Diaphorina citri psyllid: psy656

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------

MNSVHLNSCPALEASNDIDMTEKDPILYDTLDSLVQALVASFSGPAKAFYEREFEFFAQITDISGKIRPFPKGAERKRACLEELSKIKVRPGCYLPSNPEAVVLDIDYNSGTPMQSAAKAPYLARFRVKRCGINELEQMAMAICERDDDEEHDHQLVRANSKDKIMETWQAAIFKVGDDVRQDMLALQVISIFKNVFQQVGLDLYLFPYRVVATSPGCGVIECVPDAKSRDQLGRQTDIGMYEYFIKTYGDETSKEFQNARRNFVRSMAAYSVIGFLLQIKDRHNGNIMLDKAGHIIHIDFGFMFESSPGGNLGFEPDIKLTDEMVMVMGGKIEAAPFRWFMELCVQAFLAMRPYQESIISLVSLMLDTGLPCFRGQTIKLLRARFAPQATDKEAAAFMIGVIRNSFLNFRTRAYDYLQYYQNQIPC

cccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccEEEccccccccccccccccccccEEcccccccHHHHHHHHHHcccccccHHHHHHHHcccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEECcccccEEEEcccccHHHHHcccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEcccccEEEEEccccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccc

***********************DPILYDTLDSLVQALVASFSGPAKAFYEREFEFFAQITDISGKIRPFPKGAERKRACLEELSKIKVRPGCYLPSNPEAVVLDIDYNSGTPMQSAAKAPYLARFRVKRCGIN****************************DKIMETWQAAIFKVGDDVRQDMLALQVISIFKNVFQQVGLDLYLFPYRVVATSPGCGVIECVPDAKSRDQLGRQTDIGMYEYFIKTYGDETSKEFQNARRNFVRSMAAYSVIGFLLQIKDRHNGNIMLDKAGHIIHIDFGFMFESSPGGNLGFEPDIKLTDEMVMVMGGKIEAAPFRWFMELCVQAFLAMRPYQESIISLVSLMLDTGLPCFRGQTIKLLRARFAPQATDKEAAAFMIGVIRNSFLNFRTRAYDYLQYYQNQIPC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Phosphatidylinositol 4-kinase stt4	Acts on phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol 1,4,5,-trisphosphate.	confident	Q9USR3
Phosphatidylinositol 4-kinase STT4	Acts on phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol 1,4,5,-trisphosphate. STT4 functions in PKC1 protein kinase pathway.	confident	P37297
Phosphatidylinositol 4-kinase alpha	Acts on phosphatidylinositol (PtdIns) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate.	confident	O02811

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030660 [CC]	Golgi-associated vesicle membrane	probable	GO:0043229, GO:0005622, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031982, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0005794, GO:0005798, GO:0030659, GO:0012505, GO:0012506, GO:0031090, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0004430 [MF]	1-phosphatidylinositol 4-kinase activity	probable	GO:0003824, GO:0052742, GO:0016772, GO:0016301, GO:0016773, GO:0016740, GO:0003674
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0036092 [BP]	phosphatidylinositol-3-phosphate biosynthetic process	probable	GO:0006650, GO:0044249, GO:0044255, GO:0045017, GO:0044710, GO:0008150, GO:0071704, GO:0006661, GO:0006644, GO:0006629, GO:1901576, GO:0009987, GO:0009058, GO:0046488, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:0008654, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0046474
GO:0046854 [BP]	phosphatidylinositol phosphorylation	probable	GO:0044238, GO:0006644, GO:0006650, GO:0071704, GO:0016310, GO:0009987, GO:0044710, GO:0044237, GO:0046834, GO:0006796, GO:0046488, GO:0008152, GO:0006793, GO:0019637, GO:0008150, GO:0046486, GO:0030258, GO:0044255, GO:0006629
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0016303 [MF]	1-phosphatidylinositol-3-kinase activity	probable	GO:0003824, GO:0052742, GO:0016772, GO:0016301, GO:0016773, GO:0016740, GO:0003674, GO:0035004
GO:0005635 [CC]	nuclear envelope	probable	GO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0035329 [BP]	hippo signaling cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0008582 [BP]	regulation of synaptic growth at neuromuscular junction	probable	GO:0048638, GO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0048634, GO:0051128, GO:0032501, GO:0023052, GO:0051147, GO:0050789, GO:0044699, GO:0040008, GO:0060284, GO:0065007, GO:0048641, GO:0065008, GO:1901861, GO:0016202, GO:0009987, GO:0050793, GO:0050877, GO:0048742, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051963, GO:0044087, GO:0051960, GO:2000026, GO:0044763
GO:0048599 [BP]	oocyte development	probable	GO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0044699, GO:0000003, GO:0048869, GO:0007276, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0007281, GO:0022414, GO:0044763, GO:0022412, GO:0044767, GO:0044702, GO:0003006, GO:0048856, GO:0008150
GO:0042995 [CC]	cell projection	probable	GO:0005575, GO:0044464, GO:0005623
GO:0048015 [BP]	phosphatidylinositol-mediated signaling	probable	GO:0044700, GO:0051716, GO:0044699, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0048017
GO:0005942 [CC]	phosphatidylinositol 3-kinase complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.1.-	Phosphotransferases with an alcohol group as acceptor.	probable
2.7.1.67	1-phosphatidylinositol 4-kinase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WXF, chain A
Confidence level:very confident
Coverage over the Query: 23-131,165-410
View the alignment between query and template
View the model in PyMOL

Template: 2X6H, chain A
Confidence level:very confident
Coverage over the Query: 9-131,167-425
View the alignment between query and template
View the model in PyMOL