy6546         231 RHTCKECSKEFSNEYNLKNHMV--LHD-V--RAYVCE--LCARQFTRVDHFNHHRRLQHDPEEFE  288 (294)
Q Consensus       231 ~~~C~~C~~~f~~~~~l~~H~~--~h~-~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~~~~  288 (294)
                      ++.|..|...|.....|..|.+  .|. +  +++.|+  .|++.|.....+..|...|.+..+..
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~  353 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAK  353 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccc
Confidence            3677777777877777777777  665 5  677777  68888888877777777777766553


No 73 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=83.49  E-value=2.3  Score=29.34  Aligned_cols=49  Identities=18%  Similarity=0.385  Sum_probs=32.7

Q ss_pred             cCCccCccccChHHHHHHHhhccCcccCCcccccccCChHhHHHHHhhhC
Q psy6546          98 PCPQCSRDFATVKILKTHLKTHEGIIYPCPECDKTFLSTSGLREHRKVHA  147 (294)
Q Consensus        98 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  147 (294)
                      .|..|...|........-. ......|+|+.|...|-..-++-.|...|.
T Consensus        57 ~C~~C~~~f~~~~~~~~~~-~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFDE-LKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCcccccccc-cccccceeCCCCCCccccccchhhhhhccC
Confidence            4999999887653211110 112236999999999988888877776654


No 74 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=83.46  E-value=0.5  Score=37.36  Aligned_cols=26  Identities=12%  Similarity=0.285  Sum_probs=17.5

Q ss_pred             ccccccccccccccchhhhhhhhhhc
Q psy6546         256 VRAYVCELCARQFTRVDHFNHHRRLQ  281 (294)
Q Consensus       256 ~~~~~C~~C~~~f~~~~~l~~H~~~~  281 (294)
                      .+++.|+.|++..+.-..|.--.|+|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            56777777777777766666555444


No 75 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=83.08  E-value=0.74  Score=22.59  Aligned_cols=6  Identities=50%  Similarity=1.591  Sum_probs=2.2

Q ss_pred             CCCCcc
Q psy6546         207 CPSCSK  212 (294)
Q Consensus       207 C~~C~~  212 (294)
                      |+.||+
T Consensus        17 Cp~CG~   22 (26)
T PF10571_consen   17 CPHCGY   22 (26)
T ss_pred             CCCCCC
Confidence            333333


No 76 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=82.80  E-value=0.94  Score=26.98  Aligned_cols=31  Identities=16%  Similarity=0.309  Sum_probs=14.7

Q ss_pred             cccccccccccCHHHHHHHHhhhcccccccccccc
Q psy6546         232 HTCKECSKEFSNEYNLKNHMVLHDVRAYVCELCAR  266 (294)
Q Consensus       232 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~  266 (294)
                      |.|+.||+.-.....-    -.....+|+|+.||+
T Consensus        28 F~CPnCGe~~I~Rc~~----CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          28 FPCPNCGEVEIYRCAK----CRKLGNPYRCPKCGF   58 (61)
T ss_pred             eeCCCCCceeeehhhh----HHHcCCceECCCcCc
Confidence            5566665443333221    111245666666664


No 77 
>KOG2186|consensus
Probab=82.14  E-value=0.93  Score=35.80  Aligned_cols=47  Identities=28%  Similarity=0.647  Sum_probs=30.7

Q ss_pred             cccCcchhccCCchHHHhHHhhcCCCceeCCCCccccCCHHHHHHHHHH
Q psy6546         178 HACDQCDRTFSCMPYLRQHQKLHSGITYSCPSCSKSFNRKDRYRMHLKL  226 (294)
Q Consensus       178 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~  226 (294)
                      |.|..||.... +..+..|+...++.-|.|..|++.|.. .....|.+-
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccCCeeEEeeccccccc-chhhhhhhh
Confidence            56777775544 345556777777777777777777776 445566543


No 78 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=81.98  E-value=3.4  Score=28.53  Aligned_cols=27  Identities=22%  Similarity=0.534  Sum_probs=24.3

Q ss_pred             CCccC----ccchhccCCHHHHHHHHHHhCC
Q psy6546          31 TRHPC----PQCSRDFATVKILKTHLKTHEG   57 (294)
Q Consensus        31 ~~~~C----~~C~~~f~~~~~l~~H~~~~~~   57 (294)
                      ..|.|    ..|+....+...+..|++.+|+
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            56999    9999999999999999987764


No 79 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=81.65  E-value=0.7  Score=24.36  Aligned_cols=9  Identities=22%  Similarity=0.781  Sum_probs=4.4

Q ss_pred             ccccccccc
Q psy6546         258 AYVCELCAR  266 (294)
Q Consensus       258 ~~~C~~C~~  266 (294)
                      |..|++|+.
T Consensus        18 p~~CP~Cg~   26 (34)
T cd00729          18 PEKCPICGA   26 (34)
T ss_pred             CCcCcCCCC
Confidence            344555554


No 80 
>KOG4173|consensus
Probab=81.57  E-value=0.72  Score=35.15  Aligned_cols=81  Identities=23%  Similarity=0.541  Sum_probs=60.8

Q ss_pred             CcccCc--chhccCCchHHHhHHhhcCCCceeCCCCccccCCHHHHHHHHHHhC----------CCc-ccc--ccccccc
Q psy6546         177 QHACDQ--CDRTFSCMPYLRQHQKLHSGITYSCPSCSKSFNRKDRYRMHLKLHQ----------GVR-HTC--KECSKEF  241 (294)
Q Consensus       177 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~----------~~~-~~C--~~C~~~f  241 (294)
                      .+.|+.  |...|.+...+..|...-++.  .|..|.+.|.+.--|..|+...+          |.. |.|  ..|+..|
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~--sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGN--SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccc--hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            467865  778888888888887554443  69999999999999999976433          333 888  5699999


Q ss_pred             cCHHHHHHHH-hhhc-cccc
Q psy6546         242 SNEYNLKNHM-VLHD-VRAY  259 (294)
Q Consensus       242 ~~~~~l~~H~-~~h~-~~~~  259 (294)
                      .....-..|. ++|. ...|
T Consensus       157 kT~r~RkdH~I~~Hk~Pa~f  176 (253)
T KOG4173|consen  157 KTSRDRKDHMIRMHKYPADF  176 (253)
T ss_pred             hhhhhhhhHHHHhccCCcce
Confidence            9999988894 6664 4433


No 81 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=79.94  E-value=0.9  Score=25.57  Aligned_cols=11  Identities=27%  Similarity=0.869  Sum_probs=5.1

Q ss_pred             eeCCCCccccC
Q psy6546         205 YSCPSCSKSFN  215 (294)
Q Consensus       205 ~~C~~C~~~f~  215 (294)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            44445554443


No 82 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=79.79  E-value=1  Score=26.32  Aligned_cols=25  Identities=28%  Similarity=0.687  Sum_probs=18.9

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhC
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQ  228 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~  228 (294)
                      -+.|+.|+..|..+....+|....+
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhhHHh
Confidence            5778888888888888888875433


No 83 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=79.54  E-value=1.8  Score=29.81  Aligned_cols=11  Identities=36%  Similarity=1.023  Sum_probs=5.5

Q ss_pred             ccCCccCccch
Q psy6546          59 IYPCPECDKTF   69 (294)
Q Consensus        59 ~~~c~~c~~~~   69 (294)
                      ...|+.||.+|
T Consensus         9 KR~Cp~CG~kF   19 (108)
T PF09538_consen    9 KRTCPSCGAKF   19 (108)
T ss_pred             cccCCCCcchh
Confidence            34455555555


No 84 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=78.25  E-value=0.76  Score=36.39  Aligned_cols=20  Identities=35%  Similarity=0.690  Sum_probs=10.9

Q ss_pred             CcccCCcccccccCChHhHH
Q psy6546         121 GIIYPCPECDKTFLSTSGLR  140 (294)
Q Consensus       121 ~~~~~C~~C~~~f~~~~~l~  140 (294)
                      +.++.|+.|+........|.
T Consensus       207 ~k~~PCPKCg~et~eTkdLS  226 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLS  226 (314)
T ss_pred             CCCCCCCCCCCcccccccce
Confidence            34566666666555444443


No 85 
>PF14353 CpXC:  CpXC protein
Probab=77.67  E-value=1.1  Score=32.10  Aligned_cols=20  Identities=30%  Similarity=0.572  Sum_probs=10.9

Q ss_pred             CCcccCCccCccccChHHHH
Q psy6546          94 LTRHPCPQCSRDFATVKILK  113 (294)
Q Consensus        94 ~~~~~C~~C~~~f~~~~~l~  113 (294)
                      ...+.|+.||..|.-...+.
T Consensus        36 l~~~~CP~Cg~~~~~~~p~l   55 (128)
T PF14353_consen   36 LFSFTCPSCGHKFRLEYPLL   55 (128)
T ss_pred             cCEEECCCCCCceecCCCEE
Confidence            34466666666665444333


No 86 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=77.23  E-value=1.3  Score=32.72  Aligned_cols=18  Identities=28%  Similarity=0.743  Sum_probs=12.6

Q ss_pred             cccCCccCccccChHHHH
Q psy6546          96 RHPCPQCSRDFATVKILK  113 (294)
Q Consensus        96 ~~~C~~C~~~f~~~~~l~  113 (294)
                      .++|+.||+.|.+...+.
T Consensus        28 ~~~c~~c~~~f~~~e~~~   45 (154)
T PRK00464         28 RRECLACGKRFTTFERVE   45 (154)
T ss_pred             eeeccccCCcceEeEecc
Confidence            377888888887765543


No 87 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=76.31  E-value=2.2  Score=30.53  Aligned_cols=33  Identities=39%  Similarity=0.748  Sum_probs=20.5

