Query         psy6599
Match_columns 93
No_of_seqs    156 out of 1060
Neff          7.7 
Searched_HMMs 46136
Date          Fri Aug 16 22:12:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6599.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6599hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4215|consensus              100.0 2.9E-32 6.3E-37  197.8   3.8   81    9-93     13-93  (432)
  2 cd06956 NR_DBD_RXR DNA-binding 100.0 6.9E-32 1.5E-36  160.3   3.9   73   17-93      2-74  (77)
  3 cd06969 NR_DBD_NGFI-B DNA-bind 100.0 5.3E-32 1.2E-36  160.1   3.0   74   16-93      1-74  (75)
  4 cd07163 NR_DBD_TLX DNA-binding 100.0 4.6E-32 9.9E-37  165.8   2.6   81   11-93      2-82  (92)
  5 cd07160 NR_DBD_LXR DNA-binding 100.0 2.1E-31 4.6E-36  165.2   5.1   77   13-93     16-92  (101)
  6 cd07170 NR_DBD_ERR DNA-binding 100.0 1.4E-31   3E-36  165.0   4.2   76   14-93      3-78  (97)
  7 cd06958 NR_DBD_COUP_TF DNA-bin 100.0 1.7E-31 3.6E-36  157.2   3.9   72   18-93      1-72  (73)
  8 cd06959 NR_DBD_EcR_like The DN 100.0 2.8E-31 6.1E-36  156.2   4.9   73   17-93      1-73  (73)
  9 cd07161 NR_DBD_EcR DNA-binding 100.0 2.9E-31 6.2E-36  162.0   4.9   74   16-93      2-75  (91)
 10 cd07155 NR_DBD_ER_like DNA-bin 100.0 1.6E-31 3.5E-36  158.0   3.6   72   18-93      1-72  (75)
 11 cd07179 2DBD_NR_DBD2 The secon 100.0 2.5E-31 5.4E-36  156.8   4.3   72   18-93      1-72  (74)
 12 cd07171 NR_DBD_ER DNA-binding  100.0   2E-31 4.4E-36  159.9   3.9   74   16-93      4-77  (82)
 13 cd06964 NR_DBD_RAR DNA-binding 100.0 7.5E-32 1.6E-36  162.8   1.9   76   14-93      3-78  (85)
 14 cd07172 NR_DBD_GR_PR DNA-bindi 100.0 5.8E-31 1.3E-35  156.6   5.7   75   15-93      2-76  (78)
 15 cd06961 NR_DBD_TR DNA-binding  100.0 2.1E-31 4.6E-36  160.8   3.6   73   17-93      1-73  (85)
 16 cd06962 NR_DBD_FXR DNA-binding 100.0 1.7E-31 3.8E-36  160.8   3.2   74   16-93      2-75  (84)
 17 cd07154 NR_DBD_PNR_like The DN 100.0 1.4E-31 3.1E-36  157.5   2.7   73   18-93      1-73  (73)
 18 cd07158 NR_DBD_Ppar_like The D 100.0   4E-31 8.6E-36  155.6   4.2   72   18-93      1-73  (73)
 19 cd07156 NR_DBD_VDR_like The DN 100.0 3.5E-31 7.5E-36  155.5   3.9   72   18-93      1-72  (72)
 20 cd06963 NR_DBD_GR_like The DNA 100.0 6.1E-31 1.3E-35  154.8   4.6   72   18-93      1-72  (73)
 21 cd06916 NR_DBD_like DNA-bindin 100.0 1.8E-31   4E-36  156.6   2.2   72   18-93      1-72  (72)
 22 cd06955 NR_DBD_VDR DNA-binding 100.0 6.5E-31 1.4E-35  164.4   4.2   78   12-93      3-80  (107)
 23 cd07168 NR_DBD_DHR4_like DNA-b 100.0 6.1E-31 1.3E-35  160.3   3.8   76   14-93      5-80  (90)
 24 cd06967 NR_DBD_TR2_like DNA-bi 100.0 3.3E-31 7.2E-36  160.6   2.3   76   14-93      2-77  (87)
 25 cd07169 NR_DBD_GCNF_like DNA-b 100.0 7.6E-31 1.7E-35  159.8   3.8   77   13-93      4-80  (90)
 26 cd06970 NR_DBD_PNR DNA-binding 100.0 4.6E-31 9.9E-36  161.3   2.5   75   16-93      7-81  (92)
 27 cd07164 NR_DBD_PNR_like_1 DNA- 100.0 1.4E-30   3E-35  155.0   3.5   72   18-93      1-72  (78)
 28 cd07162 NR_DBD_PXR DNA-binding 100.0 2.1E-30 4.6E-35  157.0   4.4   73   17-93      1-73  (87)
 29 cd07173 NR_DBD_AR DNA-binding  100.0 3.5E-30 7.5E-35  154.5   5.1   73   15-91      3-75  (82)
