RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy6597
         (305 letters)



>gnl|CDD|240710 cd12264, RRM_AKAP17A, RNA recognition motif found in A-kinase
           anchor protein 17A (AKAP-17A) and similar proteins.
           This subfamily corresponds to the RRM domain of
           AKAP-17A, also termed 721P, or splicing factor,
           arginine/serine-rich 17A (SFRS17A). It was originally
           reported as the pseudoautosomal or X inactivation escape
           gene 7 (XE7) and as B-lymphocyte antigen precursor. It
           has been suggested that AKAP-17A is an alternative
           splicing factor and an SR-related splicing protein that
           interacts with the classical SR protein ASF/SF2 and the
           SR-related factor ZNF265. Additional studies have
           indicated that AKAP-17A is a dual-specific protein
           kinase A anchoring protein (AKAP) that can bind both
           type I and type II protein kinase A (PKA) with high
           affinity and co-localizes with the catalytic subunit of
           PKA in nuclear speckles as well as the splicing factor
           SC35 in splicing factor compartments. It is involved in
           regulation of pre-mRNA splicing possibly by docking a
           pool of PKA in splicing factor compartments. AKAP-17A
           contains an RNA recognition motif (RRM), also termed RBD
           (RNA binding domain) or RNP (ribonucleoprotein domain).
           .
          Length = 121

 Score = 98.9 bits (247), Expect = 7e-26
 Identities = 36/75 (48%), Positives = 47/75 (62%), Gaps = 2/75 (2%)

Query: 150 GERPDTIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPINDPYRAQMKPYI 209
           GERPDTI+L  LP +WF+     ++PSE +LR VF  +G+IR VDIP+ DPYR +M    
Sbjct: 1   GERPDTIHLEGLPCRWFAEPRVSDKPSELVLRTVFSKFGEIRNVDIPMLDPYRKEMDDRG 60

Query: 210 SGMTLFSHAQSLIFK 224
           S    FS    L F+
Sbjct: 61  SDT--FSFGSHLHFE 73


>gnl|CDD|214636 smart00360, RRM, RNA recognition motif. 
          Length = 73

 Score = 34.5 bits (80), Expect = 0.006
 Identities = 10/44 (22%), Positives = 19/44 (43%), Gaps = 10/44 (22%)

Query: 155 TIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPIN 198
           T+++ NLP             +E  LR +F  +G +  V +  +
Sbjct: 1   TLFVGNLPPDT----------TEEELRELFSKFGKVESVRLVRD 34


>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily.  RRM,
           also known as RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), is a highly abundant domain
           in eukaryotes found in proteins involved in
           post-transcriptional gene expression processes including
           mRNA and rRNA processing, RNA export, and RNA stability.
           This domain is 90 amino acids in length and consists of
           a four-stranded beta-sheet packed against two
           alpha-helices. RRM usually interacts with ssRNA, but is
           also known to interact with ssDNA as well as proteins.
           RRM binds a variable number of nucleotides, ranging from
           two to eight. The active site includes three aromatic
           side-chains located within the conserved RNP1 and RNP2
           motifs of the domain. The RRM domain is found in a
           variety heterogeneous nuclear ribonucleoproteins
           (hnRNPs), proteins implicated in regulation of
           alternative splicing, and protein components of small
           nuclear ribonucleoproteins (snRNPs).
          Length = 72

 Score = 33.8 bits (78), Expect = 0.012
 Identities = 11/47 (23%), Positives = 20/47 (42%), Gaps = 10/47 (21%)

Query: 156 IYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPINDPYR 202
           +++ NLP             +E  LR +F  +G+I  V I  +   +
Sbjct: 1   LFVGNLPPDT----------TEEDLRELFSKFGEIESVRIVRDKDGK 37


>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end)
           protein family.  This subfamily corresponds to the RRM2
           domain in the Spen (split end) protein family which
           includes RNA binding motif protein 15 (RBM15), putative
           RNA binding motif protein 15B (RBM15B), and similar
           proteins found in Metazoa. RBM15, also termed one-twenty
           two protein 1 (OTT1), conserved in eukaryotes, is a
           novel mRNA export factor and component of the NXF1
           pathway. It binds to NXF1 and serves as receptor for the
           RNA export element RTE. It also possess mRNA export
           activity and can facilitate the access of DEAD-box
           protein DBP5 to mRNA at the nuclear pore complex (NPC).
           RNA-binding protein 15B (RBM15B), also termed one
           twenty-two 3 (OTT3), is a paralog of RBM15 and therefore
           has post-transcriptional regulatory activity. It is a
           nuclear protein sharing with RBM15 the association with
           the splicing factor compartment and the nuclear envelope
           as well as the binding to mRNA export factors NXF1 and
           Aly/REF. Members in this family belong to the Spen
           (split end) protein family, which share a domain
           architecture comprising of three N-terminal RNA
           recognition motifs (RRMs), also known as RBD (RNA
           binding domain) or RNP (ribonucleoprotein domain), and a
           C-terminal SPOC (Spen paralog and ortholog C-terminal)
           domain. .
          Length = 79

 Score = 32.4 bits (74), Expect = 0.042
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 176 SEAMLRRVFQNYGDIREVDIPINDPYRAQMKPY 208
           +E  LRR F+ YG + +VD  I  P R Q   Y
Sbjct: 15  TEEELRRAFERYGVVEDVD--IKRPPRGQGNAY 45


>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain).  The RRM motif is probably diagnostic of an RNA
           binding protein. RRMs are found in a variety of RNA
           binding proteins, including various hnRNP proteins,
           proteins implicated in regulation of alternative
           splicing, and protein components of snRNPs. The motif
           also appears in a few single stranded DNA binding
           proteins. The RRM structure consists of four strands and
           two helices arranged in an alpha/beta sandwich, with a
           third helix present during RNA binding in some cases The
           C-terminal beta strand (4th strand) and final helix are
           hard to align and have been omitted in the SEED
           alignment The LA proteins have an N terminal rrm which
           is included in the seed. There is a second region
           towards the C terminus that has some features
           characteristic of a rrm but does not appear to have the
           important structural core of a rrm. The LA proteins are
           one of the main autoantigens in Systemic lupus
           erythematosus (SLE), an autoimmune disease.
          Length = 70

 Score = 32.2 bits (74), Expect = 0.044
 Identities = 10/43 (23%), Positives = 19/43 (44%), Gaps = 10/43 (23%)

Query: 156 IYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPIN 198
           +++ NLP     T       +E  L+ +F  +G I  + I  +
Sbjct: 1   LFVGNLP---PDT-------TEEDLKDLFSKFGPIESIRIVRD 33


>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in
           serine/arginine-rich splicing factor SRSF2, SRSF8 and
           similar proteins.  This subfamily corresponds to the RRM
           of SRSF2 and SRSF8. SRSF2, also termed protein PR264, or
           splicing component, 35 kDa (splicing factor SC35 or
           SC-35), is a prototypical SR protein that plays
           important roles in the alternative splicing of pre-mRNA.
           It is also involved in transcription elongation by
           directly or indirectly mediating the recruitment of
           elongation factors to the C-terminal domain of
           polymerase II. SRSF2 is exclusively localized in the
           nucleus and is restricted to nuclear processes. It
           contains a single N-terminal RNA recognition motif
           (RRM), also termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), followed by a C-terminal RS
           domain rich in serine-arginine dipeptides. The RRM is
           responsible for the specific recognition of 5'-SSNG-3'
           (S=C/G) RNA. In the regulation of alternative splicing
           events, it specifically binds to cis-regulatory elements
           on the pre-mRNA. The RS domain modulates SRSF2 activity
           through phosphorylation, directly contacts RNA, and
           promotes protein-protein interactions with the
           spliceosome. SRSF8, also termed SRP46 or SFRS2B, is a
           novel mammalian SR splicing factor encoded by a
           PR264/SC35 functional retropseudogene. SRSF8 is
           localized in the nucleus and does not display the same
           activity as PR264/SC35. It functions as an essential
           splicing factor in complementing a HeLa cell S100
           extract deficient in SR proteins. Like SRSF2, SRSF8
           contains a single N-terminal RRM and a C-terminal RS
           domain. .
          Length = 73