Q ss_pred             CCCCCCCCCCccCccchhccCCHHHHHHHHHHhCCc
Q psy6546          23 TQTSSTTPTRHPCPQCSRDFATVKILKTHLKTHEGI   58 (294)
Q Consensus        23 ~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   58 (294)
                      +...+..+....|-+||+.|...   ++|++.|+|.
T Consensus        63 ~i~kSI~~d~i~clecGk~~k~L---krHL~~~~gl   95 (132)
T PF05443_consen   63 PIRKSITPDYIICLECGKKFKTL---KRHLRTHHGL   95 (132)
T ss_dssp             -SSTTB-SS-EE-TBT--EESBH---HHHHHHTT-S
T ss_pred             CHhhccccCeeEEccCCcccchH---HHHHHHccCC
Confidence            34444556668999999999976   8999999875


No 88 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=75.68  E-value=3.2  Score=30.95  Aligned_cols=17  Identities=18%  Similarity=0.499  Sum_probs=8.5

Q ss_pred             ceeCCCCccccCCHHHH
Q psy6546         204 TYSCPSCSKSFNRKDRY  220 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l  220 (294)
                      -|.|+.|+..|+...++
T Consensus       109 ~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAM  125 (158)
T ss_pred             eEECCCCCcEeeHHHHH
Confidence            45555555555444444


No 89 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=75.02  E-value=1.5  Score=23.54  Aligned_cols=11  Identities=36%  Similarity=1.120  Sum_probs=5.4

Q ss_pred             cccCCccCccc
Q psy6546          96 RHPCPQCSRDF  106 (294)
Q Consensus        96 ~~~C~~C~~~f  106 (294)
                      ..+|..|+..|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            34555555444


No 90 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=73.95  E-value=1.9  Score=23.00  Aligned_cols=10  Identities=30%  Similarity=0.903  Sum_probs=4.6

Q ss_pred             ccCCccCccc
Q psy6546          97 HPCPQCSRDF  106 (294)
Q Consensus        97 ~~C~~C~~~f  106 (294)
                      .+|..|+..|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            4455554443


No 91 
>PF12907 zf-met2:  Zinc-binding
Probab=73.84  E-value=2  Score=23.57  Aligned_cols=29  Identities=24%  Similarity=0.675  Sum_probs=18.7

Q ss_pred             cccccccccc---cchhhhhhhhhhccCcccc
Q psy6546         259 YVCELCARQF---TRVDHFNHHRRLQHDPEEF  287 (294)
Q Consensus       259 ~~C~~C~~~f---~~~~~l~~H~~~~h~~~~~  287 (294)
                      ++|.+|.-.|   .....|..|....|++..+
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~   33 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTF   33 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCH
Confidence            4677777444   4445677777777776644


No 92 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=73.36  E-value=2.1  Score=23.01  Aligned_cols=10  Identities=20%  Similarity=0.723  Sum_probs=5.2

Q ss_pred             ccCCccCccc
Q psy6546          97 HPCPQCSRDF  106 (294)
Q Consensus        97 ~~C~~C~~~f  106 (294)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4555555544


No 93 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=73.09  E-value=0.58  Score=25.67  Aligned_cols=11  Identities=27%  Similarity=0.857  Sum_probs=5.3

Q ss_pred             ccCccchhccC
Q psy6546          33 HPCPQCSRDFA   43 (294)
Q Consensus        33 ~~C~~C~~~f~   43 (294)
                      |+|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            44555555444


No 94 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=72.56  E-value=6.6  Score=21.67  Aligned_cols=25  Identities=28%  Similarity=0.545  Sum_probs=19.0

Q ss_pred             CccCccchhccC--CHHHHHHHHHHhC
Q psy6546          32 RHPCPQCSRDFA--TVKILKTHLKTHE   56 (294)
Q Consensus        32 ~~~C~~C~~~f~--~~~~l~~H~~~~~   56 (294)
                      ...|+.||+.|.  ...+.+.|.+.|.
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            468999999995  4567777877664


No 95 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=72.33  E-value=1.6  Score=25.08  Aligned_cols=10  Identities=30%  Similarity=0.923  Sum_probs=5.4

Q ss_pred             cccccccccc
Q psy6546         232 HTCKECSKEF  241 (294)
Q Consensus       232 ~~C~~C~~~f  241 (294)
                      |+|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5555555554


No 96 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=70.24  E-value=4.7  Score=23.42  Aligned_cols=12  Identities=25%  Similarity=0.711  Sum_probs=7.2

Q ss_pred             cCCccCccchhc
Q psy6546          60 YPCPECDKTFLS   71 (294)
Q Consensus        60 ~~c~~c~~~~~~   71 (294)
                      |.|..|+..+..
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            556666666543


No 97 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=69.11  E-value=0.85  Score=26.64  Aligned_cols=29  Identities=24%  Similarity=0.755  Sum_probs=15.4

Q ss_pred             ccCccchhccCCHHHHHHHHHHhCCcccCCccCcc
Q psy6546          33 HPCPQCSRDFATVKILKTHLKTHEGIIYPCPECDK   67 (294)
Q Consensus        33 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~c~~c~~   67 (294)
                      |+|..||..|.....+.      ......|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~------~~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMS------DDPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecC------CCCCCCCCCCCC
Confidence            66777777776442221      123455666654


No 98 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=69.06  E-value=2.3  Score=32.35  Aligned_cols=31  Identities=19%  Similarity=0.642  Sum_probs=18.0

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCCcccccccccccc
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGVRHTCKECSKEFS  242 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f~  242 (294)
                      -|.|+.|+..|+...++.        ..|.|+.||....
T Consensus       117 ~Y~Cp~C~~rytf~eA~~--------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME--------YGFRCPQCGEMLE  147 (178)
T ss_pred             EEECCCCCcEEeHHHHhh--------cCCcCCCCCCCCe
Confidence            566766776666555442        1366666665443


No 99 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=68.56  E-value=3.7  Score=30.57  Aligned_cols=30  Identities=17%  Similarity=0.541  Sum_probs=16.3

Q ss_pred             CcccCcchhccCCchHHHhHHhhcCCCceeCCCCcccc
Q psy6546         177 QHACDQCDRTFSCMPYLRQHQKLHSGITYSCPSCSKSF  214 (294)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f  214 (294)
                      -|.|+.|+..|+....+.        -.|.|+.||...
T Consensus       109 ~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAME--------LNFTCPRCGAML  138 (158)
T ss_pred             eEECCCCCcEeeHHHHHH--------cCCcCCCCCCEe
Confidence            456666665555544432        156666666443


No 100
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=68.48  E-value=5.8  Score=29.13  Aligned_cols=12  Identities=17%  Similarity=0.728  Sum_probs=6.0

Q ss_pred             cccccccccccC
Q psy6546         232 HTCKECSKEFSN  243 (294)
Q Consensus       232 ~~C~~C~~~f~~  243 (294)
                      |.|+.|+..|..
T Consensus       100 Y~Cp~C~~~y~~  111 (147)
T smart00531      100 YKCPNCQSKYTF  111 (147)
T ss_pred             EECcCCCCEeeH
Confidence            455555544443


No 101
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=68.24  E-value=5.5  Score=19.44  Aligned_cols=19  Identities=26%  Similarity=0.684  Sum_probs=12.2

Q ss_pred             eCCCCccccCCHHHHHHHHH
Q psy6546         206 SCPSCSKSFNRKDRYRMHLK  225 (294)
Q Consensus       206 ~C~~C~~~f~~~~~l~~H~~  225 (294)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            477777776 4456666654


No 102
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=67.47  E-value=10  Score=27.02  Aligned_cols=34  Identities=35%  Similarity=0.515  Sum_probs=25.4

Q ss_pred             CCCCCCCCCCCccCccchhccCCHHHHHHHHHHhCCc
Q psy6546          22 TTQTSSTTPTRHPCPQCSRDFATVKILKTHLKTHEGI   58 (294)
Q Consensus        22 ~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   58 (294)
                      .+...+..+....|-++|+.|.   .|++|+..|.+.
T Consensus        66 V~~kKSVtpD~IicLEDGkkfK---SLKRHL~t~~gm   99 (148)
T COG4957          66 VPIKKSVTPDYIICLEDGKKFK---SLKRHLTTHYGL   99 (148)
T ss_pred             CCcccccCCCeEEEeccCcchH---HHHHHHhcccCC
Confidence            3344455556688999999997   688999998764


No 103
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=67.33  E-value=2.7  Score=31.37  Aligned_cols=9  Identities=33%  Similarity=1.202  Sum_probs=4.8

Q ss_pred             eeCCCCccc
Q psy6546         205 YSCPSCSKS  213 (294)
Q Consensus       205 ~~C~~C~~~  213 (294)
                      |.|++||+.
T Consensus       135 ~vC~vCGy~  143 (166)
T COG1592         135 WVCPVCGYT  143 (166)
T ss_pred             EEcCCCCCc
Confidence            555555543


No 104
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=66.91  E-value=1.9  Score=22.32  Aligned_cols=7  Identities=43%  Similarity=1.141  Sum_probs=3.1

Q ss_pred             ccccccc
Q psy6546         232 HTCKECS  238 (294)
Q Consensus       232 ~~C~~C~  238 (294)
                      .+|..||
T Consensus        18 irC~~CG   24 (32)
T PF03604_consen   18 IRCPECG   24 (32)
T ss_dssp             SSBSSSS
T ss_pred             EECCcCC
Confidence            3444444


No 105
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=65.83  E-value=2.3  Score=23.83  Aligned_cols=20  Identities=15%  Similarity=0.487  Sum_probs=7.6

Q ss_pred             cccccccccccch----hhhhhhh
Q psy6546         259 YVCELCARQFTRV----DHFNHHR  278 (294)
Q Consensus       259 ~~C~~C~~~f~~~----~~l~~H~  278 (294)
                      .+|..|++.+...    ++|..|+
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhh
Confidence            3444444444332    4455554