 30 cd06960 NR_DBD_HNF4A DNA-bindi 100.0 8.3E-31 1.8E-35  155.3   2.1   72   18-93      1-72  (76)
 31 cd06957 NR_DBD_PNR_like_2 DNA- 100.0 4.7E-31   1E-35  158.3   0.8   73   18-93      1-73  (82)
 32 cd06968 NR_DBD_ROR DNA-binding 100.0   2E-30 4.4E-35  159.3   3.6   77   13-93      3-79  (95)
 33 cd07166 NR_DBD_REV_ERB DNA-bin 100.0   1E-30 2.2E-35  159.0   2.1   75   15-93      3-78  (89)
 34 cd07167 NR_DBD_Lrh-1_like The  100.0 1.8E-30 3.9E-35  159.0   2.6   72   18-93      1-72  (93)
 35 cd07165 NR_DBD_DmE78_like DNA- 100.0 2.9E-30 6.2E-35  154.6   3.4   72   18-93      1-72  (81)
 36 cd06966 NR_DBD_CAR DNA-binding 100.0 1.6E-30 3.5E-35  159.5   2.2   73   17-93      2-74  (94)
 37 cd07157 2DBD_NR_DBD1 The first 100.0 4.4E-30 9.5E-35  155.4   3.2   73   17-93      2-76  (86)
 38 smart00399 ZnF_C4 c4 zinc fing 100.0 1.7E-29 3.7E-34  147.5   3.8   70   17-90      1-70  (70)
 39 cd06965 NR_DBD_Ppar DNA-bindin 100.0 8.7E-30 1.9E-34  153.5   2.6   71   17-93      1-72  (84)
 40 PF00105 zf-C4:  Zinc finger, C 100.0 2.6E-29 5.7E-34  146.5   3.5   70   16-89      1-70  (70)
 41 KOG4846|consensus              100.0 1.7E-29 3.6E-34  185.9   2.3   74   16-93    133-207 (538)
 42 KOG4216|consensus               99.9 2.2E-28 4.8E-33  178.8   3.2   75   15-93     46-120 (479)
 43 KOG4217|consensus               99.9   8E-28 1.7E-32  179.1   3.8   76   14-93    268-343 (605)
 44 KOG4218|consensus               99.9 3.2E-26   7E-31  165.8   2.9   79   11-93     11-89  (475)
 45 PF10764 Gin:  Inhibitor of sig  74.5     2.5 5.3E-05   22.5   1.5   24   17-40      1-26  (46)
 46 PRK00420 hypothetical protein;  71.4     1.5 3.2E-05   27.7   0.3   31   12-42     20-50  (112)
 47 PF01412 ArfGap:  Putative GTPa  70.5       2 4.4E-05   26.8   0.8   32   13-44     11-45  (116)
 48 KOG2879|consensus               57.2      12 0.00027   27.3   2.8   52    2-56    226-281 (298)
 49 smart00401 ZnF_GATA zinc finge  56.1     7.9 0.00017   20.8   1.3   31   15-45      3-38  (52)
 50 PF03107 C1_2:  C1 domain;  Int  56.0     5.1 0.00011   19.0   0.5   21   17-39      2-22  (30)
 51 cd00729 rubredoxin_SM Rubredox  53.8     5.7 0.00012   19.5   0.5   14   14-27     17-30  (34)
 52 smart00105 ArfGap Putative GTP  52.3     9.5  0.0002   23.6   1.4   30   15-44      3-35  (112)
 53 TIGR00269 conserved hypothetic  50.1     8.5 0.00018   23.5   0.9   21   15-40     80-100 (104)
 54 PTZ00218 40S ribosomal protein  48.6     9.4  0.0002   21.0   0.8   23   16-38     17-40  (54)
 55 PHA03124 dUTPase; Provisional   45.7      11 0.00023   28.8   1.0   16   32-47    190-205 (418)
 56 PLN02915 cellulose synthase A   44.5      16 0.00035   31.2   1.9   36    1-38      1-40  (1044)
 57 PF03002 Somatostatin:  Somatos  42.8     5.9 0.00013   16.9  -0.4   10   37-46      6-15  (18)
 58 PF06677 Auto_anti-p27:  Sjogre  40.3      10 0.00022   19.6   0.2   27   12-38     14-40  (41)
 59 PRK12495 hypothetical protein;  35.7      15 0.00032   25.9   0.4   33   11-44     38-70  (226)
 60 PF00320 GATA:  GATA zinc finge  35.4      17 0.00037   17.9   0.5   16   30-45     17-33  (36)