 Score = 30.3 bits (69), Expect = 0.21
 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%)

Query: 176 SEAMLRRVFQNYGDIREVDIPINDPY 201
           +   LRRVF+ YG++ +V IP  D Y
Sbjct: 11  TPDDLRRVFEKYGEVGDVYIP-RDRY 35


>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA
           binding motif protein 15 (RBM15).  This subgroup
           corresponds to the RRM2 of RBM15, also termed one-twenty
           two protein 1 (OTT1), conserved in eukaryotes, a novel
           mRNA export factor and component of the NXF1 pathway. It
           binds to NXF1 and serves as receptor for the RNA export
           element RTE. It also possesses mRNA export activity and
           can facilitate the access of DEAD-box protein DBP5 to
           mRNA at the nuclear pore complex (NPC). RBM15 belongs to
           the Spen (split end) protein family, which contain three
           N-terminal RNA recognition motifs (RRMs), also known as
           RBD (RNA binding domain) or RNP (ribonucleoprotein
           domain), and a C-terminal SPOC (Spen paralog and
           ortholog C-terminal) domain. This family also includes a
           RBM15-MKL1 (OTT-MAL) fusion protein that RBM15 is
           N-terminally fused to megakaryoblastic leukemia 1
           protein (MKL1) at the C-terminus in a translocation
           involving chromosome 1 and 22, resulting in acute
           megakaryoblastic leukemia. The fusion protein could
           interact with the mRNA export machinery. Although it
           maintains the specific transactivator function of MKL1,
           the fusion protein cannot activate RTE-mediated mRNA
           expression and has lost the post-transcriptional
           activator function of RBM15. However, it has
           transdominant suppressor function contributing to its
           oncogenic properties. .
          Length = 87

 Score = 30.3 bits (68), Expect = 0.27
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 12/54 (22%)

Query: 155 TIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPINDPYRAQMKPY 208
           T++L NL +            +E  LRR F  +G I EVD  I  P R Q   Y
Sbjct: 9   TLFLGNLDIT----------VTETDLRRAFDRFGVITEVD--IKRPGRGQTSTY 50


>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog
           subfamily C member 17.  The CD corresponds to the RRM of
           some eukaryotic DnaJ homolog subfamily C member 17 and
           similar proteins. DnaJ/Hsp40 (heat shock protein 40)
           proteins are highly conserved and play crucial roles in
           protein translation, folding, unfolding, translocation,
           and degradation. They act primarily by stimulating the
           ATPase activity of Hsp70s, an important chaperonine
           family. Members in this family contains an N-terminal
           DnaJ domain or J-domain, which mediates the interaction
           with Hsp70. They also contains a RNA recognition motif
           (RRM), also known as RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), at the C-terminus, which may
           play an essential role in RNA binding. .
          Length = 74

 Score = 29.9 bits (68), Expect = 0.30
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%)

Query: 161 LPVKWFSTKARPNQP--SEAMLRRVFQNYGDIREVDIPIND 199
           L VKW   K +      SE  LR++F  YGD+ +V +    
Sbjct: 3   LKVKW---KRKKGNGDYSEDELRKIFSKYGDVSDVVVSSKK 40


>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene
           single-strand binding proteins (MSSP) family.  This
           subfamily corresponds to the RRM2 of c-myc gene
           single-strand binding proteins (MSSP) family, including
           single-stranded DNA-binding protein MSSP-1 (also termed
           RBMS1 or SCR2) and MSSP-2 (also termed RBMS2 or SCR3).
           All MSSP family members contain two RNA recognition
           motifs (RRMs), also termed RBDs (RNA binding domains) or
           RNPs (ribonucleoprotein domains), both of which are
           responsible for the specific DNA binding activity. Both,
           MSSP-1 and -2, have been identified as protein factors
           binding to a putative DNA replication
           origin/transcriptional enhancer sequence present
           upstream from the human c-myc gene in both single- and
           double-stranded forms. Thus they have been implied in
           regulating DNA replication, transcription, apoptosis
           induction, and cell-cycle movement, via the interaction
           with C-MYC, the product of protooncogene c-myc.
           Moreover, they family includes a new member termed
           RNA-binding motif, single-stranded-interacting protein 3
           (RBMS3), which is not a transcriptional regulator. RBMS3
           binds with high affinity to A/U-rich stretches of RNA,
           and to A/T-rich DNA sequences, and functions as a
           regulator of cytoplasmic activity. In addition, a
           putative meiosis-specific RNA-binding protein termed
           sporulation-specific protein 5 (SPO5, or meiotic
           RNA-binding protein 1, or meiotically up-regulated gene
           12 protein), encoded by Schizosaccharomyces pombe
           Spo5/Mug12 gene, is also included in this family. SPO5
           is a novel meiosis I regulator that may function in the
           vicinity of the Mei2 dot. .
          Length = 79

 Score = 30.0 bits (68), Expect = 0.32
 Identities = 9/35 (25%), Positives = 15/35 (42%), Gaps = 10/35 (28%)

Query: 156 IYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDI 190
           +Y+SNLP+             E  L  + + YG +
Sbjct: 3   LYISNLPLHM----------DEQDLETMLKPYGQV 27


>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33)
           and similar proteins.  This subfamily corresponds to the
           RRM of Cyp33, also termed peptidyl-prolyl cis-trans
           isomerase E (PPIase E), or cyclophilin E, or rotamase E.
           Cyp33 is a nuclear RNA-binding cyclophilin with an
           N-terminal RNA recognition motif (RRM), also termed RBD
           (RNA binding domain) or RNP (ribonucleoprotein domain),
           and a C-terminal PPIase domain. Cyp33 possesses
           RNA-binding activity and preferentially binds to
           polyribonucleotide polyA and polyU, but hardly to polyG
           and polyC. It binds specifically to mRNA, which can
           stimulate its PPIase activity. Moreover, Cyp33 interacts
           with the third plant homeodomain (PHD3) zinc finger
           cassette of the mixed lineage leukemia (MLL)
           proto-oncoprotein and a poly-A RNA sequence through its
           RRM domain. It further mediates downregulation of the
           expression of MLL target genes HOXC8, HOXA9, CDKN1B, and
           C-MYC, in a proline isomerase-dependent manner. Cyp33
           also possesses a PPIase activity that catalyzes
           cis-trans isomerization of the peptide bond preceding a
           proline, which has been implicated in the stimulation of
           folding and conformational changes in folded and
           unfolded proteins. The PPIase activity can be inhibited
           by the immunosuppressive drug cyclosporin A. .
          Length = 73

 Score = 29.5 bits (67), Expect = 0.46
 Identities = 10/43 (23%), Positives = 20/43 (46%), Gaps = 10/43 (23%)

Query: 156 IYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPIN 198
           +Y+  L            +  E +L   F  +GDI+++ IP++
Sbjct: 1   LYVGGLA----------EEVDEKVLHAAFIPFGDIKDIQIPLD 33


>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal
           pre-messenger RNA splicing protein 24 (Prp24) and
           similar proteins.  This subfamily corresponds to the
           RRM1 of Prp24, also termed U4/U6
           snRNA-associated-splicing factor PRP24 (U4/U6 snRNP), an
           RNA-binding protein with four well conserved RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains). It
           facilitates U6 RNA base-pairing with U4 RNA during
           spliceosome assembly. Prp24 specifically binds free U6
           RNA primarily with RRMs 1 and 2 and facilitates pairing
           of U6 RNA bases with U4 RNA bases. Additionally, it may
           also be involved in dissociation of the U4/U6 complex
           during spliceosome activation. .
          Length = 71