No 106
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=65.31  E-value=4.1  Score=24.38  Aligned_cols=8  Identities=50%  Similarity=1.684  Sum_probs=3.4

Q ss_pred             ceeCCCCc
Q psy6546         204 TYSCPSCS  211 (294)
Q Consensus       204 ~~~C~~C~  211 (294)
                      +|.|+.||
T Consensus        48 ~Y~CP~CG   55 (59)
T PRK14890         48 PYTCPKCG   55 (59)
T ss_pred             ceECCCCC
Confidence            44444444


No 107
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=64.96  E-value=1  Score=35.38  Aligned_cols=11  Identities=27%  Similarity=0.957  Sum_probs=6.7

Q ss_pred             cCCcccccccC
Q psy6546         124 YPCPECDKTFL  134 (294)
Q Consensus       124 ~~C~~C~~~f~  134 (294)
                      +.|+.||..+.
T Consensus        49 ~vCP~CgyA~~   59 (214)
T PF09986_consen   49 WVCPHCGYAAF   59 (214)
T ss_pred             EECCCCCCccc
Confidence            45666766554


No 108
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=64.89  E-value=2.3  Score=21.66  Aligned_cols=11  Identities=27%  Similarity=0.610  Sum_probs=5.7

Q ss_pred             ccccccccccc
Q psy6546         256 VRAYVCELCAR  266 (294)
Q Consensus       256 ~~~~~C~~C~~  266 (294)
                      ...|.|+.|+.
T Consensus        17 ~~~~vCp~C~~   27 (30)
T PF08274_consen   17 GELLVCPECGH   27 (30)
T ss_dssp             SSSEEETTTTE
T ss_pred             CCEEeCCcccc
Confidence            44555555554


No 109
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=64.71  E-value=6.3  Score=22.74  Aligned_cols=21  Identities=33%  Similarity=0.735  Sum_probs=12.3

Q ss_pred             eeCCCCccccCCH-----HHHHHHHH
Q psy6546         205 YSCPSCSKSFNRK-----DRYRMHLK  225 (294)
Q Consensus       205 ~~C~~C~~~f~~~-----~~l~~H~~  225 (294)
                      -.|..|++.+...     +.|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            3566666665443     46666665


No 110
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=63.78  E-value=4.4  Score=22.91  Aligned_cols=11  Identities=27%  Similarity=0.939  Sum_probs=5.7

Q ss_pred             ccCCccCccch
Q psy6546          59 IYPCPECDKTF   69 (294)
Q Consensus        59 ~~~c~~c~~~~   69 (294)
                      .|.|+.|+..+
T Consensus         3 ~y~C~~CG~~~   13 (46)
T PRK00398          3 EYKCARCGREV   13 (46)
T ss_pred             EEECCCCCCEE
Confidence            35555555544


No 111
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=63.61  E-value=5.1  Score=30.51  Aligned_cols=30  Identities=20%  Similarity=0.635  Sum_probs=16.0

Q ss_pred             CcccCcchhccCCchHHHhHHhhcCCCceeCCCCcccc
Q psy6546         177 QHACDQCDRTFSCMPYLRQHQKLHSGITYSCPSCSKSF  214 (294)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f  214 (294)
                      -|.|+.|+..|+....+.        -.|.|+.||...
T Consensus       117 ~Y~Cp~C~~rytf~eA~~--------~~F~Cp~Cg~~L  146 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME--------YGFRCPQCGEML  146 (178)
T ss_pred             EEECCCCCcEEeHHHHhh--------cCCcCCCCCCCC
Confidence            356666665555444321        156666666544


No 112
>PF09788 Tmemb_55A:  Transmembrane protein 55A;  InterPro: IPR019178  Members of this family catalyse the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate, in the reaction:  1-phosphatidyl-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.  
Probab=63.38  E-value=6.7  Score=31.31  Aligned_cols=32  Identities=16%  Similarity=0.424  Sum_probs=24.6

Q ss_pred             CCccCccchhccCCHHHHHHHHHHhCCcccCCccCccch
Q psy6546          31 TRHPCPQCSRDFATVKILKTHLKTHEGIIYPCPECDKTF   69 (294)
Q Consensus        31 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~c~~c~~~~   69 (294)
                      ....|..|+...+....+..|+       ++|..|++..
T Consensus        64 p~v~CrVCq~~I~i~gk~~QhV-------VkC~~CnEAT   95 (256)
T PF09788_consen   64 PVVTCRVCQSLIDIEGKMHQHV-------VKCSVCNEAT   95 (256)
T ss_pred             ceEEeecCCceecccCccceee-------EECCCCCccc
Confidence            3468999999998877766664       7888887654


No 113
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=62.10  E-value=3.4  Score=23.62  Aligned_cols=11  Identities=27%  Similarity=0.767  Sum_probs=5.7

Q ss_pred             CcccCCccCcc
Q psy6546          95 TRHPCPQCSRD  105 (294)
Q Consensus        95 ~~~~C~~C~~~  105 (294)
                      .-+.|+.|+..
T Consensus        33 ~~w~CP~C~a~   43 (47)
T PF00301_consen   33 DDWVCPVCGAP   43 (47)
T ss_dssp             TT-B-TTTSSB
T ss_pred             CCCcCcCCCCc
Confidence            44678888654


No 114
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=60.24  E-value=8.2  Score=27.25  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=4.5

Q ss_pred             cCCccCccch
Q psy6546          60 YPCPECDKTF   69 (294)
Q Consensus        60 ~~c~~c~~~~   69 (294)
                      ..|+.|+.+|
T Consensus        10 r~Cp~cg~kF   19 (129)
T TIGR02300        10 RICPNTGSKF   19 (129)
T ss_pred             ccCCCcCccc
Confidence            3444444444


No 115
>PHA00626 hypothetical protein
Probab=59.27  E-value=4.2  Score=23.95  Aligned_cols=16  Identities=13%  Similarity=0.241  Sum_probs=13.2

Q ss_pred             CCCccCccchhccCCH
Q psy6546          30 PTRHPCPQCSRDFATV   45 (294)
Q Consensus        30 ~~~~~C~~C~~~f~~~   45 (294)
                      ...|.|+.||..|+..
T Consensus        21 snrYkCkdCGY~ft~~   36 (59)
T PHA00626         21 SDDYVCCDCGYNDSKD   36 (59)
T ss_pred             CcceEcCCCCCeechh
Confidence            5789999999999743


No 116
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=58.99  E-value=6.3  Score=21.83  Aligned_cols=10  Identities=50%  Similarity=1.351  Sum_probs=5.9

Q ss_pred             cCCccCccch
Q psy6546          60 YPCPECDKTF   69 (294)
Q Consensus        60 ~~c~~c~~~~   69 (294)
                      |.|..|+..|
T Consensus         6 y~C~~Cg~~f   15 (42)
T PF09723_consen    6 YRCEECGHEF   15 (42)
T ss_pred             EEeCCCCCEE
Confidence            5566666555


No 117
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=58.39  E-value=6.4  Score=22.54  Aligned_cols=14  Identities=21%  Similarity=0.558  Sum_probs=8.5

Q ss_pred             hCCCcccccccccc
Q psy6546         227 HQGVRHTCKECSKE  240 (294)
Q Consensus       227 h~~~~~~C~~C~~~  240 (294)
                      +|..+|.|..||.+
T Consensus        33 ~H~dR~~CGkCgyT   46 (51)
T COG1998          33 DHKDRWACGKCGYT   46 (51)
T ss_pred             hcCceeEeccccce
Confidence            34446777777754


No 118
>KOG4167|consensus
Probab=57.31  E-value=8.5  Score=35.60  Aligned_cols=27  Identities=33%  Similarity=0.693  Sum_probs=20.4

Q ss_pred             CCcccCCccCccccChHHHHHHHhhcc
Q psy6546          94 LTRHPCPQCSRDFATVKILKTHLKTHE  120 (294)
Q Consensus        94 ~~~~~C~~C~~~f~~~~~l~~H~~~~~  120 (294)
                      ...|.|..|++.|....++..||+.|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            456778888888877777777877774


No 119
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=57.24  E-value=15  Score=20.46  Aligned_cols=26  Identities=27%  Similarity=0.392  Sum_probs=22.0

Q ss_pred             CCCccCccchhccCCHHHHHHHHHHh
Q psy6546          30 PTRHPCPQCSRDFATVKILKTHLKTH   55 (294)
Q Consensus        30 ~~~~~C~~C~~~f~~~~~l~~H~~~~   55 (294)
                      +-.|+|-.|.......+.|-.||+..
T Consensus        18 p~~ykcfqcpftc~~kshl~nhmky~   43 (54)
T PF15269_consen   18 PFKYKCFQCPFTCNEKSHLFNHMKYS   43 (54)
T ss_pred             CccceeecCCcccchHHHHHHHHHHH
Confidence            33588999999999999999999753


No 120
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=57.19  E-value=3.3  Score=29.39  Aligned_cols=10  Identities=30%  Similarity=0.723  Sum_probs=4.9

Q ss_pred             cccCcchhcc
Q psy6546         178 HACDQCDRTF  187 (294)
Q Consensus       178 ~~C~~C~~~f  187 (294)
                      |+|.+|..+.
T Consensus        81 YeCnIC~etS   90 (140)
T PF05290_consen   81 YECNICKETS   90 (140)
T ss_pred             eeccCccccc
Confidence            5555554433


No 121
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=56.32  E-value=5.4  Score=28.60  Aligned_cols=24  Identities=25%  Similarity=0.652  Sum_probs=12.7

Q ss_pred             cccccccccccchhhhhhhhhhccCcc
Q psy6546         259 YVCELCARQFTRVDHFNHHRRLQHDPE  285 (294)
Q Consensus       259 ~~C~~C~~~f~~~~~l~~H~~~~h~~~  285 (294)
                      -.|-.||+.|..   |++|++.|||=.
T Consensus        73 i~clecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-S-
T ss_pred             eEEccCCcccch---HHHHHHHccCCC
Confidence            467777777764   367777776643