 61 PF13901 DUF4206:  Domain of un  34.2      25 0.00053   24.1   1.3   34   15-48    152-188 (202)
 62 cd00350 rubredoxin_like Rubred  33.6      16 0.00034   17.6   0.2   14   14-27     16-29  (33)
 63 KOG3277|consensus               33.6      16 0.00035   24.5   0.3   26   17-42     81-114 (165)
 64 PF10013 DUF2256:  Uncharacteri  33.1      28  0.0006   18.2   1.1   13   12-24      5-17  (42)
 65 PF00357 Integrin_alpha:  Integ  32.7      19 0.00041   14.7   0.3    8   40-47      3-10  (15)
 66 PF08273 Prim_Zn_Ribbon:  Zinc-  32.3      22 0.00048   18.2   0.6   24   15-38      3-32  (40)
 67 PRK04179 rpl37e 50S ribosomal   31.3      53  0.0011   18.6   2.1   24   14-39     16-39  (62)
 68 smart00778 Prim_Zn_Ribbon Zinc  30.4      27 0.00058   17.6   0.7   10   15-24      3-12  (37)
 69 PF00628 PHD:  PHD-finger;  Int  30.3     8.3 0.00018   20.0  -1.2   25   18-44      2-26  (51)
 70 TIGR03124 ctirate_citX holo-AC  29.4      23 0.00049   23.7   0.5   13   14-26    129-141 (165)
 71 PRK08359 transcription factor;  27.7      37  0.0008   23.0   1.3   31   14-44      5-42  (176)
 72 PF07649 C1_3:  C1-like domain;  27.5      21 0.00046   16.6   0.1   14   17-30      2-16  (30)
 73 COG1592 Rubrerythrin [Energy p  26.8      20 0.00043   24.2  -0.2   14   13-26    147-160 (166)
 74 PRK01392 citX 2'-(5''-triphosp  26.7      26 0.00056   23.8   0.4   14   13-26    137-150 (180)
 75 PF03802 CitX:  Apo-citrate lya  26.2      26 0.00056   23.4   0.3   13   14-26    131-143 (170)
 76 PTZ00073 60S ribosomal protein  25.8      74  0.0016   19.3   2.2   26   12-39     13-38  (91)
 77 PRK06424 transcription factor;  25.6      29 0.00063   22.7   0.5   27   17-43      2-34  (144)
 78 PRK05766 rps14P 30S ribosomal   25.5      89  0.0019   16.9   2.3   27   12-38     11-38  (52)
 79 PF11781 RRN7:  RNA polymerase   25.1      35 0.00076   16.9   0.6    9   16-24      9-17  (36)
 80 COG2260 Predicted Zn-ribbon RN  25.0      31 0.00067   19.3   0.4   16   14-29     16-31  (59)
 81 PF09180 ProRS-C_1:  Prolyl-tRN  24.8      36 0.00079   19.1   0.7   18   11-28     44-61  (68)
 82 TIGR00270 conserved hypothetic  24.0      33 0.00072   22.6   0.5   25   17-41      2-33  (154)
 83 PRK01343 zinc-binding protein;  23.8      73  0.0016   17.7   1.8   27   14-41      8-34  (57)
 84 PF00130 C1_1:  Phorbol esters/  23.6      20 0.00044   18.6  -0.5   28   14-41     10-37  (53)
 85 COG1997 RPL43A Ribosomal prote  23.5      28 0.00061   21.1   0.1   28   15-42     35-63  (89)
 86 PF10080 DUF2318:  Predicted me  22.7      29 0.00063   21.4   0.1   29   14-42     34-62  (102)
 87 PF06147 DUF968:  Protein of un  22.3      48   0.001   22.7   1.1   18   13-30    125-143 (200)
 88 KOG3116|consensus               22.3      48   0.001   22.2   1.0    9   78-86     29-37  (177)
 89 PF12760 Zn_Tnp_IS1595:  Transp  21.4      47   0.001   17.0   0.7   11   70-80     36-46  (46)
 90 smart00109 C1 Protein kinase C  20.8      89  0.0019   15.3   1.7   25   15-40     11-35  (49)
 91 PF08394 Arc_trans_TRASH:  Arch  20.5      95  0.0021   15.6   1.7   27   18-44      1-35  (37)
 92 TIGR03655 anti_R_Lar restricti  20.4      67  0.0014   17.0   1.2   15   16-30      2-16  (53)