 Score = 28.8 bits (65), Expect = 0.60
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 172 PNQPSEAMLRRVFQNYGDIREVDIP 196
           P   +E  +R+ F++ G+IREV I 
Sbjct: 9   PKDTTENKIRQFFKDCGEIREVKIV 33


>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like
           proteins and terminal EAR1-like proteins.  This
           subfamily corresponds to the RRM2 of Mei2-like proteins
           from plant and fungi, terminal EAR1-like proteins from
           plant, and other eukaryotic homologs. Mei2-like proteins
           represent an ancient eukaryotic RNA-binding proteins
           family whose corresponding Mei2-like genes appear to
           have arisen early in eukaryote evolution, been lost from
           some lineages such as Saccharomyces cerevisiae and
           metazoans, and diversified in the plant lineage. The
           plant Mei2-like genes may function in cell fate
           specification during development, rather than as
           stimulators of meiosis. In the fission yeast
           Schizosaccharomyces pombe, the Mei2 protein is an
           essential component of the switch from mitotic to
           meiotic growth. S. pombe Mei2 stimulates meiosis in the
           nucleus upon binding a specific non-coding RNA. The
           terminal EAR1-like protein 1 and 2 (TEL1 and TEL2) are
           mainly found in land plants. They may play a role in the
           regulation of leaf initiation. All members in this
           family are putative RNA-binding proteins carrying three
           RNA recognition motifs (RRMs), also termed RBDs (RNA
           binding domains) or RNPs (ribonucleoprotein domains). In
           addition to the RRMs, the terminal EAR1-like proteins
           also contain TEL characteristic motifs that allow
           sequence and putative functional discrimination between
           them and Mei2-like proteins. .
          Length = 71

 Score = 28.7 bits (65), Expect = 0.62
 Identities = 5/18 (27%), Positives = 13/18 (72%)

Query: 176 SEAMLRRVFQNYGDIREV 193
           S+  LR +F  +G+++++
Sbjct: 14  SDQELRSLFSQFGEVKDI 31


>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate
           RNA-binding protein RBM23, RBM39 and similar proteins.
           This subfamily corresponds to the RRM2 of RBM39 (also
           termed HCC1), a nuclear autoantigen that contains an
           N-terminal arginine/serine rich (RS) motif and three RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains). An
           octapeptide sequence called the RS-ERK motif is repeated
           six times in the RS region of RBM39. Although the
           cellular function of RBM23 remains unclear, it shows
           high sequence homology to RBM39 and contains two RRMs.
           It may possibly function as a pre-mRNA splicing factor.
           .
          Length = 73

 Score = 28.8 bits (65), Expect = 0.72
 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 176 SEAMLRRVFQNYGDIREVDIPINDPYRAQMKPY 208
           +E  LR +F+ +G+I  V +   DP   + K Y
Sbjct: 11  TEDDLRGIFEPFGEIEFVQLQR-DPETGRSKGY 42


>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in
           SMART/HDAC1-associated repressor protein (SHARP) and
           similar proteins.  This subfamily corresponds to the
           RRM3 of SHARP, also termed Msx2-interacting protein
           (MINT), or SPEN homolog, an estrogen-inducible
           transcriptional repressor that interacts directly with
           the nuclear receptor corepressor SMRT, histone
           deacetylases (HDACs) and components of the NuRD complex.
           SHARP recruits HDAC activity and binds to the steroid
           receptor RNA coactivator SRA through four conserved
           N-terminal RNA recognition motifs (RRMs), also termed
           RBDs (RNA binding domains) or RNPs (ribonucleoprotein
           domains), further suppressing SRA-potentiated steroid
           receptor transcription activity. Thus, SHARP has the
           capacity to modulate both liganded and nonliganded
           nuclear receptors. SHARP also has been identified as a
           component of transcriptional repression complexes in
           Notch/RBP-Jkappa signaling pathways. In addition to the
           N-terminal RRMs, SHARP possesses a C-terminal SPOC
           domain (Spen paralog and ortholog C-terminal domain),
           which is highly conserved among Spen proteins.  .
          Length = 74

 Score = 28.5 bits (64), Expect = 0.81
 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 3/25 (12%)

Query: 180 LRRVFQNYGDIREVDI---PINDPY 201
           LR  F+ +G+I ++DI     N  Y
Sbjct: 19  LREAFERFGEIIDIDIKKQGGNPAY 43


>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in
           CELF/Bruno-like family of RNA binding proteins and plant
           flowering time control protein FCA.  This subfamily
           corresponds to the RRM1 and RRM2 domains of the CUGBP1
           and ETR-3-like factors (CELF) as well as plant flowering
           time control protein FCA. CELF, also termed BRUNOL
           (Bruno-like) proteins, is a family of structurally
           related RNA-binding proteins involved in regulation of
           pre-mRNA splicing in the nucleus, and control of mRNA
           translation and deadenylation in the cytoplasm. The
           family contains six members: CELF-1 (also known as
           BRUNOL-2, CUG-BP1, NAPOR, EDEN-BP), CELF-2 (also known
           as BRUNOL-3, ETR-3, CUG-BP2, NAPOR-2), CELF-3 (also
           known as BRUNOL-1, TNRC4, ETR-1, CAGH4, ER DA4), CELF-4
           (BRUNOL-4), CELF-5 (BRUNOL-5) and CELF-6 (BRUNOL-6).
           They all contain three highly conserved RNA recognition
           motifs (RRMs), also known as RBDs (RNA binding domains)
           or RNPs (ribonucleoprotein domains): two consecutive
           RRMs (RRM1 and RRM2) situated in the N-terminal region
           followed by a linker region and the third RRM (RRM3)
           close to the C-terminus of the protein. The low sequence
           conservation of the linker region is highly suggestive
           of a large variety in the co-factors that associate with
           the various CELF family members. Based on both, sequence
           similarity and function, the CELF family can be divided
           into two subfamilies, the first containing CELFs 1 and
           2, and the second containing CELFs 3, 4, 5, and 6. The
           different CELF proteins may act through different sites
           on at least some substrates. Furthermore, CELF proteins
           may interact with each other in varying combinations to
           influence alternative splicing in different contexts.
           This subfamily also includes plant flowering time
           control protein FCA that functions in the
           posttranscriptional regulation of transcripts involved
           in the flowering process. FCA contains two RRMs, and a
           WW protein interaction domain.  .
          Length = 77

 Score = 28.7 bits (65), Expect = 0.82
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 172 PNQPSEAMLRRVFQNYGDIREVDIPINDPYRAQMK 206
           P   +E  +R +F+ YG+I EV I I D    Q K
Sbjct: 8   PKTATEEDVRALFEEYGNIEEVTI-IRDKDTGQSK 41


>gnl|CDD|237992 cd00025, BPI1, BPI/LBP/CETP N-terminal domain; Bactericidal
           permeability-increasing protein (BPI) /
           Lipopolysaccharide-binding protein (LBP) / Cholesteryl
           ester transfer protein (CETP) N-terminal domain; binds
           to and neutralizes lipopolysaccharides from the outer
           membrane of Gram-negative bacteria.; Apolar pockets on
           the concave surface bind a molecule of
           phosphatidylcholine, primarily by interacting with their
           acyl chains; this suggests that the pockets may also
           bind the acyl chains of lipopolysaccharide.
          Length = 223

 Score = 30.4 bits (69), Expect = 0.84
 Identities = 27/111 (24%), Positives = 45/111 (40%), Gaps = 11/111 (9%)

Query: 19  DAKILSAAYQLFLKPVARLNISVQIPELKITGKSLSNYEVIEKIKYWAQPEEFSSLKVTK 78
             K L  A Q  LK +      +QIP++    K       + K +     +E   LK+  
Sbjct: 7   SPKGLKFAKQQGLKVLQAELEKLQIPDILGAMKIKL----LGKGRVGLSNKEIQELKLPS 62