No 122
>KOG4377|consensus
Probab=56.30  E-value=5.1  Score=34.20  Aligned_cols=102  Identities=19%  Similarity=0.429  Sum_probs=61.9

Q ss_pred             ccC--CCCCcccCCHHHHHHHHHhhcCC-------------Cccc--CcchhccCCchHHHhHHhhcCCC--------ce
Q psy6546         151 YIC--HACPREFSSEATMKAHVASHNGV-------------QHAC--DQCDRTFSCMPYLRQHQKLHSGI--------TY  205 (294)
Q Consensus       151 ~~C--~~C~~~f~~~~~l~~H~~~~~~~-------------~~~C--~~C~~~f~~~~~l~~H~~~h~~~--------~~  205 (294)
                      |.|  +.|++.+..+..+.+|.+.|..+             .|.|  ..|.+   +.++...|...|+.+        -|
T Consensus       272 yhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gfrrthf  348 (480)
T KOG4377|consen  272 YHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTHF  348 (480)
T ss_pred             hcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceeccee
Confidence            555  45888888889999999888653             1455  45777   556677787777664        36


Q ss_pred             eCCCCc--cccCCHHHHHHHHHHhCCC------------------c-------ccc--ccccccccCHHHHHHHHhhhc
Q psy6546         206 SCPSCS--KSFNRKDRYRMHLKLHQGV------------------R-------HTC--KECSKEFSNEYNLKNHMVLHD  255 (294)
Q Consensus       206 ~C~~C~--~~f~~~~~l~~H~~~h~~~------------------~-------~~C--~~C~~~f~~~~~l~~H~~~h~  255 (294)
                      .|..|+  ..|.....-..|.+-+.++                  .       +.|  ..|+..+.+.+++..|.+.|.
T Consensus       349 hC~r~gCTdtfK~~khk~yh~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~shkrkhe  427 (480)
T KOG4377|consen  349 HCQRIGCTDTFKDSKHKPYHYKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQMASHKRKHE  427 (480)
T ss_pred             EEeccCCccccccccccccccCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhhhhhhhhhhh
Confidence            687766  4444322222222222211                  0       122  347777777777777777773


No 123
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=55.21  E-value=8.4  Score=25.13  Aligned_cols=14  Identities=29%  Similarity=0.650  Sum_probs=8.7

Q ss_pred             CcccCCccCccccC
Q psy6546          95 TRHPCPQCSRDFAT  108 (294)
Q Consensus        95 ~~~~C~~C~~~f~~  108 (294)
                      ..+.|..|+..|..
T Consensus        52 GIW~C~kCg~~fAG   65 (89)
T COG1997          52 GIWKCRKCGAKFAG   65 (89)
T ss_pred             CeEEcCCCCCeecc
Confidence            45667777666653


No 124
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=53.45  E-value=11  Score=35.55  Aligned_cols=10  Identities=40%  Similarity=1.012  Sum_probs=6.4

Q ss_pred             ccCCcccccc
Q psy6546         123 IYPCPECDKT  132 (294)
Q Consensus       123 ~~~C~~C~~~  132 (294)
                      |..|+.||..
T Consensus       475 p~~Cp~Cgs~  484 (730)
T COG1198         475 PQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCC
Confidence            5667777654


No 125
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=52.65  E-value=5.6  Score=19.06  Aligned_cols=7  Identities=29%  Similarity=1.127  Sum_probs=3.5

Q ss_pred             ccccccc
Q psy6546         232 HTCKECS  238 (294)
Q Consensus       232 ~~C~~C~  238 (294)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            4555554


No 126
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=52.43  E-value=4.3  Score=31.79  Aligned_cols=21  Identities=24%  Similarity=0.548  Sum_probs=10.3

Q ss_pred             cccccccccccCHHHHHHHHh
Q psy6546         232 HTCKECSKEFSNEYNLKNHMV  252 (294)
Q Consensus       232 ~~C~~C~~~f~~~~~l~~H~~  252 (294)
                      |.|..|++.|....-..+|+.
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~   98 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIF   98 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHH
T ss_pred             ECCCCCCcccCChHHHHHHHh
Confidence            555555555555555555543


No 127
>PRK04023 DNA polymerase II large subunit; Validated
Probab=49.61  E-value=21  Score=34.75  Aligned_cols=9  Identities=44%  Similarity=1.169  Sum_probs=5.1

Q ss_pred             cCCcccccc
Q psy6546         124 YPCPECDKT  132 (294)
Q Consensus       124 ~~C~~C~~~  132 (294)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            456666554


No 128
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=49.50  E-value=9.7  Score=22.74  Aligned_cols=7  Identities=43%  Similarity=0.619  Sum_probs=2.8

Q ss_pred             HHHHHHh
Q psy6546         111 ILKTHLK  117 (294)
Q Consensus       111 ~l~~H~~  117 (294)
                      .|..|+.
T Consensus        25 ~l~~H~~   31 (60)
T PF02176_consen   25 ELDDHLE   31 (60)
T ss_dssp             CHHHHHH
T ss_pred             HHHHHHH
Confidence            3334443


No 129
>KOG4167|consensus
Probab=48.46  E-value=14  Score=34.21  Aligned_cols=27  Identities=33%  Similarity=0.710  Sum_probs=24.0

Q ss_pred             CCCccCccchhccCCHHHHHHHHHHhC
Q psy6546          30 PTRHPCPQCSRDFATVKILKTHLKTHE   56 (294)
Q Consensus        30 ~~~~~C~~C~~~f~~~~~l~~H~~~~~   56 (294)
                      .--|.|.+|++.|.-...+..||+.|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            345999999999999999999999884


No 130
>PRK04023 DNA polymerase II large subunit; Validated
Probab=48.34  E-value=19  Score=34.92  Aligned_cols=11  Identities=27%  Similarity=0.912  Sum_probs=6.1

Q ss_pred             ccccccccccc
Q psy6546         232 HTCKECSKEFS  242 (294)
Q Consensus       232 ~~C~~C~~~f~  242 (294)
                      +.|+.||....
T Consensus       664 y~CPKCG~El~  674 (1121)
T PRK04023        664 DECEKCGREPT  674 (1121)
T ss_pred             CcCCCCCCCCC
Confidence            55666665443


No 131
>KOG2593|consensus
Probab=47.94  E-value=11  Score=32.60  Aligned_cols=11  Identities=45%  Similarity=1.280  Sum_probs=5.4

Q ss_pred             ccCCccCccch
Q psy6546          59 IYPCPECDKTF   69 (294)
Q Consensus        59 ~~~c~~c~~~~   69 (294)
                      .|.|+.|.++|
T Consensus       128 ~Y~Cp~C~kky  138 (436)
T KOG2593|consen  128 GYVCPNCQKKY  138 (436)
T ss_pred             cccCCccccch
Confidence            34455555544


No 132
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=47.74  E-value=17  Score=28.63  Aligned_cols=26  Identities=27%  Similarity=0.572  Sum_probs=20.5

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCC
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQG  229 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~  229 (294)
                      .|.|+.|+|.|.-...+.+|+..-|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            69999999999999999999987554


No 133
>KOG2807|consensus
Probab=46.41  E-value=26  Score=29.22  Aligned_cols=17  Identities=24%  Similarity=0.581  Sum_probs=8.7

Q ss_pred             ceeCCCCccccCCHHHH
Q psy6546         204 TYSCPSCSKSFNRKDRY  220 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l  220 (294)
                      |-.|+.|+-...+.-+|
T Consensus       290 P~eCpiC~ltLVss~hL  306 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHL  306 (378)
T ss_pred             CccCCccceeEecchHH
Confidence            44555555555544444


No 134
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=45.60  E-value=3  Score=26.32  Aligned_cols=18  Identities=22%  Similarity=0.532  Sum_probs=9.3

Q ss_pred             cccccc--cccccccchhhh
Q psy6546         257 RAYVCE--LCARQFTRVDHF  274 (294)
Q Consensus       257 ~~~~C~--~C~~~f~~~~~l  274 (294)
                      .-++|.  .||..|.....+
T Consensus        26 ~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         26 RYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             eeeecCCCCCCCEEEEEEEE
Confidence            334554  566666554443


No 135
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=45.00  E-value=14  Score=20.16  Aligned_cols=13  Identities=15%  Similarity=0.542  Sum_probs=8.6

Q ss_pred             CcccCCccCcccc
Q psy6546          95 TRHPCPQCSRDFA  107 (294)
Q Consensus        95 ~~~~C~~C~~~f~  107 (294)
                      .-|.|..|+..|.
T Consensus        27 ~fy~C~~C~~~w~   39 (40)
T smart00440       27 VFYVCTKCGHRWR   39 (40)
T ss_pred             EEEEeCCCCCEeC
Confidence            4477777776654


No 136
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=44.75  E-value=8.3  Score=20.96  Aligned_cols=12  Identities=17%  Similarity=0.456  Sum_probs=8.5

Q ss_pred             CcccCCccCccc
Q psy6546          95 TRHPCPQCSRDF  106 (294)
Q Consensus        95 ~~~~C~~C~~~f  106 (294)
                      .-|.|..|+..|
T Consensus        27 ~fy~C~~C~~~w   38 (39)
T PF01096_consen   27 LFYVCCNCGHRW   38 (39)
T ss_dssp             EEEEESSSTEEE
T ss_pred             EEEEeCCCCCee
Confidence            447788888765


No 137
>KOG1701|consensus
Probab=44.71  E-value=5.2  Score=34.40  Aligned_cols=11  Identities=36%  Similarity=0.875  Sum_probs=8.6

Q ss_pred             ccccccccccc
Q psy6546         259 YVCELCARQFT  269 (294)
Q Consensus       259 ~~C~~C~~~f~  269 (294)
                      |+|+.|+...+
T Consensus       428 Y~CEDCg~~LS  438 (468)
T KOG1701|consen  428 YKCEDCGLLLS  438 (468)
T ss_pred             eehhhcCcccc
Confidence            78888887766