No 1  
>KOG4215|consensus
Probab=99.97  E-value=2.9e-32  Score=197.78  Aligned_cols=81  Identities=43%  Similarity=1.027  Sum_probs=76.0

Q ss_pred             CCCCCCCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCC
Q psy6599           9 LGDRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMN   88 (93)
Q Consensus         9 ~~~~~~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~   88 (93)
                      .+++.....|.||||+++|.|||+.+|++||+||||+|.++..|+|+.+.    +|.|+++.|+.||||||+||+.+||+
T Consensus        13 ~~~s~~~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk~~~YtCRF~k----~C~VDKdkRNaCRyCRfqKC~~aGMK   88 (432)
T KOG4215|consen   13 QSSSGVAEFCAICGDKATGKHYGAISCDGCKGFFRRSVRKNHQYTCRFNK----QCVVDKDKRNACRYCRFQKCVRAGMK   88 (432)
T ss_pred             CCcccccchhheeCCcccccccceeecCcchHHHHHHHHhcceeeeeccc----cccccchhhhhhhHhhHHHHHHhccc
Confidence            34445889999999999999999999999999999999999999999886    69999999999999999999999999


Q ss_pred             CCCCC
Q psy6599          89 KDDFK   93 (93)
Q Consensus        89 ~~~vq   93 (93)
                      ++|||
T Consensus        89 ~eAiQ   93 (432)
T KOG4215|consen   89 REAIQ   93 (432)
T ss_pred             HHhhh
Confidence            99997


No 2  
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=99.97  E-value=6.9e-32  Score=160.29  Aligned_cols=73  Identities=49%  Similarity=1.210  Sum_probs=69.0

Q ss_pred             CceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          17 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        17 ~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      +|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         2 ~C~VC~~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~   74 (77)
T cd06956           2 ICAICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK----DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQ   74 (77)
T ss_pred             CCcccCCcCcceEECceeehhHHHHHHHHhhCCCccccCCCC----ccccCCCccccCccchhHHHhHhCCCHHHhc
Confidence            699999999999999999999999999999999999998764    6999999999999999999999999999887


No 3  
>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B. DNA-binding domain (DBD) of the orphan nuclear receptor, nerve growth factor-induced-B (NGFI-B) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NGFI-B interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. NGFI-B is a member of the nuclear-steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcrip
Probab=99.97  E-value=5.3e-32  Score=160.06  Aligned_cols=74  Identities=45%  Similarity=1.081  Sum_probs=69.3

Q ss_pred             CCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          16 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        16 ~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      .+|.|||++++++|||+.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         1 ~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~   74 (75)
T cd06969           1 GLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANK----NCPVDKRRRNRCQYCRFQKCLQVGMVKEVVR   74 (75)
T ss_pred             CCCeecCCcCcceEECcceeeeeeeeeeeeeecCCcccCCcCC----ccccCCcccccCcccHhHHHHHhCCCHHHcc
Confidence            3699999999999999999999999999999988889998764    6999999999999999999999999999987


No 4  
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=99.97  E-value=4.6e-32  Score=165.83  Aligned_cols=81  Identities=78%  Similarity=1.514  Sum_probs=73.3

