Diaphorina citri psyllid: psy6575

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MKAKQELYSFIQNVVAIKRQDHEEKELQKAKGMDENNNKIDTKDDKNKDLKINSENGNEEEFLDIEYKNTKTKSFLELLLEIDHAADDKLTDAEILPELTTLFFAALDTTATANSTILLLLAMYPEVLQKIDGLYRPERYSNISTISSALFRLSAQNLRLMAYTDQRDIVTDEIDSVFGGPDEDDGRPPTPADLHSMNYLECVIKETARLYPPAPIVFRQVDEEVPLGRHVLPAGASIMLTIAGIHRNKNYWVNPIQFIPERFHPDESVSSSHIRQRHPYAFIPFSAGPRNCIGQKYAMLQMKTVISTILRQYHLSPSPRFQTIADIDKRIRMDITLRMEDGAVIFQSRKQ
ccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHccccccHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccHHHcccccHHHHHHHHHccccccccccEEcccccEEEccEEEccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcCECccccccccccccccccccEEEEccccEEEEEEEcc
*KAKQELYSFIQNVVAIKRQDHEEKELQKAKGMDENNNKIDTK******************FL****KNTKTKSFLELLLEIDHAADDKLTDAEILPELTTLFFAALDTTATANSTILLLLAMYPEVLQKIDGLYRPERYSNISTISSALFRLSAQNLRLMAYTDQRDIVTDEIDSVFGGPDEDDGRPPTPADLHSMNYLECVIKETARLYPPAPIVFRQVDEEVPLGRHVLPAGASIMLTIAGIHRNKNYWVNPIQFIPERFHPDESVSSSHIRQRHPYAFIPFSAGPRNCIGQKYAMLQMKTVISTILRQYHLSPSPRFQTIADIDKRIRMDITLRMEDGAVIFQSRK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAKQELYSFIQNVVAIKRQDHEEKELQKAKGxxxxxxxxxxxxxxxxxxxxxSENGNEEEFLDIEYKNTKTKSFLELLLEIDHAADDKLTDAEILPELTTLFFAALDTTATANSTILLLLAMYPEVLQKIDGLYRPERYSNISTISSALFRLSAQNLRLMAYTDQRDIVTDEIDSVFGGPDEDDGRPPTPADLHSMNYLECVIKETARLYPPAPIVFRQVDEEVPLGRHVLPAGASIMLTIAGIHRNKNYWVNPIQFIPERFHPDESVSSSHIRQRHPYAFIPFSAGPRNCIGQKYAMLQMKTVISTILRQYHLSPSPRFQTIADIDKRIRMDITLRMEDGAVIFQSRKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046483 [BP]heterocycle metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0070989 [BP]oxidative demethylationprobableGO:0070988, GO:0044710, GO:0008150, GO:0008152, GO:0055114
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0016709 [MF]oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygenprobableGO:0003824, GO:0004497, GO:0016705, GO:0003674, GO:0016491
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0006725 [BP]cellular aromatic compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0043651 [BP]linoleic acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0043436, GO:0008150, GO:0019752, GO:0008152, GO:0001676, GO:0044255, GO:0033559, GO:0044281
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:1901575 [BP]organic substance catabolic processprobableGO:0008150, GO:0071704, GO:0009056, GO:0008152
GO:0048252 [BP]lauric acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0044237, GO:0008152, GO:0043436, GO:0044255, GO:0051791, GO:0044281
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0017144 [BP]drug metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PO5, chain A
Confidence level:very confident
Coverage over the Query: 5-130,170-351
View the alignment between query and template
View the model in PyMOL
Template: 1TQN, chain A
Confidence level:confident
Coverage over the Query: 140-322
View the alignment between query and template
View the model in PyMOL