No 138
>KOG2272|consensus
Probab=43.65  E-value=18  Score=28.89  Aligned_cols=15  Identities=20%  Similarity=0.654  Sum_probs=8.1

Q ss_pred             ccCCcccccccCChH
Q psy6546         123 IYPCPECDKTFLSTS  137 (294)
Q Consensus       123 ~~~C~~C~~~f~~~~  137 (294)
                      -|.|.+|.+...+..
T Consensus        99 CF~Cd~Cn~~Lad~g  113 (332)
T KOG2272|consen   99 CFRCDLCNKHLADQG  113 (332)
T ss_pred             cchhHHHHHHHhhhh
Confidence            456666665544443


No 139
>COG1773 Rubredoxin [Energy production and conversion]
Probab=43.51  E-value=21  Score=21.19  Aligned_cols=9  Identities=33%  Similarity=1.029  Sum_probs=5.3

Q ss_pred             cccCCccCc
Q psy6546          96 RHPCPQCSR  104 (294)
Q Consensus        96 ~~~C~~C~~  104 (294)
                      -..|+.|+.
T Consensus        36 ~w~CP~Cg~   44 (55)
T COG1773          36 DWVCPECGV   44 (55)
T ss_pred             ccCCCCCCC
Confidence            356677764


No 140
>KOG2071|consensus
Probab=41.86  E-value=22  Score=32.23  Aligned_cols=31  Identities=16%  Similarity=0.401  Sum_probs=25.9

Q ss_pred             CCCCCCccCccchhccCCHHHHHHHHHHhCC
Q psy6546          27 STTPTRHPCPQCSRDFATVKILKTHLKTHEG   57 (294)
Q Consensus        27 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~   57 (294)
                      -....+-+|..||..|........||..|..
T Consensus       413 Ly~~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  413 LYKDSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             hccCCcchhcccccccccchhhhhHhhhhhh
Confidence            3456678999999999999999999888754


No 141
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=39.84  E-value=16  Score=26.08  Aligned_cols=12  Identities=25%  Similarity=0.858  Sum_probs=5.3

Q ss_pred             eeCCCCccccCC
Q psy6546         205 YSCPSCSKSFNR  216 (294)
Q Consensus       205 ~~C~~C~~~f~~  216 (294)
                      ++|..||+.|..
T Consensus         2 H~Ct~Cg~~f~d   13 (131)
T PF09845_consen    2 HQCTKCGRVFED   13 (131)
T ss_pred             cccCcCCCCcCC
Confidence            344444444443


No 142
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=39.76  E-value=13  Score=27.15  Aligned_cols=33  Identities=27%  Similarity=0.713  Sum_probs=18.7

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCCcccccccccc
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGVRHTCKECSKE  240 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~  240 (294)
                      +|.|. |+..+.+.   ++|-..-.|+.|.|..|+..
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~~YrC~~C~gk  149 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGEVYRCGKCGGK  149 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccceEEeccCCce
Confidence            67777 77665543   33433444445777777644


No 143
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=39.16  E-value=21  Score=25.83  Aligned_cols=13  Identities=15%  Similarity=0.644  Sum_probs=6.4

Q ss_pred             cccCCccCccccC
Q psy6546          96 RHPCPQCSRDFAT  108 (294)
Q Consensus        96 ~~~C~~C~~~f~~  108 (294)
                      .+.|..||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            3455555555443


No 144
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=38.80  E-value=23  Score=19.92  Aligned_cols=9  Identities=33%  Similarity=0.984  Sum_probs=4.6

Q ss_pred             ccccccccc
Q psy6546         257 RAYVCELCA  265 (294)
Q Consensus       257 ~~~~C~~C~  265 (294)
                      ..|+|..|+
T Consensus        36 ~~~~C~~C~   44 (46)
T PF12760_consen   36 GRYRCKACR   44 (46)
T ss_pred             CeEECCCCC
Confidence            445555554


No 145
>KOG4377|consensus
Probab=38.47  E-value=18  Score=31.11  Aligned_cols=79  Identities=19%  Similarity=0.307  Sum_probs=47.2

Q ss_pred             eeC--CCCccccCCHHHHHHHHHHhCCCc-------------ccc--ccccccccCHHHHHHHHhhhcc--------ccc
Q psy6546         205 YSC--PSCSKSFNRKDRYRMHLKLHQGVR-------------HTC--KECSKEFSNEYNLKNHMVLHDV--------RAY  259 (294)
Q Consensus       205 ~~C--~~C~~~f~~~~~l~~H~~~h~~~~-------------~~C--~~C~~~f~~~~~l~~H~~~h~~--------~~~  259 (294)
                      |.|  +.|++.+..+..+.+|..+|..+.             |.|  ..|.+   +-+....|...|.+        .-|
T Consensus       272 yhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gfrrthf  348 (480)
T KOG4377|consen  272 YHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTHF  348 (480)
T ss_pred             hcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceeccee
Confidence            555  568888877888888888875421             455  34666   44555667666632        236


Q ss_pred             ccccccccccchhhhhhhhhhccCccccc
Q psy6546         260 VCELCARQFTRVDHFNHHRRLQHDPEEFE  288 (294)
Q Consensus       260 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~  288 (294)
                      -|--|+-.++.+  ...|...|-.+..++
T Consensus       349 hC~r~gCTdtfK--~~khk~yh~kdda~~  375 (480)
T KOG4377|consen  349 HCQRIGCTDTFK--DSKHKPYHYKDDAGE  375 (480)
T ss_pred             EEeccCCccccc--cccccccccCcchhh
Confidence            676666333333  556665555554444


No 146
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=37.51  E-value=18  Score=20.88  Aligned_cols=12  Identities=50%  Similarity=0.999  Sum_probs=5.9

Q ss_pred             cccccccccccC
Q psy6546         232 HTCKECSKEFSN  243 (294)
Q Consensus       232 ~~C~~C~~~f~~  243 (294)
                      +.|..||..|.-
T Consensus         5 l~C~dCg~~Fvf   16 (49)
T PF13451_consen    5 LTCKDCGAEFVF   16 (49)
T ss_pred             EEcccCCCeEEE
Confidence            445555554443


No 147
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=36.20  E-value=24  Score=23.78  Aligned_cols=12  Identities=25%  Similarity=0.844  Sum_probs=6.2

Q ss_pred             eeCCCCccccCC
Q psy6546         205 YSCPSCSKSFNR  216 (294)
Q Consensus       205 ~~C~~C~~~f~~  216 (294)
                      ++|..||..|.+
T Consensus         3 H~CtrCG~vf~~   14 (112)
T COG3364           3 HQCTRCGEVFDD   14 (112)
T ss_pred             ceeccccccccc
Confidence            445555555544


No 148
>KOG2593|consensus
Probab=34.35  E-value=24  Score=30.70  Aligned_cols=39  Identities=21%  Similarity=0.600  Sum_probs=21.3

Q ss_pred             CCCCCcccCCccCccccChHHHHHHHhhccCcccCCccccc
Q psy6546          91 STTLTRHPCPQCSRDFATVKILKTHLKTHEGIIYPCPECDK  131 (294)
Q Consensus        91 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~C~~C~~  131 (294)
                      ......|.|+.|.+.|.....+..-  .-....|.|..|+.
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea~~L~--~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEALQLL--DNETGEFHCENCGG  161 (436)
T ss_pred             ccccccccCCccccchhhhHHHHhh--cccCceEEEecCCC
Confidence            3444557777777777665554321  11122467777764


No 149
>KOG3408|consensus
Probab=34.20  E-value=26  Score=24.52  Aligned_cols=29  Identities=38%  Similarity=0.547  Sum_probs=23.6

Q ss_pred             CCCCCcccCCccCccccChHHHHHHHhhc
Q psy6546          91 STTLTRHPCPQCSRDFATVKILKTHLKTH  119 (294)
Q Consensus        91 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  119 (294)
                      -++...|.|-.|.+-|.+...|..|.++-
T Consensus        52 lPG~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   52 LPGGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCCCceeehhhhhhhhcchHHHHHHHhcc
Confidence            35667789999999999999999987653


No 150
>PF14369 zf-RING_3:  zinc-finger
Probab=33.97  E-value=19  Score=19.05  Aligned_cols=11  Identities=36%  Similarity=0.546  Sum_probs=4.9

Q ss_pred             ccCccchhccC
Q psy6546          33 HPCPQCSRDFA   43 (294)
Q Consensus        33 ~~C~~C~~~f~   43 (294)
                      |.|-.|.+..+
T Consensus         3 ywCh~C~~~V~   13 (35)
T PF14369_consen    3 YWCHQCNRFVR   13 (35)
T ss_pred             EeCccCCCEeE
Confidence            44444444433


No 151
>KOG2907|consensus
Probab=33.59  E-value=27  Score=24.08  Aligned_cols=11  Identities=45%  Similarity=1.120  Sum_probs=5.6

Q ss_pred             ccccccccccc
Q psy6546         259 YVCELCARQFT  269 (294)
Q Consensus       259 ~~C~~C~~~f~  269 (294)
                      |-|+.|++.|+
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            45555555544


No 152
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=31.40  E-value=13  Score=34.99  Aligned_cols=12  Identities=17%  Similarity=0.420  Sum_probs=8.5

Q ss_pred             cccccccccccc
Q psy6546         256 VRAYVCELCARQ  267 (294)
Q Consensus       256 ~~~~~C~~C~~~  267 (294)
                      ..|..|+.||-.
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            457778888764


No 153
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=31.24  E-value=37  Score=18.50  Aligned_cols=19  Identities=21%  Similarity=0.443  Sum_probs=12.4