Q ss_pred             CCCCCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCC
Q psy6599          11 DRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD   90 (93)
Q Consensus        11 ~~~~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~   90 (93)
                      +++...+|.|||++++++||||.+|+||++||||++..+..|.|..+++  ++|.++...|..|++|||+|||++||+++
T Consensus         2 ~~~~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~~--~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~   79 (92)
T cd07163           2 SRILDIPCKVCGDRSSGKHYGIYACDGCSGFFKRSIRRNRQYVCKSKGQ--GGCPVDKTHRNQCRACRLKKCFEVGMNKD   79 (92)
T ss_pred             CcccCCCCcccCCcCcccEECceeeeeeeeEEeeeecCCCCcCCCCCCC--CCCccCCCccccCccchhhhhhhhcCCHH
Confidence            5567889999999999999999999999999999999888999987421  36999998899999999999999999999


Q ss_pred             CCC
Q psy6599          91 DFK   93 (93)
Q Consensus        91 ~vq   93 (93)
                      +||
T Consensus        80 ~Vq   82 (92)
T cd07163          80 AVQ   82 (92)
T ss_pred             Hhh
Confidence            886


No 5  
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=99.97  E-value=2.1e-31  Score=165.18  Aligned_cols=77  Identities=43%  Similarity=0.966  Sum_probs=71.7

Q ss_pred             CCCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCC
Q psy6599          13 LLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDF   92 (93)
Q Consensus        13 ~~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~v   92 (93)
                      +...+|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++|
T Consensus        16 ~~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V   91 (101)
T cd07160          16 LGNEVCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAQYVCKNGG----KCQMDMYMRRKCQECRLRKCREAGMREQCV   91 (101)
T ss_pred             cCCCCCeecCCcCcceEECcceehhhhhhhhhcccccCccccCCCC----ccccCCcccccCccchhHHHHHhCCCHHHh
Confidence            4567899999999999999999999999999999988999999865    699999999999999999999999999988


Q ss_pred             C
Q psy6599          93 K   93 (93)
Q Consensus        93 q   93 (93)
                      |
T Consensus        92 ~   92 (101)
T cd07160          92 L   92 (101)
T ss_pred             c
Confidence            6


No 6  
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=99.97  E-value=1.4e-31  Score=164.97  Aligned_cols=76  Identities=45%  Similarity=0.946  Sum_probs=70.4

Q ss_pred             CCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          14 LDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      ...+|.|||++++|+||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         3 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~vq   78 (97)
T cd07170           3 PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATN----ECEITKRRRKSCQACRFMKCLKVGMLKEGVR   78 (97)
T ss_pred             CCCCCeecCCcCcceEECceeehhhhHHHHHHhccCCceeecCCC----ccccCcccCccCCccccchhhhcCCCHHHcc
Confidence            346799999999999999999999999999999998889998764    6999999999999999999999999999886


No 7  
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. COUP-TFs homodimerize or heterodimerize with retinoid X receptor (RXR) and a few other nuclear receptors and bind to a variety of response elements that are composed of imperfect AGGTCA direct or inverted repeats with various spacings. COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone recept
Probab=99.97  E-value=1.7e-31  Score=157.20  Aligned_cols=72  Identities=56%  Similarity=1.271  Sum_probs=68.0

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++||||.+|+||++||||++..+..|.|..++    +|.++...+..|++|||+|||++||++++||
T Consensus         1 C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~   72 (73)
T cd06958           1 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRGNR----NCPIDQHHRNQCQYCRLKKCLKVGMRREAVQ   72 (73)
T ss_pred             CCccCccCcceEEChhhhhhhhhhhhhhhcCCCceeCCCCC----cCccCCcccccCccchhhHhhHhCCCHHHcc
Confidence            78999999999999999999999999999998889998764    6999999999999999999999999999987


No 8  
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: Ecdysone receptor (EcR), Liver X receptor (LXR) and Farnesoid X receptor (FXR). The DNA binding activity is regulated by their corresponding ligands. The ligands for EcR are ecdysteroids; LXR is regulated by oxidized cholesterol derivatives or oxysterols; and bile acids control FXR's activities. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcR-like receptors have  a central well conserved DNA binding domai
Probab=99.97  E-value=2.8e-31  Score=156.22  Aligned_cols=73  Identities=47%  Similarity=1.065  Sum_probs=68.4