Query: 79  STLEFVR---LDGEIENRSKLLPVLARLDGRTIKLSGFAD----GLRVRAT 122
           S+++ V    LD  I N S  L  + + + R I   G  +    G+ ++A 
Sbjct: 63  SSIKLVEVKGLDLSISNVSIGLSGVWKYNYRFILDGGNVELSVEGMNIQAD 113


>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell
           carcinoma antigen recognized by T-cells 3 (SART3) and
           similar proteins.  This subfamily corresponds to the
           RRM1 of SART3, also termed Tat-interacting protein of
           110 kDa (Tip110), an RNA-binding protein expressed in
           the nucleus of the majority of proliferating cells,
           including normal cells and malignant cells, but not in
           normal tissues except for the testes and fetal liver. It
           is involved in the regulation of mRNA splicing probably
           via its complex formation with RNA-binding protein with
           a serine-rich domain (RNPS1), a pre-mRNA-splicing
           factor. SART3 has also been identified as a nuclear
           Tat-interacting protein that regulates Tat
           transactivation activity through direct interaction and
           functions as an important cellular factor for HIV-1 gene
           expression and viral replication. In addition, SART3 is
           required for U6 snRNP targeting to Cajal bodies. It
           binds specifically and directly to the U6 snRNA,
           interacts transiently with the U6 and U4/U6 snRNPs, and
           promotes the reassembly of U4/U6 snRNPs after splicing
           in vitro. SART3 contains an N-terminal
           half-a-tetratricopeptide repeat (HAT)-rich domain, a
           nuclearlocalization signal (NLS) domain, and two
           C-terminal RNA recognition motifs (RRMs), also termed
           RBDs (RNA binding domains) or RNPs (ribonucleoprotein
           domains). .
          Length = 72

 Score = 28.4 bits (64), Expect = 0.89
 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 10/45 (22%)

Query: 155 TIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPIND 199
           T+++SNL    +S         E  LR++F   G+I +V +  N 
Sbjct: 1   TVFVSNLD---YSV-------PEDELRKLFSKCGEITDVRLVKNY 35


>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast
           negative growth regulatory protein NGR1 (RBP1), yeast
           protein NAM8 and similar proteins.  This subfamily
           corresponds to the RRM3 of NGR1 and NAM8. NGR1, also
           termed RNA-binding protein RBP1, is a putative
           glucose-repressible protein that binds both RNA and
           single-stranded DNA (ssDNA) in yeast. It may function in
           regulating cell growth in early log phase, possibly
           through its participation in RNA metabolism. NGR1
           contains two RNA recognition motifs (RRMs), also termed
           RBDs (RNA binding domains) or RNPs (ribonucleoprotein
           domains), followed by a glutamine-rich stretch that may
           be involved in transcriptional activity. In addition,
           NGR1 has an asparagine-rich region near the carboxyl
           terminus which also harbors a methionine-rich region.
           The family also includes protein NAM8, which is a
           putative RNA-binding protein that acts as a suppressor
           of mitochondrial splicing deficiencies when
           overexpressed in yeast. It may be a non-essential
           component of the mitochondrial splicing machinery. Like
           NGR1, NAM8 contains two RRMs. .
          Length = 72

 Score = 28.4 bits (64), Expect = 0.93
 Identities = 9/21 (42%), Positives = 13/21 (61%)

Query: 176 SEAMLRRVFQNYGDIREVDIP 196
           +E  LR +F  +G+I  V IP
Sbjct: 14  TEDELRSLFGPFGEIVYVKIP 34


>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family.  This model
           represents a subfamily of RNA splicing factors including
           the Pad-1 protein (N. crassa), CAPER (M. musculus) and
           CC1.3 (H.sapiens). These proteins are characterized by
           an N-terminal arginine-rich, low complexity domain
           followed by three (or in the case of 4 H. sapiens
           paralogs, two) RNA recognition domains (rrm: pfam00706).
           These splicing factors are closely related to the U2AF
           splicing factor family (TIGR01642). A homologous gene
           from Plasmodium falciparum was identified in the course
           of the analysis of that genome at TIGR and was included
           in the seed.
          Length = 457

 Score = 30.6 bits (69), Expect = 1.1
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 176 SEAMLRRVFQNYGDIREVDIPINDPYRAQMKPYISGMTLFSHAQ 219
           +E  LR++F+ +GDI +V +   DP   + K +  G   F  A+
Sbjct: 199 TEQELRQIFEPFGDIEDVQLHR-DPETGRSKGF--GFIQFHDAE 239


>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding
           protein 43 (TDP-43) and similar proteins.  This
           subfamily corresponds to the RRM2 of TDP-43 (also termed
           TARDBP), a ubiquitously expressed pathogenic protein
           whose normal function and abnormal aggregation are
           directly linked to the genetic disease cystic fibrosis,
           and two neurodegenerative disorders: frontotemporal
           lobar degeneration (FTLD) and amyotrophic lateral
           sclerosis (ALS). TDP-43 binds both DNA and RNA, and has
           been implicated in transcriptional repression, pre-mRNA
           splicing and translational regulation. TDP-43 is a
           dimeric protein with two RNA recognition motifs (RRMs),
           also termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), and a C-terminal
           glycine-rich domain. The RRMs are responsible for DNA
           and RNA binding; they bind to TAR DNA and RNA sequences
           with UG-repeats. The glycine-rich domain can interact
           with the hnRNP family proteins to form the hnRNP-rich
           complex involved in splicing inhibition. It is also
           essential for the cystic fibrosis transmembrane
           conductance regulator (CFTR) exon 9-skipping activity. .
          Length = 71

 Score = 28.0 bits (63), Expect = 1.1
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 2/32 (6%)

Query: 172 PNQPSEAMLRRVFQNYGDIREVDIPINDPYRA 203
               +E  LR+ F  +G++ +V IP   P+RA
Sbjct: 9   TEDMTEEDLRQYFSQFGEVTDVYIPK--PFRA 38


>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in
           serine/arginine-rich splicing factor SRSF10, SRSF12 and
           similar proteins.  This subfamily corresponds to the RRM
           of SRSF10 and SRSF12. SRSF10, also termed 40 kDa
           SR-repressor protein (SRrp40), or FUS-interacting
           serine-arginine-rich protein 1 (FUSIP1), or splicing
           factor SRp38, or splicing factor, arginine/serine-rich
           13A (SFRS13A), or TLS-associated protein with Ser-Arg
           repeats (TASR). It is a serine-arginine (SR) protein
           that acts as a potent and general splicing repressor
           when dephosphorylated. It mediates global inhibition of
           splicing both in M phase of the cell cycle and in
           response to heat shock. SRSF10 emerges as a modulator of
           cholesterol homeostasis through the regulation of
           low-density lipoprotein receptor (LDLR) splicing
           efficiency. It also regulates cardiac-specific
           alternative splicing of triadin pre-mRNA and is required
           for proper Ca2+ handling during embryonic heart
           development. In contrast, the phosphorylated SRSF10
           functions as a sequence-specific splicing activator in
           the presence of a nuclear cofactor. It activates distal
           alternative 5' splice site of adenovirus E1A pre-mRNA in
           vivo. Moreover, SRSF10 strengthens pre-mRNA recognition
           by U1 and U2 snRNPs. SRSF10 localizes to the nuclear
           speckles and can shuttle between nucleus and cytoplasm.
           SRSF12, also termed 35 kDa SR repressor protein
           (SRrp35), or splicing factor, arginine/serine-rich 13B
           (SFRS13B), or splicing factor, arginine/serine-rich 19
           (SFRS19), is a serine/arginine (SR) protein-like
           alternative splicing regulator that antagonizes
           authentic SR proteins in the modulation of alternative
           5' splice site choice. For instance, it activates distal
           alternative 5' splice site of the adenovirus E1A
           pre-mRNA in vivo. Both, SRSF10 and SRSF12, contain a
           single N-terminal RNA recognition motif (RRM), also
           termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), followed by a C-terminal RS
           domain rich in serine-arginine dipeptides. .
          Length = 84