Q ss_pred             ceeCCCCccccCCHHHHHH
Q psy6546         204 TYSCPSCSKSFNRKDRYRM  222 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~  222 (294)
                      -+.|+.|+-.+.....|.+
T Consensus        19 id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEECCCCCeEEccHHHHHH
Confidence            4567777777766666654


No 154
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=30.78  E-value=34  Score=18.27  Aligned_cols=15  Identities=20%  Similarity=0.567  Sum_probs=9.6

Q ss_pred             cccCCCCCcccCCcc
Q psy6546          88 SRMSTTLTRHPCPQC  102 (294)
Q Consensus        88 ~~~~~~~~~~~C~~C  102 (294)
                      .....+...|.|..|
T Consensus        21 G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   21 GKSPSGHQRYRCKDC   35 (36)
T ss_pred             CCCCCCCEeEecCcC
Confidence            344556667777776


No 155
>PRK12496 hypothetical protein; Provisional
Probab=30.59  E-value=13  Score=27.85  Aligned_cols=10  Identities=30%  Similarity=0.939  Sum_probs=5.2

Q ss_pred             eeCCCCcccc
Q psy6546         205 YSCPSCSKSF  214 (294)
Q Consensus       205 ~~C~~C~~~f  214 (294)
                      |.|.-|++.|
T Consensus       128 ~~C~gC~~~~  137 (164)
T PRK12496        128 KVCKGCKKKY  137 (164)
T ss_pred             EECCCCCccc
Confidence            4455555554


No 156
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=30.29  E-value=24  Score=20.87  Aligned_cols=9  Identities=33%  Similarity=1.276  Sum_probs=3.9

Q ss_pred             cCCccCccc
Q psy6546          98 PCPQCSRDF  106 (294)
Q Consensus        98 ~C~~C~~~f  106 (294)
                      .|+.|+..+
T Consensus         4 ~CP~CG~~i   12 (54)
T TIGR01206         4 ECPDCGAEI   12 (54)
T ss_pred             CCCCCCCEE
Confidence            444444433


No 157
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=30.06  E-value=34  Score=26.47  Aligned_cols=48  Identities=21%  Similarity=0.327  Sum_probs=24.4

Q ss_pred             cccccccCHHHHHHHHhhhccccccccc----ccccccchhhhhhhhhhccCcc
Q psy6546         236 ECSKEFSNEYNLKNHMVLHDVRAYVCEL----CARQFTRVDHFNHHRRLQHDPE  285 (294)
Q Consensus       236 ~C~~~f~~~~~l~~H~~~h~~~~~~C~~----C~~~f~~~~~l~~H~~~~h~~~  285 (294)
                      .|...+. ......|...-.-+||.|+.    |+..= ....|..|....|...
T Consensus        23 GC~~~~~-~~~~~~HE~~C~~~p~~CP~~~~~C~~~G-~~~~l~~Hl~~~H~~~   74 (198)
T PF03145_consen   23 GCTETFP-YSEKREHEEECPFRPCSCPFPGSGCDWQG-SYKELLDHLRDKHSWN   74 (198)
T ss_dssp             T---EE--GGGHHHHHHT-TTSEEE-SSSSTT---EE-ECCCHHHHHHHHTTTS
T ss_pred             CCccccc-ccChhhHhccCCCcCCcCCCCCCCccccC-CHHHHHHHHHHHCCCc
Confidence            4655533 34556677666677777766    65542 3456778877777664


No 158
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=30.05  E-value=54  Score=27.17  Aligned_cols=26  Identities=23%  Similarity=0.326  Sum_probs=15.1

Q ss_pred             CCcccCCccCccccChHHHHHHHhhc
Q psy6546          94 LTRHPCPQCSRDFATVKILKTHLKTH  119 (294)
Q Consensus        94 ~~~~~C~~C~~~f~~~~~l~~H~~~~  119 (294)
                      ...|+|+.|...|-.......|...|
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHh
Confidence            34566666666666666555555444


No 159
>KOG3408|consensus
Probab=30.00  E-value=29  Score=24.26  Aligned_cols=21  Identities=33%  Similarity=0.670  Sum_probs=17.2

Q ss_pred             cccccccccccCHHHHHHHHh
Q psy6546         232 HTCKECSKEFSNEYNLKNHMV  252 (294)
Q Consensus       232 ~~C~~C~~~f~~~~~l~~H~~  252 (294)
                      |.|-.|.+-|.+...|..|.+
T Consensus        58 fyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   58 FYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             eehhhhhhhhcchHHHHHHHh
Confidence            788888888888888888854


No 160
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=29.27  E-value=48  Score=29.50  Aligned_cols=25  Identities=28%  Similarity=0.640  Sum_probs=22.3

Q ss_pred             CceeCCCCccccCCHHHHHHHHHHh
Q psy6546         203 ITYSCPSCSKSFNRKDRYRMHLKLH  227 (294)
Q Consensus       203 ~~~~C~~C~~~f~~~~~l~~H~~~h  227 (294)
                      +-|.|+.|.+.|.+...+..|+...
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~e   80 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQE   80 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHh
Confidence            4799999999999999999999753


No 161
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=29.25  E-value=28  Score=23.09  Aligned_cols=14  Identities=21%  Similarity=0.487  Sum_probs=8.6

Q ss_pred             CcccCCccCccccC
Q psy6546          95 TRHPCPQCSRDFAT  108 (294)
Q Consensus        95 ~~~~C~~C~~~f~~  108 (294)
                      ..+.|..|++.|..
T Consensus        53 GIW~C~~C~~~~AG   66 (90)
T PTZ00255         53 GIWRCKGCKKTVAG   66 (90)
T ss_pred             EEEEcCCCCCEEeC
Confidence            45667777666653


No 162
>KOG1280|consensus
Probab=28.93  E-value=64  Score=27.28  Aligned_cols=39  Identities=26%  Similarity=0.456  Sum_probs=29.1

Q ss_pred             CCCCCccCccchhccCCHHHHHHHHHHhCCc---ccCCccCc
Q psy6546          28 TTPTRHPCPQCSRDFATVKILKTHLKTHEGI---IYPCPECD   66 (294)
Q Consensus        28 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~---~~~c~~c~   66 (294)
                      ..+.-|.|++|++.=-+...|..|+...|..   ...|+.|+
T Consensus        75 y~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   75 YDPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3445799999999988999999999765544   44555554


No 163
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=28.58  E-value=17  Score=24.07  Aligned_cols=13  Identities=31%  Similarity=0.820  Sum_probs=8.6

Q ss_pred             CcccCCccCcccc
Q psy6546          95 TRHPCPQCSRDFA  107 (294)
Q Consensus        95 ~~~~C~~C~~~f~  107 (294)
                      ..+.|..|++.|.
T Consensus        52 GIW~C~~C~~~~A   64 (90)
T PF01780_consen   52 GIWKCKKCGKKFA   64 (90)
T ss_dssp             TEEEETTTTEEEE
T ss_pred             EEeecCCCCCEEe
Confidence            3467777777664


No 164
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=28.57  E-value=34  Score=20.22  Aligned_cols=10  Identities=30%  Similarity=1.089  Sum_probs=5.6

Q ss_pred             ccCCccCccc
Q psy6546          97 HPCPQCSRDF  106 (294)
Q Consensus        97 ~~C~~C~~~f  106 (294)
                      ..|+.|+..+
T Consensus        22 VvCp~Cgapy   31 (54)
T PF14446_consen   22 VVCPECGAPY   31 (54)
T ss_pred             EECCCCCCcc
Confidence            4566666554


No 165
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=28.03  E-value=6  Score=32.83  Aligned_cols=10  Identities=30%  Similarity=0.826  Sum_probs=4.3

Q ss_pred             ccCCCCCccc
Q psy6546         151 YICHACPREF  160 (294)
Q Consensus       151 ~~C~~C~~~f  160 (294)
                      ..|..|+...
T Consensus       198 L~Cs~C~t~W  207 (290)
T PF04216_consen  198 LHCSLCGTEW  207 (290)
T ss_dssp             EEETTT--EE
T ss_pred             EEcCCCCCee
Confidence            4555665554


No 166
>KOG4727|consensus
Probab=28.01  E-value=26  Score=26.16  Aligned_cols=22  Identities=23%  Similarity=0.516  Sum_probs=17.5

Q ss_pred             cccccccccccccchhhhhhhh
Q psy6546         257 RAYVCELCARQFTRVDHFNHHR  278 (294)
Q Consensus       257 ~~~~C~~C~~~f~~~~~l~~H~  278 (294)
                      .-|.|.+|+-.|.+.-++..|+
T Consensus        74 ~GyyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             CceeeeecceeehhhHHHHHHh
Confidence            4588888888888888888876


No 167
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=27.40  E-value=29  Score=23.06  Aligned_cols=14  Identities=29%  Similarity=0.667  Sum_probs=8.4

Q ss_pred             CcccCCccCccccC
Q psy6546          95 TRHPCPQCSRDFAT  108 (294)
Q Consensus        95 ~~~~C~~C~~~f~~  108 (294)
                      ..+.|..|++.|..
T Consensus        52 GIW~C~~C~~~~AG   65 (91)
T TIGR00280        52 GIWTCRKCGAKFAG   65 (91)
T ss_pred             EEEEcCCCCCEEeC
Confidence            34567777666543


No 168
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=27.28  E-value=25  Score=20.36  Aligned_cols=10  Identities=30%  Similarity=0.830  Sum_probs=5.9

Q ss_pred             cccccccccc
Q psy6546         231 RHTCKECSKE  240 (294)
Q Consensus       231 ~~~C~~C~~~  240 (294)
                      ++.|..||..
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            4666666654


No 169
>PRK04351 hypothetical protein; Provisional
Probab=27.11  E-value=31  Score=25.39  Aligned_cols=31  Identities=29%  Similarity=0.724  Sum_probs=14.6