Q ss_pred             CceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          17 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        17 ~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      +|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.++...+..|++|||+|||++||+++.|+
T Consensus         1 ~C~vCg~~~~~~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~   73 (73)
T cd06959           1 NCVVCGDKASGFHYGVLSCEGCKGFFRRSVTKGAVYACKFGN----KCEMDMYMRRKCQECRLRKCKAAGMRPDCLL   73 (73)
T ss_pred             CCceeCCcCcceEECceeehhhHHHHHHhhcCCCCccCCCCC----cCCcCCcccccCccchhHHHHHhCCChhhcC
Confidence            599999999999999999999999999999988889998764    6999999999999999999999999999875


No 9  
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers. DNA-binding domain of Ecdysone receptor (EcR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with highly degenerate pseudo-palindromic response elements, resembling inverted repeats of 5'-AGGTCA-3' separated by 1 bp, upstream of the target gene and modulates the rate of transcriptional initiation. EcR is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. EcR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of EcR are ecdysteroids, the endogenous steroidal hormones found in invertebrates. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcRs h
Probab=99.97  E-value=2.9e-31  Score=161.98  Aligned_cols=74  Identities=43%  Similarity=0.980  Sum_probs=69.6

Q ss_pred             CCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          16 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        16 ~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      ++|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         2 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~   75 (91)
T cd07161           2 ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYHCKYGR----ACEMDMYMRRKCQECRLKKCLSVGMRPECVV   75 (91)
T ss_pred             CCCeeCCCcCcceEECceeehhhHHHHHHHhccCCceecCCCC----ccccCccccccCccchhhHHhHcCCCHHHcC
Confidence            5699999999999999999999999999999999999998764    6999999999999999999999999999886


No 10 
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=99.97  E-value=1.6e-31  Score=157.98  Aligned_cols=72  Identities=47%  Similarity=1.059  Sum_probs=68.0

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++|||+.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         1 C~VC~~~~~g~hygv~sC~aCk~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~   72 (75)
T cd07155           1 CLVCGDIASGYHYGVASCEACKAFFKRTIQGNLGYSCPSTS----ECEVDKKRRKSCQACRLQKCLKVGMLKEGVR   72 (75)
T ss_pred             CcccCccCcceEEChhhhhhhHHHHHHHhhCCCceeCCcCC----CcccCCcccccCccchhhhhhHhCCCHHHcc
Confidence            78999999999999999999999999999988899998765    6999999999999999999999999999886


No 11 
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers. The second DNA-binding domain (DBD) of the 2DBD nuclear receptor (NR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. The proteins contain two DBDs in tandem, probably resulting from an ancient recombination event.  The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=99.97  E-value=2.5e-31  Score=156.82  Aligned_cols=72  Identities=39%  Similarity=1.024  Sum_probs=67.9

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++||||.+|+||++||||++..+..|.|..++    +|.++...+..|++|||+|||++||++++|+
T Consensus         1 C~VCg~~~~g~hygv~sC~aC~~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~   72 (74)
T cd07179           1 CRVCGGKSSGFHFGALTCEGCKGFFRRTELSSNSYVCPGGQ----NCAITPATRNACKSCRFRRCLAVGMSKTGSR   72 (74)
T ss_pred             CcccCccCcceEECceeehhHHHHHHHHhhCCCcccCCCCC----ccccCCcccccCccchhHHHHHhCCCHhHee
Confidence            78999999999999999999999999999999999999865    5999999999999999999999999999985


No 12 
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=99.97  E-value=2e-31  Score=159.91  Aligned_cols=74  Identities=49%  Similarity=1.060  Sum_probs=69.2

Q ss_pred             CCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          16 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        16 ~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      .+|.|||++++++|||+.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         4 ~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~   77 (82)
T cd07171           4 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATN----QCTIDKNRRKSCQACRLRKCYEVGMMKGGIR   77 (82)
T ss_pred             CCCeecCCcCcceEECceeehhhHHhHHHHeeCCCceeCCCCC----ccccCCcccccCccchhHHHhHhcCCHHHHH
Confidence            5799999999999999999999999999999998899998764    6999999999999999999999999999875