 Score = 28.5 bits (64), Expect = 1.2
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 11/55 (20%)

Query: 155 TIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPINDPYRAQMKPYI 209
           ++Y+ N+         RP+      LRR+F  YG I +V IP+ D Y  + + + 
Sbjct: 2   SLYVRNVA-----DATRPDD-----LRRLFGKYGPIVDVYIPL-DFYTRRPRGFA 45


>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in
           granule-associated RNA binding proteins (p40-TIA-1 and
           TIAR), and yeast nuclear and cytoplasmic polyadenylated
           RNA-binding protein PUB1.  This subfamily corresponds to
           the RRM3 of TIA-1, TIAR, and PUB1. Nucleolysin TIA-1
           isoform p40 (p40-TIA-1 or TIA-1) and nucleolysin
           TIA-1-related protein (TIAR) are granule-associated RNA
           binding proteins involved in inducing apoptosis in
           cytotoxic lymphocyte (CTL) target cells. They share high
           sequence similarity and are expressed in a wide variety
           of cell types. TIA-1 can be phosphorylated by a
           serine/threonine kinase that is activated during
           Fas-mediated apoptosis.TIAR is mainly localized in the
           nucleus of hematopoietic and nonhematopoietic cells. It
           is translocated from the nucleus to the cytoplasm in
           response to exogenous triggers of apoptosis. Both TIA-1
           and TIAR bind specifically to poly(A) but not to poly(C)
           homopolymers. They are composed of three N-terminal
           highly homologous RNA recognition motifs (RRMs), also
           termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), and a glutamine-rich
           C-terminal auxiliary domain containing a
           lysosome-targeting motif. TIA-1 and TIAR interact with
           RNAs containing short stretches of uridylates and their
           RRM2 can mediate the specific binding to uridylate-rich
           RNAs. The C-terminal auxiliary domain may be responsible
           for interacting with other proteins. In addition, TIA-1
           and TIAR share a potential serine protease-cleavage site
           (Phe-Val-Arg) localized at the junction between their
           RNA binding domains and their C-terminal auxiliary
           domains. This subfamily also includes a yeast nuclear
           and cytoplasmic polyadenylated RNA-binding protein PUB1,
           termed ARS consensus-binding protein ACBP-60, or poly
           uridylate-binding protein, or poly(U)-binding protein,
           which has been identified as both a heterogeneous
           nuclear RNA-binding protein (hnRNP) and a cytoplasmic
           mRNA-binding protein (mRNP). It may be stably bound to a
           translationally inactive subpopulation of mRNAs within
           the cytoplasm. PUB1 is distributed in both, the nucleus
           and the cytoplasm, and binds to poly(A)+ RNA (mRNA or
           pre-mRNA). Although it is one of the major cellular
           proteins cross-linked by UV light to polyadenylated RNAs
           in vivo, PUB1 is nonessential for cell growth in yeast.
           PUB1 also binds to T-rich single stranded DNA (ssDNA);
           however, there is no strong evidence implicating PUB1 in
           the mechanism of DNA replication. PUB1 contains three
           RRMs, and a GAR motif (glycine and arginine rich
           stretch) that is located between RRM2 and RRM3. .
          Length = 73

 Score = 28.0 bits (63), Expect = 1.3
 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 10/41 (24%)

Query: 155 TIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDI 195
           T+Y+ NLP          +  +E  L+R F  +G I EV +
Sbjct: 2   TVYVGNLP----------HGLTEEELQRTFSPFGAIEEVRV 32


>gnl|CDD|99738 cd00614, CGS_like, CGS_like: Cystathionine gamma-synthase is a PLP
           dependent enzyme and catalyzes the committed step of
           methionine biosynthesis. This pathway is unique to
           microorganisms and plants, rendering the enzyme an
           attractive target for the development of antimicrobials
           and herbicides. This subgroup also includes
           cystathionine gamma-lyases (CGL), O-acetylhomoserine
           sulfhydrylases and O-acetylhomoserine thiol lyases.
           CGL's are very similar to CGS's. Members of this group
           are widely distributed among all three forms of life.
          Length = 369

 Score = 30.2 bits (69), Expect = 1.4
 Identities = 14/66 (21%), Positives = 27/66 (40%), Gaps = 4/66 (6%)

Query: 157 YLSNLP-VKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPINDPYRAQMKPYISGMTLF 215
           +L   P V+       P+ P   + ++    YG +   ++          K +++ + LF
Sbjct: 253 FLEKHPKVERVYYPGLPSHPQHELAKKQMSGYGGVFSFELKGGL---EAAKKFLNALKLF 309

Query: 216 SHAQSL 221
           S A SL
Sbjct: 310 SLAVSL 315


>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous
           nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA
           recognition motif 1 (hRBMY), testis-specific
           heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T)
           and similar proteins.  This subfamily corresponds to the
           RRM domain of hnRNP G, also termed glycoprotein p43 or
           RBMX, an RNA-binding motif protein located on the X
           chromosome. It is expressed ubiquitously and has been
           implicated in the splicing control of several pre-mRNAs.
           Moreover, hnRNP G may function as a regulator of
           transcription for SREBP-1c and GnRH1. Research has shown
           that hnRNP G may also act as a tumor-suppressor since it
           upregulates the Txnip gene and promotes the fidelity of
           DNA end-joining activity. In addition, hnRNP G appears
           to play a critical role in proper neural development of
           zebrafish and frog embryos. The family also includes
           several paralogs of hnRNP G, such as hRBMY and hnRNP G-T
           (also termed RNA-binding motif protein,
           X-linked-like-2). Both, hRBMY and hnRNP G-T, are
           exclusively expressed in testis and critical for male
           fertility. Like hnRNP G, hRBMY and hnRNP G-T interact
           with factors implicated in the regulation of pre-mRNA
           splicing, such as hTra2-beta1 and T-STAR. Although
           members in this family share a high conserved N-terminal
           RNA recognition motif (RRM), also termed RBD (RNA
           binding domain) or RNP (ribonucleoprotein domain), they
           appear to recognize different RNA targets. For instance,
           hRBMY interacts specifically with a stem-loop structure
           in which the loop is formed by the sequence CA/UCAA. In
           contrast, hnRNP G associates with single stranded RNA
           sequences containing a CCA/C motif. In addition to the
           RRM, hnRNP G contains a nascent transcripts targeting
           domain (NTD) in the middle region and a novel auxiliary
           RNA-binding domain (RBD) in its C-terminal region. The
           C-terminal RBD exhibits distinct RNA binding
           specificity, and would play a critical role in the
           regulation of alternative splicing by hnRNP G. .
          Length = 80

 Score = 28.0 bits (63), Expect = 1.4
 Identities = 10/48 (20%), Positives = 21/48 (43%), Gaps = 11/48 (22%)

Query: 153 PDTIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPINDP 200
            + +++S L  +           +E  L  +F  +G + EV + + DP
Sbjct: 1   GNKLFVSGLSTRT----------TEKELEALFSKFGRVEEVLL-MKDP 37


>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding
           protein 28 (RBM28) and similar proteins.  This subfamily
           corresponds to the RRM2 of RBM28 and Nop4p. RBM28 is a
           specific nucleolar component of the spliceosomal small
           nuclear ribonucleoproteins (snRNPs), possibly
           coordinating their transition through the nucleolus. It
           specifically associates with U1, U2, U4, U5, and U6
           small nuclear RNAs (snRNAs), and may play a role in the
           maturation of both small nuclear and ribosomal RNAs.
           RBM28 has four RNA recognition motifs (RRMs), also
           termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), and an extremely acidic
           region between RRM2 and RRM3. The family also includes
           nucleolar protein 4 (Nop4p or Nop77p) encoded by YPL043W
           from Saccharomyces cerevisiae. It is an essential
           nucleolar protein involved in processing and maturation
           of 27S pre-rRNA and biogenesis of 60S ribosomal
           subunits. Nop4p also contains four RRMs.  .
          Length = 76