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCCccccccccccc
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGVRHTCKECSKEF  241 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f  241 (294)
                      .|.|..|+..+.+.       +.+...+|.|..|+-.+
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~n~~~yrCg~C~g~L  142 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRINTKRYRCGKCRGKL  142 (149)
T ss_pred             EEECCCCCCEeeee-------eecCCCcEEeCCCCcEe
Confidence            45665566444321       12223336666665444


No 170
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=26.94  E-value=23  Score=20.73  Aligned_cols=14  Identities=29%  Similarity=0.672  Sum_probs=7.7

Q ss_pred             cCccchhccCCHHH
Q psy6546          34 PCPQCSRDFATVKI   47 (294)
Q Consensus        34 ~C~~C~~~f~~~~~   47 (294)
                      .||.|++.|.....
T Consensus        22 ~CPlC~r~l~~e~~   35 (54)
T PF04423_consen   22 CCPLCGRPLDEEHR   35 (54)
T ss_dssp             E-TTT--EE-HHHH
T ss_pred             cCCCCCCCCCHHHH
Confidence            89999999975543


No 171
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=26.61  E-value=38  Score=18.36  Aligned_cols=14  Identities=21%  Similarity=0.726  Sum_probs=11.5

Q ss_pred             ceeCCCCccccCCH
Q psy6546         204 TYSCPSCSKSFNRK  217 (294)
Q Consensus       204 ~~~C~~C~~~f~~~  217 (294)
                      |+.|..|+..|-.+
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899999988753


No 172
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=26.51  E-value=26  Score=19.37  Aligned_cols=13  Identities=38%  Similarity=0.994  Sum_probs=10.0

Q ss_pred             ccccccccccchh
Q psy6546         260 VCELCARQFTRVD  272 (294)
Q Consensus       260 ~C~~C~~~f~~~~  272 (294)
                      .|++|+..|+...
T Consensus        10 ~C~~C~rpf~WRK   22 (42)
T PF10013_consen   10 ICPVCGRPFTWRK   22 (42)
T ss_pred             cCcccCCcchHHH
Confidence            5888888887654


No 173
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=26.47  E-value=30  Score=32.33  Aligned_cols=83  Identities=17%  Similarity=0.397  Sum_probs=50.0

Q ss_pred             CCCccCccchhccCCHHHHHHHHHHhCCcc-cCCccCccchhccccCCCCCCCccchhhcccCCCCCcccCCccCccccC
Q psy6546          30 PTRHPCPQCSRDFATVKILKTHLKTHEGII-YPCPECDKTFLSTLTGTPQGARGRAVYLSRMSTTLTRHPCPQCSRDFAT  108 (294)
Q Consensus        30 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~-~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~  108 (294)
                      +..-.|+.|-+.+.+..+-+-+      .| ..|..||-.|+....         +.+-+...+-..--.|+.|.+.|.+
T Consensus        99 pD~a~C~~Cl~Ei~dp~~rrY~------YPF~~CT~CGPRfTIi~a---------lPYDR~nTsM~~F~lC~~C~~EY~d  163 (750)
T COG0068          99 PDAATCEDCLEEIFDPNSRRYL------YPFINCTNCGPRFTIIEA---------LPYDRENTSMADFPLCPFCDKEYKD  163 (750)
T ss_pred             CchhhhHHHHHHhcCCCCccee------ccccccCCCCcceeeecc---------CCCCcccCccccCcCCHHHHHHhcC
Confidence            3346799998777665443321      12 358999998876552         2222222222233369999999888


Q ss_pred             hHHHHHHHhhccCcccCCcccccc
Q psy6546         109 VKILKTHLKTHEGIIYPCPECDKT  132 (294)
Q Consensus       109 ~~~l~~H~~~~~~~~~~C~~C~~~  132 (294)
                      ..+=    +.|. .|..|+.||-.
T Consensus       164 P~nR----RfHA-Qp~aCp~CGP~  182 (750)
T COG0068         164 PLNR----RFHA-QPIACPKCGPH  182 (750)
T ss_pred             cccc----cccc-ccccCcccCCC
Confidence            7752    2222 36789999853


No 174
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=25.85  E-value=82  Score=23.58  Aligned_cols=17  Identities=29%  Similarity=0.905  Sum_probs=9.3

Q ss_pred             ceeCCCCccccCCHHHH
Q psy6546         204 TYSCPSCSKSFNRKDRY  220 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l  220 (294)
                      -|.|+.|++.|-.-+++
T Consensus       130 f~~C~~CgkiYW~GsHw  146 (165)
T COG1656         130 FYRCPKCGKIYWKGSHW  146 (165)
T ss_pred             eeECCCCcccccCchHH
Confidence            45566666666554443


No 175
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=25.82  E-value=91  Score=23.73  Aligned_cols=13  Identities=31%  Similarity=0.958  Sum_probs=7.2

Q ss_pred             ceeCCCCccccCC
Q psy6546         204 TYSCPSCSKSFNR  216 (294)
Q Consensus       204 ~~~C~~C~~~f~~  216 (294)
                      .|.|+.|...++-
T Consensus       113 ~y~C~~~~~r~sf  125 (176)
T COG1675         113 YYVCPNCHVKYSF  125 (176)
T ss_pred             ceeCCCCCCcccH
Confidence            4666666555443


No 176
>KOG1280|consensus
Probab=25.64  E-value=61  Score=27.36  Aligned_cols=21  Identities=19%  Similarity=0.482  Sum_probs=10.4

Q ss_pred             cCCcccccccCChHhHHHHHh
Q psy6546         124 YPCPECDKTFLSTSGLREHRK  144 (294)
Q Consensus       124 ~~C~~C~~~f~~~~~l~~H~~  144 (294)
                      |.|++|+..-.+...|..|..
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~  100 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVL  100 (381)
T ss_pred             ccCCcccccccchhHHHHHhh
Confidence            455555554444455555543


No 177
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=25.47  E-value=26  Score=24.50  Aligned_cols=12  Identities=25%  Similarity=0.733  Sum_probs=6.3

Q ss_pred             eeCCCCccccCC
Q psy6546         205 YSCPSCSKSFNR  216 (294)
Q Consensus       205 ~~C~~C~~~f~~  216 (294)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            455555555443


No 178
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=25.39  E-value=25  Score=24.48  Aligned_cols=10  Identities=30%  Similarity=0.527  Sum_probs=4.6

Q ss_pred             eeCCCCcccc
Q psy6546         205 YSCPSCSKSF  214 (294)
Q Consensus       205 ~~C~~C~~~f  214 (294)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4444444444


No 179
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=25.03  E-value=16  Score=21.26  Aligned_cols=23  Identities=26%  Similarity=0.593  Sum_probs=9.6

Q ss_pred             cccccccccccCHHHHHHHHhhh
Q psy6546         232 HTCKECSKEFSNEYNLKNHMVLH  254 (294)
Q Consensus       232 ~~C~~C~~~f~~~~~l~~H~~~h  254 (294)
                      |+|+.|+..|=..-.+..|..+|
T Consensus        22 y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   22 YRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             E--TTTT--B-HHHHHTTTTTS-
T ss_pred             EECCCCCCccccCcChhhhcccc
Confidence            66666666665555555554444


No 180
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=24.82  E-value=22  Score=24.79  Aligned_cols=12  Identities=25%  Similarity=0.789  Sum_probs=5.5

Q ss_pred             eeCCCCccccCC
Q psy6546         205 YSCPSCSKSFNR  216 (294)
Q Consensus       205 ~~C~~C~~~f~~  216 (294)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            445555555543


No 181
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=24.36  E-value=34  Score=22.69  Aligned_cols=14  Identities=29%  Similarity=0.653  Sum_probs=8.8

Q ss_pred             CcccCCccCccccC
Q psy6546          95 TRHPCPQCSRDFAT  108 (294)
Q Consensus        95 ~~~~C~~C~~~f~~  108 (294)
                      ..+.|..|++.|..
T Consensus        53 GIW~C~~C~~~~AG   66 (90)
T PRK03976         53 GIWECRKCGAKFAG   66 (90)
T ss_pred             EEEEcCCCCCEEeC
Confidence            44667777776653


No 182
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=24.11  E-value=20  Score=26.39  Aligned_cols=31  Identities=29%  Similarity=0.853  Sum_probs=16.7

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCCccccccccccc
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGVRHTCKECSKEF  241 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f  241 (294)
                      .|.|..|+..+....      +. ....|.|..|+..+
T Consensus       123 ~~~C~~C~~~~~r~~------~~-~~~~~~C~~C~~~l  153 (157)
T PF10263_consen  123 VYRCPSCGREYKRHR------RS-KRKRYRCGRCGGPL  153 (157)
T ss_pred             EEEcCCCCCEeeeec------cc-chhhEECCCCCCEE
Confidence            577777776653322      22 11226777776544


No 183
>PF12773 DZR:  Double zinc ribbon
Probab=24.02  E-value=45  Score=18.96  Aligned_cols=6  Identities=33%  Similarity=1.237  Sum_probs=2.4

Q ss_pred             ccCcch
Q psy6546         179 ACDQCD  184 (294)
Q Consensus       179 ~C~~C~  184 (294)
                      .|+.|+
T Consensus        31 ~C~~Cg   36 (50)
T PF12773_consen   31 ICPNCG   36 (50)
T ss_pred             CCcCCc
Confidence            344443


No 184
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=23.84  E-value=19  Score=21.38  Aligned_cols=8  Identities=50%  Similarity=1.298  Sum_probs=3.5

Q ss_pred             ccCCcccc
Q psy6546         123 IYPCPECD  130 (294)
Q Consensus       123 ~~~C~~C~  130 (294)
                      .|.|..|.
T Consensus        31 tYmC~eC~   38 (56)
T PF09963_consen   31 TYMCDECK   38 (56)
T ss_pred             ceeChhHH
Confidence            34444443


No 185
>COG2879 Uncharacterized small protein [Function unknown]
Probab=23.72  E-value=45  Score=20.29  Aligned_cols=21  Identities=19%  Similarity=0.270  Sum_probs=16.1