No 13 
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. RARs mediate the biological effect of retinoids, including both natural dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RAR function as a heterodimer with retinoic X receptor by binding to specific RAR response elements (RAREs), which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair and found in the promoter reg
Probab=99.97  E-value=7.5e-32  Score=162.76  Aligned_cols=76  Identities=51%  Similarity=1.133  Sum_probs=70.4

Q ss_pred             CCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          14 LDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      .+.+|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         3 ~~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~   78 (85)
T cd06964           3 IYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDK----NCIINKVTRNRCQYCRLQKCFEVGMSKESVR   78 (85)
T ss_pred             cCCCCcccCCcCcccEECcceeeeeeeEEeeeecCCCCeECCCCC----ccccCCcccccCccchhhhhhhhCCCHHHhh
Confidence            346899999999999999999999999999999988889998765    6999999999999999999999999999886


No 14 
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=99.97  E-value=5.8e-31  Score=156.62  Aligned_cols=75  Identities=43%  Similarity=0.919  Sum_probs=69.4

Q ss_pred             CCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          15 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        15 ~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      ..+|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++.+++
T Consensus         2 ~~~C~VCg~~a~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~~~   76 (78)
T cd07172           2 QKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRN----DCIIDKIRRKNCPACRLRKCLQAGMNLGARK   76 (78)
T ss_pred             CCCCeecCCcCcceEECceeehhhHHhHHHHeeCCCceeCCCCC----ccccCCcccccCccchhHHHHHhCCCccccc
Confidence            45799999999999999999999999999999999999998764    6999999999999999999999999998864


No 15 
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TR interacts with the thyroid response element, which is a DNA site with direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pairs, upstream of target genes and modulates the rate of transcriptional initiation. Thyroid hormone receptor (TR) mediates the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the he
Probab=99.97  E-value=2.1e-31  Score=160.81  Aligned_cols=73  Identities=48%  Similarity=1.149  Sum_probs=68.9

Q ss_pred             CceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          17 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        17 ~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      +|.|||++++++|||+.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         1 ~C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~   73 (85)
T cd06961           1 PCVVCGDKATGYHYRCITCEGCKGFFRRTVQKKLSYSCKGEG----KCEIDKVTRNQCQECRFKKCIAVGMAKDLVL   73 (85)
T ss_pred             CCceeCCcCcceEEChhhhhhhhHhhHhhhccCCccccCCCC----ccccCccccccCccchhhhhhhccCCHHHcc
Confidence            599999999999999999999999999999999999999865    6999999999999999999999999999886


No 16 
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. FXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  FXR is a member of the nuclear receptor family of ligand activated transcription factors. Bile acids are endogenous ligands for FXRs. Upon binding of a ligand, FXR binds to FXR response element (FXRE), which is an inverted repeat of TGACCT spaced by one nucleotide, either as a monomer or as a heterodimer with retinoid X receptor (RXR), to regulate the expression of various genes involved in bile acid, lipid, and glucose metabolism. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, FXR has a central well conserved 
Probab=99.97  E-value=1.7e-31  Score=160.85  Aligned_cols=74  Identities=46%  Similarity=1.006  Sum_probs=69.4

Q ss_pred             CCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          16 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        16 ~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      ++|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         2 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~   75 (84)
T cd06962           2 ELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGG----NCEMDMYMRRKCQECRLRKCKEMGMLAECLL   75 (84)
T ss_pred             CCCeecCCcCcceEECcceeecceeeeeeeeccCCceecCCCC----cCccCccccccCccchhhHHHHhCCChHHcc
Confidence            5799999999999999999999999999999988899998765    6999998899999999999999999999886


No 17 
>cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear
Probab=99.97  E-value=1.4e-31  Score=157.47  Aligned_cols=73  Identities=71%  Similarity=1.399  Sum_probs=67.5

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++|||+.+|+||++||||++..+..|.|...+   ++|.|+...+..|++|||+|||++||++++||
T Consensus         1 C~vCg~~~~~~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~---~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~vq   73 (73)
T cd07154           1 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNLLYTCKAGN---GSCVVDKARRNQCQACRLKKCLEVSMNKDAVQ   73 (73)
T ss_pred             CcccCccCcceEECcceeeeeeeEeeeeecCCCCcccCCCC---CCCccCCcccccCccchhhHhhHhCCChHHCC
Confidence            78999999999999999999999999999999999998432   26999999999999999999999999999997