 Score = 28.0 bits (63), Expect = 1.5
 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 10/37 (27%)

Query: 160 NLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIP 196
           NLP   F          EA L+++F  +G + EV IP
Sbjct: 6   NLP---FKCT-------EADLKKLFSPFGFVWEVTIP 32


>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple
           RNA-binding domain-containing protein 1 (MRD1) and
           similar proteins.  This subgroup corresponds to the RRM2
           of MRD1 which is encoded by a novel yeast gene MRD1
           (multiple RNA-binding domain). It is well-conserved in
           yeast and its homologs exist in all eukaryotes. MRD1 is
           present in the nucleolus and the nucleoplasm. It
           interacts with the 35 S precursor rRNA (pre-rRNA) and U3
           small nucleolar RNAs (snoRNAs). It is essential for the
           initial processing at the A0-A2 cleavage sites in the 35
           S pre-rRNA. MRD1 contains 5 conserved RNA recognition
           motifs (RRMs), also termed RBDs (RNA binding domains) or
           RNPs (ribonucleoprotein domains), which may play an
           important structural role in organizing specific rRNA
           processing events. .
          Length = 79

 Score = 27.7 bits (62), Expect = 1.7
 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 10/43 (23%)

Query: 156 IYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPIN 198
           +++ NLP   +S K       E  L ++F  +G++ EV + I+
Sbjct: 5   LFVRNLP---YSCK-------EDDLEKLFSKFGELSEVHVAID 37


>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a.k.a. RRM, RBD, or RNP
           domain). 
          Length = 69

 Score = 27.5 bits (62), Expect = 1.7
 Identities = 13/44 (29%), Positives = 18/44 (40%), Gaps = 10/44 (22%)

Query: 156 IYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPIND 199
           +Y+ NLP    S        +E  LR  F  YG +  V +  N 
Sbjct: 1   LYVRNLP---PSV-------TEEDLREFFSPYGKVEGVRLVRNK 34


>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic
           RNA-binding protein RBM24, RBM38 and similar proteins.
           This subfamily corresponds to the RRM of RBM24 and RBM38
           from vertebrate, SUPpressor family member SUP-12 from
           Caenorhabditis elegans and similar proteins. Both, RBM24
           and RBM38, are preferentially expressed in cardiac and
           skeletal muscle tissues. They regulate myogenic
           differentiation by controlling the cell cycle in a
           p21-dependent or -independent manner. RBM24, also termed
           RNA-binding region-containing protein 6, interacts with
           the 3'-untranslated region (UTR) of myogenin mRNA and
           regulates its stability in C2C12 cells. RBM38, also
           termed CLL-associated antigen KW-5, or HSRNASEB, or
           RNA-binding region-containing protein 1(RNPC1), or
           ssDNA-binding protein SEB4, is a direct target of the
           p53 family. It is required for maintaining the stability
           of the basal and stress-induced p21 mRNA by binding to
           their 3'-UTRs. It also binds the AU-/U-rich elements in
           p63 3'-UTR and regulates p63 mRNA stability and
           activity. SUP-12 is a novel tissue-specific splicing
           factor that controls muscle-specific splicing of the
           ADF/cofilin pre-mRNA in C. elegans. All family members
           contain a conserved RNA recognition motif (RRM), also
           termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain). .
          Length = 76

 Score = 27.6 bits (62), Expect = 2.0
 Identities = 10/38 (26%), Positives = 18/38 (47%), Gaps = 10/38 (26%)

Query: 155 TIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIRE 192
            I++  LP   + T        ++ LR+ F  +G+I E
Sbjct: 2   KIFVGGLP---YHT------TDDS-LRKYFSQFGEIEE 29


>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein
           with serine-rich domain 1 (RNPS1) and similar proteins. 
           This subfamily corresponds to the RRM of RNPS1 and its
           eukaryotic homologs. RNPS1, also termed RNA-binding
           protein prevalent during the S phase, or SR-related
           protein LDC2, was originally characterized as a general
           pre-mRNA splicing activator, which activates both
           constitutive and alternative splicing of pre-mRNA in
           vitro.It has been identified as a protein component of
           the splicing-dependent mRNP complex, or exon-exon
           junction complex (EJC), and is directly involved in mRNA
           surveillance. Furthermore, RNPS1 is a splicing regulator
           whose activator function is controlled in part by CK2
           (casein kinase II) protein kinase phosphorylation. It
           can also function as a squamous-cell carcinoma antigen
           recognized by T cells-3 (SART3)-binding protein, and is
           involved in the regulation of mRNA splicing. RNPS1
           contains an N-terminal serine-rich (S) domain, a central
           RNA recognition motif (RRM), also termed RBD (RNA
           binding domain) or RNP (ribonucleoprotein domain), and
           the C-terminal arginine/serine/proline-rich (RS/P)
           domain. .
          Length = 73

 Score = 27.5 bits (62), Expect = 2.0
 Identities = 9/21 (42%), Positives = 16/21 (76%)

Query: 180 LRRVFQNYGDIREVDIPINDP 200
           L+ +F NYG +++VD+PI+  
Sbjct: 15  LKEIFSNYGTVKDVDLPIDRE 35


>gnl|CDD|212089 cd11520, SLC5sbd_SMCT2, Na(+)/monocarboxylate cotransporter SMCT2
           and related proteins; solute-binding domain.  SMCT2 is a
           low-affinity transporter for short-chain fatty acids,
           lactate, pyruvate, and nicotinate. Human SMCT2 (hSMCT2)
           is encoded by the SLC5A12 gene. SMCT2 is expressed in
           the kidney, small intestine, skeletal muscle, and
           retina. In the kidney, it is expressed in the apical
           membrane of the proximal convoluted tubule, along the
           entire length of the tubule (in contrast to the
           high-affinity monocarboxylate transporter SMCT1,
           belonging to a different family, which is limited to the
           S3 segment of the tubule). SMCT2 may initiate lactate
           absorption in the early parts of the tubule. In the
           retina, SMCT1 and SMCT2 may play a differential role in
           monocarboxylate transport in a cell type-specific
           manner, SMCT2 is expressed exclusively in Muller cells.
           Nicotine transport by hSMCT2 is inhibited by several
           non-steroidal anti-inflammatory drugs. This subgroup
           belongs to the solute carrier 5 (SLC5) transporter
           family.
          Length = 529

 Score = 29.8 bits (67), Expect = 2.2
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 259 SRKTSGGASKSMCVTYVVMCMAMEISA 285
           S K S   SK +C+ + VMC +M ++A
Sbjct: 371 SEKLSTWISKGLCILFGVMCTSMAVAA 397


>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal
           pre-messenger RNA splicing protein 24 (Prp24) and
           similar proteins.  This subfamily corresponds to the
           RRM3 of Prp24, also termed U4/U6
           snRNA-associated-splicing factor PRP24 (U4/U6 snRNP), an
           RNA-binding protein with four well conserved RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains). It
           facilitates U6 RNA base-pairing with U4 RNA during
           spliceosome assembly. Prp24 specifically binds free U6
           RNA primarily with RRMs 1 and 2 and facilitates pairing
           of U6 RNA bases with U4 RNA bases. Additionally, it may
           also be involved in dissociation of the U4/U6 complex
           during spliceosome activation. .
          Length = 78

 Score = 27.6 bits (62), Expect = 2.2
 Identities = 12/43 (27%), Positives = 18/43 (41%), Gaps = 10/43 (23%)

