BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6561
(223 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q5R7R7|THSD1_PONAB Thrombospondin type-1 domain-containing protein 1 OS=Pongo abelii
GN=THSD1 PE=2 SV=1
Length = 853
Score = 32.7 bits (73), Expect = 2.3, Method: Compositional matrix adjust.
Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 8/72 (11%)
Query: 33 GITVLFQYPKCILPISDKIRLFGKVPADVSSPRSPSSQ-IYITEKKVIRGQHSLQFGCDL 91
G+ V+ P C + + +F + +PRSP + I++ E + G+ F C L
Sbjct: 255 GVEVMVLPPPCTF-VQGVVTVFKE------APRSPGKRTIHLAENSLPLGERRTIFNCTL 307
Query: 92 FNEHYVEYCFVY 103
F+ +YCF +
Sbjct: 308 FDMGKNKYCFDF 319
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.317 0.130 0.389
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 78,503,439
Number of Sequences: 539616
Number of extensions: 3033704
Number of successful extensions: 7341
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 7336
Number of HSP's gapped (non-prelim): 13
length of query: 223
length of database: 191,569,459
effective HSP length: 113
effective length of query: 110
effective length of database: 130,592,851
effective search space: 14365213610
effective search space used: 14365213610
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)