Q ss_pred             cccchhhhhhhhhhccCcccc
Q psy6546         267 QFTRVDHFNHHRRLQHDPEEF  287 (294)
Q Consensus       267 ~f~~~~~l~~H~~~~h~~~~~  287 (294)
                      +..+..+...|++.+|+++|.
T Consensus        21 GvpdYdnYVehmr~~hPd~p~   41 (65)
T COG2879          21 GVPDYDNYVEHMRKKHPDKPP   41 (65)
T ss_pred             CCCcHHHHHHHHHHhCcCCCc
Confidence            345667888999999988864


No 186
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=23.57  E-value=39  Score=16.91  Aligned_cols=9  Identities=33%  Similarity=0.999  Sum_probs=4.8

Q ss_pred             ccccccccc
Q psy6546         260 VCELCARQF  268 (294)
Q Consensus       260 ~C~~C~~~f  268 (294)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            355555555


No 187
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=23.53  E-value=43  Score=20.60  Aligned_cols=8  Identities=38%  Similarity=1.165  Sum_probs=1.6

Q ss_pred             cCcchhcc
Q psy6546         180 CDQCDRTF  187 (294)
Q Consensus       180 C~~C~~~f  187 (294)
                      |..|++.|
T Consensus        12 C~~C~~~F   19 (69)
T PF01363_consen   12 CMICGKKF   19 (69)
T ss_dssp             -TTT--B-
T ss_pred             CcCcCCcC
Confidence            33444444


No 188
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=23.51  E-value=50  Score=24.17  Aligned_cols=12  Identities=33%  Similarity=1.118  Sum_probs=5.9

Q ss_pred             cCCcccccccCC
Q psy6546         124 YPCPECDKTFLS  135 (294)
Q Consensus       124 ~~C~~C~~~f~~  135 (294)
                      +.|+.|++.|..
T Consensus       125 ~~C~~C~kiyW~  136 (147)
T PF01927_consen  125 WRCPGCGKIYWE  136 (147)
T ss_pred             EECCCCCCEecc
Confidence            445555555443


No 189
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=23.09  E-value=37  Score=18.74  Aligned_cols=14  Identities=21%  Similarity=0.524  Sum_probs=7.5

Q ss_pred             CCcccCCccCcccc
Q psy6546          94 LTRHPCPQCSRDFA  107 (294)
Q Consensus        94 ~~~~~C~~C~~~f~  107 (294)
                      ...+.|..||....
T Consensus        17 ~g~~vC~~CG~Vl~   30 (43)
T PF08271_consen   17 RGELVCPNCGLVLE   30 (43)
T ss_dssp             TTEEEETTT-BBEE
T ss_pred             CCeEECCCCCCEee
Confidence            34456777766543


No 190
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=22.76  E-value=70  Score=19.00  Aligned_cols=18  Identities=17%  Similarity=0.438  Sum_probs=13.1

Q ss_pred             CCCCCccCccchhccCCH
Q psy6546          28 TTPTRHPCPQCSRDFATV   45 (294)
Q Consensus        28 ~~~~~~~C~~C~~~f~~~   45 (294)
                      .....|.|+.||..+-..
T Consensus        10 ~~~v~~~Cp~cGipthcS   27 (55)
T PF13824_consen   10 PAHVNFECPDCGIPTHCS   27 (55)
T ss_pred             ccccCCcCCCCCCcCccC
Confidence            345678999999887544


No 191
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=22.56  E-value=55  Score=23.97  Aligned_cols=16  Identities=25%  Similarity=0.629  Sum_probs=10.1

Q ss_pred             ccCCccCccccChHHH
Q psy6546          97 HPCPQCSRDFATVKIL  112 (294)
Q Consensus        97 ~~C~~C~~~f~~~~~l  112 (294)
                      -.|..|++.|++...+
T Consensus        29 ReC~~C~~RFTTyErv   44 (147)
T TIGR00244        29 RECLECHERFTTFERA   44 (147)
T ss_pred             ccCCccCCccceeeec
Confidence            3577777777765543


No 192
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=21.72  E-value=23  Score=33.03  Aligned_cols=57  Identities=16%  Similarity=0.414  Sum_probs=29.8

Q ss_pred             cCCCCCcccCCHHHHHHHHHhhcCCCc-ccCcchhccCCchHHHhHHhhcCCCceeCCCCccc
Q psy6546         152 ICHACPREFSSEATMKAHVASHNGVQH-ACDQCDRTFSCMPYLRQHQKLHSGITYSCPSCSKS  213 (294)
Q Consensus       152 ~C~~C~~~f~~~~~l~~H~~~~~~~~~-~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~  213 (294)
                      .|..||-.|.....|-.-....+-..| .|+.|.+.+....+     |..+..|.-|+.||-.
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~n-----RRfHAQp~aCp~CGP~  182 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLN-----RRFHAQPIACPKCGPH  182 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccc-----cccccccccCcccCCC
Confidence            466666666544333222111111123 57888777666544     2223347778888853


No 193
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=20.93  E-value=42  Score=18.58  Aligned_cols=13  Identities=38%  Similarity=0.930  Sum_probs=8.5

Q ss_pred             ceeCCCCccccCC
Q psy6546         204 TYSCPSCSKSFNR  216 (294)
Q Consensus       204 ~~~C~~C~~~f~~  216 (294)
                      |+.|+.|+..|-.
T Consensus        13 ~~~C~~C~~~FC~   25 (43)
T PF01428_consen   13 PFKCKHCGKSFCL   25 (43)
T ss_dssp             HEE-TTTS-EE-T
T ss_pred             CeECCCCCcccCc
Confidence            7889999988865


No 194
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=20.91  E-value=37  Score=24.83  Aligned_cols=32  Identities=22%  Similarity=0.642  Sum_probs=15.4

Q ss_pred             ceeCCCCccccCCHHHHHHHHHHhCCCccccccccccc
Q psy6546         204 TYSCPSCSKSFNRKDRYRMHLKLHQGVRHTCKECSKEF  241 (294)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~f  241 (294)
                      .|.|..|+..+.+      +.+.....+|.|..|+..+
T Consensus       112 ~y~C~~C~~~~~~------~rr~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYLR------VRRSNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCce------EccccCcceEEcCCCCCEE
Confidence            5667666655431      1111111336666666544


No 195
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=20.64  E-value=97  Score=16.69  Aligned_cols=21  Identities=29%  Similarity=0.475  Sum_probs=9.3

Q ss_pred             CccCccchhccC-CH-HHHHHHH
Q psy6546          32 RHPCPQCSRDFA-TV-KILKTHL   52 (294)
Q Consensus        32 ~~~C~~C~~~f~-~~-~~l~~H~   52 (294)
                      .|-|+.|+.-|. .. ...+.|.
T Consensus         3 ryyCdyC~~~~~~d~~~~Rk~H~   25 (38)
T PF06220_consen    3 RYYCDYCKKYLTHDSPSIRKQHE   25 (38)
T ss_dssp             S-B-TTT--B-S--SHHHHHHHT
T ss_pred             CeecccccceecCCChHHHHHhh
Confidence            588999999993 33 3445564


No 196
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=20.60  E-value=95  Score=19.04  Aligned_cols=12  Identities=25%  Similarity=1.088  Sum_probs=6.4

Q ss_pred             ceeCCCCccccC
Q psy6546         204 TYSCPSCSKSFN  215 (294)
Q Consensus       204 ~~~C~~C~~~f~  215 (294)
                      .|.|+.||....
T Consensus        46 ~~~C~~Cg~~~~   57 (69)
T PF07282_consen   46 VFTCPNCGFEMD   57 (69)
T ss_pred             eEEcCCCCCEEC
Confidence            555555555543


No 197
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=20.41  E-value=62  Score=22.24  Aligned_cols=11  Identities=36%  Similarity=0.927  Sum_probs=5.3

Q ss_pred             ceeCCCCcccc
Q psy6546         204 TYSCPSCSKSF  214 (294)
Q Consensus       204 ~~~C~~C~~~f  214 (294)
                      .|.|++|+..+
T Consensus        19 ~~iCpeC~~EW   29 (109)
T TIGR00686        19 QLICPSCLYEW   29 (109)
T ss_pred             eeECccccccc
Confidence            44555555444


No 198
>KOG4124|consensus
Probab=20.41  E-value=18  Score=30.33  Aligned_cols=70  Identities=19%  Similarity=0.275  Sum_probs=39.6

Q ss_pred             CCCCccCcc--chhccCCHHHHHHHHHHhCCcccCCccCccchhccccCCCCCCCccchhhcccCCCCCcccCCccCccc
Q psy6546          29 TPTRHPCPQ--CSRDFATVKILKTHLKTHEGIIYPCPECDKTFLSTLTGTPQGARGRAVYLSRMSTTLTRHPCPQCSRDF  106 (294)
Q Consensus        29 ~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f  106 (294)
                      ..++|+|++  |.+.+.....|..|-..-+..++.-        ...         ....+.......++|+|++|.+.+
T Consensus       346 ~~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~--------~s~---------~~~ph~~~~~~nk~~r~~i~~~~~  408 (442)
T KOG4124|consen  346 VDKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITT--------PTP---------APIPHQGFVVENKPYRCEVCSKRY  408 (442)
T ss_pred             ecCCCCCCCCcchhhcccCcceeeccccCcCCCCCC--------CCC---------CCCCcceeeeccCcccChhhhhhh
Confidence            356678864  8888888777776643222111110        000         122233344567889999998887


Q ss_pred             cChHHHHHH
Q psy6546         107 ATVKILKTH  115 (294)
Q Consensus       107 ~~~~~l~~H  115 (294)
                      +....|..|
T Consensus       409 k~~~~l~~~  417 (442)
T KOG4124|consen  409 KNLNGLKYH  417 (442)
T ss_pred             ccCCCCCce
Confidence            776555433


Done!