Query: 156 IYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPIN 198
           IY+ NL    F          E  LR +F  +G++  + IP  
Sbjct: 3   IYVRNLD---FKL-------DEDDLRGIFSKFGEVESIRIPKK 35


>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal
           lipases, cholinesterases, etc.)  These enzymes act on
           carboxylic esters (EC: 3.1.1.-). The catalytic apparatus
           involves three residues (catalytic triad): a serine, a
           glutamate or aspartate and a histidine.These catalytic
           residues are responsible for the nucleophilic attack on
           the carbonyl carbon atom of the ester bond. In contrast
           with other alpha/beta hydrolase fold family members,
           p-nitrobenzyl esterase and acetylcholine esterase have a
           Glu instead of Asp at the active site carboxylate.
          Length = 493

 Score = 29.6 bits (67), Expect = 2.3
 Identities = 10/45 (22%), Positives = 19/45 (42%)

Query: 143 NMNEMKPGERPDTIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNY 187
               +K G R +   LS   +K+++  A+   P+      V+  Y
Sbjct: 430 GNPLLKEGLREEEEKLSRTMMKYWANFAKTGNPNTEGNLVVWPAY 474


>gnl|CDD|99799 cd06202, Nitric_oxide_synthase, The ferredoxin-reductase (FNR) like
           C-terminal domain of the nitric oxide synthase (NOS)
           fuses with a heme-containing N-terminal oxidase domain.
           The reductase portion is similar in structure to NADPH
           dependent cytochrome-450 reductase (CYPOR), having an
           inserted connecting sub-domain within the FAD binding
           portion of FNR. NOS differs from CYPOR in a requirement
           for the cofactor tetrahydrobiopterin and unlike most
           CYPOR is dimeric. Nitric oxide synthase produces nitric
           oxide in the conversion of L-arginine to L-citruline.
           NOS has been implicated in a variety of processes
           including cytotoxicity, anti-inflamation,
           neurotransmission, and vascular smooth muscle
           relaxation.
          Length = 406

 Score = 29.6 bits (67), Expect = 2.3
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 9/43 (20%)

Query: 45  ELKITGKSLSNYEVIEKIKYWAQP------EEFSSLKVTKSTL 81
            L++ GK  S YE     K++  P      EEF SL+V  S L
Sbjct: 129 RLEVLGKGSSEYE---DWKWYKNPNILEVLEEFPSLQVPASLL 168


>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ)
           autosomal homologs, DAZL (DAZ-like) and BOULE.  This
           subfamily corresponds to the RRM domain of two Deleted
           in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like)
           and BOULE. BOULE is the founder member of the family and
           DAZL arose from BOULE in an ancestor of vertebrates. The
           DAZ gene subsequently originated from a duplication
           transposition of the DAZL gene. Invertebrates contain a
           single DAZ homolog, BOULE, while vertebrates, other than
           catarrhine primates, possess both BOULE and DAZL genes.
           The catarrhine primates possess BOULE, DAZL, and DAZ
           genes. The family members encode closely related
           RNA-binding proteins that are required for fertility in
           numerous organisms. These proteins contain an RNA
           recognition motif (RRM), also known as RBD (RNA binding
           domain) or RNP (ribonucleoprotein domain), and a varying
           number of copies of a DAZ motif, believed to mediate
           protein-protein interactions. DAZL and BOULE contain a
           single copy of the DAZ motif, while DAZ proteins can
           contain 8-24 copies of this repeat. Although their
           specific biochemical functions remain to be
           investigated, DAZL proteins may interact with
           poly(A)-binding proteins (PABPs), and act as
           translational activators of specific mRNAs during
           gametogenesis.  .
          Length = 80

 Score = 27.6 bits (62), Expect = 2.3
 Identities = 12/47 (25%), Positives = 21/47 (44%), Gaps = 11/47 (23%)

Query: 153 PDTIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPIND 199
           P+ I++  +P             +E  LR  F  +G +++V I I D
Sbjct: 2   PNRIFVGGIPPD----------TTEEELRDFFSRFGSVKDVKI-ITD 37


>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA
           binding motif protein 15B (RBM15B) from vertebrate.
           This subgroup corresponds to the RRM2 of RBM15B, also
           termed one twenty-two 3 (OTT3), a paralog of RNA binding
           motif protein 15 (RBM15), also known as One-twenty two
           protein 1 (OTT1). Like RBM15, RBM15B has
           post-transcriptional regulatory activity. It is a
           nuclear protein sharing with RBM15 the association with
           the splicing factor compartment and the nuclear envelope
           as well as the binding to mRNA export factors NXF1 and
           Aly/REF. RBM15B belongs to the Spen (split end) protein
           family, which shares a domain architecture comprising of
           three N-terminal RNA recognition motifs (RRMs), also
           known as RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), and a C-terminal SPOC (Spen
           paralog and ortholog C-terminal) domain. .
          Length = 85

 Score = 27.6 bits (61), Expect = 2.3
 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%)

Query: 176 SEAMLRRVFQNYGDIREVDIPINDPYRAQMKPY 208
           SE  LRR F  YG I EV   I  P R Q   Y
Sbjct: 21  SEVELRRAFDKYGIIEEV--VIKRPARGQGGAY 51


>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA
           binding protein fox-1 homologs and similar proteins.
           This subfamily corresponds to the RRM of several
           tissue-specific alternative splicing isoforms of
           vertebrate RNA binding protein Fox-1 homologs, which
           show high sequence similarity to the Caenorhabditis
           elegans feminizing locus on X (Fox-1) gene encoding
           Fox-1 protein. RNA binding protein Fox-1 homolog 1
           (RBFOX1), also termed ataxin-2-binding protein 1
           (A2BP1), or Fox-1 homolog A, or
           hexaribonucleotide-binding protein 1 (HRNBP1), is
           predominantly expressed in neurons, skeletal muscle and
           heart. It regulates alternative splicing of
           tissue-specific exons by binding to UGCAUG elements.
           Moreover, RBFOX1 binds to the C-terminus of ataxin-2 and
           forms an ataxin-2/A2BP1 complex involved in RNA
           processing. RNA binding protein fox-1 homolog 2
           (RBFOX2), also termed Fox-1 homolog B, or
           hexaribonucleotide-binding protein 2 (HRNBP2), or
           RNA-binding motif protein 9 (RBM9), or repressor of
           tamoxifen transcriptional activity, is expressed in
           ovary, whole embryo, and human embryonic cell lines in
           addition to neurons and muscle. RBFOX2 activates
           splicing of neuron-specific exons through binding to
           downstream UGCAUG elements. RBFOX2 also functions as a
           repressor of tamoxifen activation of the estrogen
           receptor. RNA binding protein Fox-1 homolog 3 (RBFOX3 or
           NeuN or HRNBP3), also termed Fox-1 homolog C, is a
           nuclear RNA-binding protein that regulates alternative
           splicing of the RBFOX2 pre-mRNA, producing a message
           encoding a dominant negative form of the RBFOX2 protein.
           Its message is detected exclusively in post-mitotic
           regions of embryonic brain. Like RBFOX1, both RBFOX2 and
           RBFOX3 bind to the hexanucleotide UGCAUG elements and
           modulate brain and muscle-specific splicing of exon
           EIIIB of fibronectin, exon N1 of c-src, and
           calcitonin/CGRP. Members in this family also harbor one
           RNA recognition motifs (RRMs), also termed RBDs (RNA
           binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 76

 Score = 27.4 bits (61), Expect = 2.4
 Identities = 11/44 (25%), Positives = 24/44 (54%), Gaps = 10/44 (22%)

Query: 156 IYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIPIND 199
           +++SN+P ++           +  LR++F  +G I +V+I  N+
Sbjct: 3   LHVSNIPFRF----------RDPDLRQMFGQFGPILDVEIIFNE 36


