Diaphorina citri psyllid: psy6593

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---

MVFGTRSEVTSMENENLRFLCRSSLIFTSGCSACDVMLDNWYFEKDGLLFCKEDYNGKYGEACQNCGQMMSGPVMVVGDHKFHPECFKCTSCSCCIGDGESYALVERSILCSACDVMLDNWYFEKDGLLFCKEDYNGKYGEACQNCGQVAVLRSLHHHNVIRFIGVLYKDRKLNLVTEYIAGGTLKELLQDPGQPLPWGQRVNFARDIAAGMTYLHSMNLIHRDLNSQNCLVREDKTVVVADFGLARIIHQGPRAPTTVMAKVPRKAAQRRGARKKRYTVVGNPYWMAPEMMTGQEYDETVDVFSYGIVLCEIIGRVPADPDYLPRSPDFGLDQTDFRNKFCASCPEPFVRIAFLCCDLNPDQRPPFEVLEVWLEGLSMHLSVDKPLPSDLEADIYQFATRKSASPLTEPECTAPTPADGALRPILETQSSKL

cccccHHHHcccccHHHHHHHHHHHccccccEEEEEEEccEEEccccCEEEHHHHHHHccccccccccccccccCCcccccccccccccccccccccccccccHHcccccccccccccccCEEEEcEEEEEEEccccccHHHHHHHHHHHHHHccccccEEEEEEEEEEcccEEEEEEccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEECcccCEEEEEcccccCECccccccccccccccHHHHHcccccccccccccccccccHHHcccccccccccEEEHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccc

***********MENENLRFLCRSSLIFTSGCSACDVMLDNWYFEKDGLLFCKEDYNGKYGEAC***GQMMSGPVMVVGDHKFHPECFKCTSCSCCIGDGESYALVERSILCSACDVMLDNWYFEKDGLLFCKEDYNGKYGEACQNCGQVAVLRSLHHHNVIRFIGVLYKDRKLNLVTEYIAGGTLKELLQDPGQPLPWGQRVNFARDIAAGMTYLHSMNLIHRDLNSQNCLVREDKTVVVADFGLARIIHQGPRAPT**************GARKKRYTVVGNPYWMAPEMMTGQEYDETVDVFSYGIVLCEIIGRVPADPDYLPRSPDFGLDQTDFRNKFCASCPEPFVRIAFLCCDLNPDQRPPFEVLEVWLEGLSMHLSVDKPL***L******************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
LIM domain kinase 1	Protein kinase which regulates actin filament dynamics. Phosphorylates and inactivates the actin binding/depolymerizing factor cofilin, thereby stabilizing the actin cytoskeleton. Required for motility of the axon growth cone.	confident	Q8QFP8
LIM domain kinase 1	Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways. Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop. LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton. In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation. Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly. Stimulates axonal outgrowth and may be involved in brain development. Isoform 3 has a dominant negative effect on actin cytoskeletal changes.	confident	P53667
LIM domain kinase 1	Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways. Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop. LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton. In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation. Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly. Stimulates axonal outgrowth and may be involved in brain development.	confident	P53668

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031072 [MF]	heat shock protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005925 [CC]	focal adhesion	probable	GO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0004674 [MF]	protein serine/threonine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0051444 [BP]	negative regulation of ubiquitin-protein ligase activity	probable	GO:0009892, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0051438, GO:0050789, GO:0051248, GO:0051340, GO:0010605, GO:0051246, GO:0043086, GO:0065007, GO:0044092, GO:0031396, GO:0031397, GO:0065009, GO:0060255, GO:0050790, GO:0050794, GO:0008150, GO:0048519, GO:0032269, GO:0032268, GO:0031400, GO:0051352, GO:0048523
GO:0006468 [BP]	protein phosphorylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0048468 [BP]	cell development	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032233 [BP]	positive regulation of actin filament bundle assembly	probable	GO:0051130, GO:0032231, GO:0033043, GO:0051493, GO:0051495, GO:0032970, GO:0010638, GO:0050794, GO:0044087, GO:0065007, GO:0032956, GO:0048518, GO:0008150, GO:0051128, GO:0050789, GO:0048522
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0048699 [BP]	generation of neurons	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044295 [CC]	axonal growth cone	probable	GO:0044464, GO:0044463, GO:0030427, GO:0030426, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0005801 [CC]	cis-Golgi network	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.1	Transferred entry: 2.7.11.19.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S95, chain A
Confidence level:very confident
Coverage over the Query: 120-250,278-394
View the alignment between query and template
View the model in PyMOL

Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 2-118
View the alignment between query and template
View the model in PyMOL