>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the
           p54nrb/PSF/PSP1 family.  This subfamily corresponds to
           the RRM1 of the p54nrb/PSF/PSP1 family, including 54 kDa
           nuclear RNA- and DNA-binding protein (p54nrb or NonO or
           NMT55), polypyrimidine tract-binding protein
           (PTB)-associated-splicing factor (PSF or POMp100),
           paraspeckle protein 1 (PSP1 or PSPC1), which are
           ubiquitously expressed and are conserved in vertebrates.
           p54nrb is a multi-functional protein involved in
           numerous nuclear processes including transcriptional
           regulation, splicing, DNA unwinding, nuclear retention
           of hyperedited double-stranded RNA, viral RNA
           processing, control of cell proliferation, and circadian
           rhythm maintenance. PSF is also a multi-functional
           protein that binds RNA, single-stranded DNA (ssDNA),
           double-stranded DNA (dsDNA) and many factors, and
           mediates diverse activities in the cell. PSP1 is a novel
           nucleolar factor that accumulates within a new
           nucleoplasmic compartment, termed paraspeckles, and
           diffusely distributes in the nucleoplasm. The cellular
           function of PSP1 remains unknown currently. This
           subfamily also includes some p54nrb/PSF/PSP1 homologs
           from invertebrate species, such as the Drosophila
           melanogaster gene no-ontransient A (nonA) encoding
           puff-specific protein Bj6 (also termed NONA) and
           Chironomus tentans hrp65 gene encoding protein Hrp65. D.
           melanogaster NONA is involved in eye development and
           behavior, and may play a role in circadian rhythm
           maintenance, similar to vertebrate p54nrb. C. tentans
           Hrp65 is a component of nuclear fibers associated with
           ribonucleoprotein particles in transit from the gene to
           the nuclear pore. All family members contain a DBHS
           domain (for Drosophila behavior, human splicing), which
           comprises two conserved RNA recognition motifs (RRMs),
           also termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), and a charged
           protein-protein interaction module. PSF has an
           additional large N-terminal domain that differentiates
           it from other family members. .
          Length = 71

 Score = 26.9 bits (60), Expect = 3.2
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 172 PNQPSEAMLRRVFQNYGDIREVDIP 196
           PN  +E   + +F  YG++ EV + 
Sbjct: 10  PNDITEEEFKELFSKYGEVSEVFLN 34


>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE.  This
           subgroup corresponds to the RRM of BOULE, the founder
           member of the human DAZ gene family. Invertebrates
           contain a single BOULE, while vertebrates, other than
           catarrhine primates, possess both BOULE and DAZL genes.
           The catarrhine primates possess BOULE, DAZL, and DAZ
           genes. BOULE encodes an RNA-binding protein containing
           an RNA recognition motif (RRM), also known as RBD (RNA
           binding domain) or RNP (ribonucleoprotein domain), and a
           single copy of the DAZ motif. Although its specific
           biochemical functions remains to be investigated, BOULE
           protein may interact with poly(A)-binding proteins
           (PABPs), and act as translational activators of specific
           mRNAs during gametogenesis. .
          Length = 81

 Score = 27.1 bits (60), Expect = 4.0
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 176 SEAMLRRVFQNYGDIREVDIPIN 198
           +E  LR+ F  YG ++EV I  +
Sbjct: 15  NENDLRKFFSQYGTVKEVKIVND 37


>gnl|CDD|240969 cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 in fungal
           Mei2-like proteins.  This subgroup corresponds to the
           RRM1 of fungal Mei2-like proteins. The Mei2 protein is
           an essential component of the switch from mitotic to
           meiotic growth in the fission yeast Schizosaccharomyces
           pombe. It is an RNA-binding protein that contains three
           RNA recognition motifs (RRMs), also termed RBDs (RNA
           binding domains) or RNPs (ribonucleoprotein domains). In
           the nucleus, S. pombe Mei2 stimulates meiosis upon
           binding a specific non-coding RNA through its C-terminal
           RRM motif. .
          Length = 72

 Score = 26.6 bits (59), Expect = 4.1
 Identities = 6/24 (25%), Positives = 14/24 (58%)

Query: 172 PNQPSEAMLRRVFQNYGDIREVDI 195
           P   S + L+ +F+  GD++ + +
Sbjct: 10  PKDVSTSNLKEIFEKMGDVKGIFV 33


>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding
           protein 19 (RBM19 or RBD-1) and similar proteins.  This
           subfamily corresponds to the RRM5 of RBM19 and RRM4 of
           MRD1. RBM19, also termed RNA-binding domain-1 (RBD-1),
           is a nucleolar protein conserved in eukaryotes involved
           in ribosome biogenesis by processing rRNA and is
           essential for preimplantation development. It has a
           unique domain organization containing 6 conserved RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains). .
          Length = 82

 Score = 26.4 bits (59), Expect = 5.5
 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 10/42 (23%)

Query: 155 TIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDIP 196
           T+++ NL    F T        E  L++ F+  G +R V I 
Sbjct: 2   TLFVKNLN---FKTT-------EETLKKHFEKCGGVRSVTIA 33


>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type
           and RNA-binding motif-containing protein 1 (ZCRB1) and
           similar proteins.  This subfamily corresponds to the RRM
           of ZCRB1, also termed MADP-1, or U11/U12 small nuclear
           ribonucleoprotein 31 kDa protein (U11/U12 snRNP 31 or
           U11/U12-31K), a novel multi-functional nuclear factor,
           which may be involved in morphine dependence, cold/heat
           stress, and hepatocarcinoma. It is located in the
           nucleoplasm, but outside the nucleolus. ZCRB1 is one of
           the components of U11/U12 snRNPs that bind to U12-type
           pre-mRNAs and form a di-snRNP complex, simultaneously
           recognizing the 5' splice site and branchpoint sequence.
           ZCRB1 is characterized by an RNA recognition motif
           (RRM), also termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), and a CCHC-type Zinc finger
           motif. In addition, it contains core nucleocapsid
           motifs, and Lys- and Glu-rich domains.  .
          Length = 78

 Score = 26.1 bits (58), Expect = 6.6
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 10/41 (24%)

Query: 155 TIYLSNLPVKWFSTKARPNQPSEAMLRRVFQNYGDIREVDI 195
           T+Y+SNLP   FS            L ++F  YG + +V I
Sbjct: 3   TVYVSNLP---FSLT-------NNDLHKIFSKYGKVVKVTI 33


>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General
           function prediction only].
          Length = 306

 Score = 27.6 bits (60), Expect = 9.1
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 14/90 (15%)

Query: 115 DGLRVRATEAKPDFPTRHDW----DSYFRDAKNMNEMKPGERPDTIYLSNLPVKWFSTKA 170
           +G  +R  +A+P    R +     D+ F    +  +    E+ D +Y+ NLP+K      
Sbjct: 183 EGRPLRVQKAQPASQPRSELSNNLDASFAKKLSRGKALLLEKSDNLYVGNLPLKT----- 237

Query: 171 RPNQPSEAMLRRVFQNYGDIREVDIPINDP 200
                +E  L  +F++ GDI    +P +  
Sbjct: 238 -----AEEELADLFKSRGDIVRASLPPSKD 262


>gnl|CDD|224110 COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal
           structure and biogenesis].
          Length = 245

 Score = 27.2 bits (61), Expect = 9.2
 Identities = 8/23 (34%), Positives = 13/23 (56%)

Query: 57  EVIEKIKYWAQPEEFSSLKVTKS 79
           EV+ KI+ +A+   F    + KS
Sbjct: 203 EVLSKIENFAKELGFQVKGLIKS 225


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.320    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0783    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 15,301,681
Number of extensions: 1445972
Number of successful extensions: 1182
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1181
Number of HSP's successfully gapped: 51
Length of query: 305
Length of database: 10,937,602
Length adjustment: 97
Effective length of query: 208
Effective length of database: 6,635,264
Effective search space: 1380134912
Effective search space used: 1380134912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (26.4 bits)