No 18 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=99.97  E-value=4e-31  Score=155.57  Aligned_cols=72  Identities=47%  Similarity=1.164  Sum_probs=67.9

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCcee-ccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVY-TCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~-~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++||||.+|++|++||||++..+..| .|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         1 C~VCg~~~~g~hyGv~~C~aC~~FFRR~v~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~   73 (73)
T cd07158           1 CKVCGDKASGFHYGVHSCEGCKGFFRRTIQHNLTYRRCLNGG----KCVIQRKNRNRCQYCRFKKCLSVGMSRNAVR   73 (73)
T ss_pred             CcccCccCcceEECcchhhHHHHHHhhhhcCCCCcccCCCCC----CcCCCccccccCccchhhhhhHccCChHHcC
Confidence            78999999999999999999999999999998888 898765    5999999999999999999999999999986


No 19 
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=99.97  E-value=3.5e-31  Score=155.48  Aligned_cols=72  Identities=46%  Similarity=1.083  Sum_probs=67.5

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++||||.+|+||++||||++..+..|.|..++    +|.++...+..|++|||+|||++||++++|.
T Consensus         1 C~VC~~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~   72 (72)
T cd07156           1 CGVCGDRATGYHFNAMTCEGCKGFFRRSMKRKARFTCPFNG----DCEITKDNRRHCQACRLKKCLDIGMKKEMIL   72 (72)
T ss_pred             CCccCccCcccEECcceehhhhhhhchhccCcCccccCCCC----ccccCCcccccCccchhHHHHHhCCCHHHcC
Confidence            78999999999999999999999999999988889998764    6999999999999999999999999999874


No 20 
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and sha
Probab=99.97  E-value=6.1e-31  Score=154.81  Aligned_cols=72  Identities=43%  Similarity=0.983  Sum_probs=67.5

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||+++++.
T Consensus         1 C~VCg~~a~~~hygv~sC~aCk~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~a~~   72 (73)
T cd06963           1 CLICGDEASGCHYGVLTCGSCKVFFKRAAEGQHNYLCAGRN----DCIIDKIRRKNCPACRLRKCYQAGMTLGARK   72 (73)
T ss_pred             CcccCccCcceEECceeehhhhHhHHHhhcCCCceeCCCCC----ccccCCcccccCccchhhHHHHcCCChhhcc
Confidence            78999999999999999999999999999999889998765    6999999999999999999999999999873


No 21 
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with a specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. Nuclear receptors form a superfamily of ligand-activated transcription regulators, which regulate various physiological functions, from development, reproduction, to homeostasis and metabolism in animals (metazoans). The family contains not only receptors for known ligands but also orphan receptors for which ligands do not exist or have not been identified. NRs share a common structural organization with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).  Most nuclear receptors bind as homodimers or hetero
Probab=99.96  E-value=1.8e-31  Score=156.64  Aligned_cols=72  Identities=56%  Similarity=1.255  Sum_probs=68.2

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         1 C~vC~~~~~~~hygv~sC~aC~~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~   72 (72)
T cd06916           1 CAVCGDKASGYHYGVLTCEGCKGFFRRSVRRNLEYTCPAGG----NCVIDKRNRNRCQACRLKKCLAVGMRKEAVR   72 (72)
T ss_pred             CCccCccCcccEECcceeeeeeeeEeEeecCCCCccCCCCC----ccccCCcccccCccchhhHhhHhCCChHHcC
Confidence            78999999999999999999999999999988889998765    6999999999999999999999999999997


No 22 
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=99.96  E-value=6.5e-31  Score=164.42  Aligned_cols=78  Identities=42%  Similarity=0.971  Sum_probs=71.5

Q ss_pred             CCCCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCC
Q psy6599          12 RLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDD   91 (93)
Q Consensus        12 ~~~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~   91 (93)
                      ...+.+|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++
T Consensus         3 ~~~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~   78 (107)
T cd06955           3 RNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNG----DCRITKDNRRHCQACRLKRCVDIGMMKEF   78 (107)
T ss_pred             CCCCCCCeecCCcCcccEECcceeeeecceecceeccCCccccCCCC----ccccccCCccccccchhHHHHHcCCCchh
Confidence            34668899999999999999999999999999999999999998764    69999988999999999999999999987


Q ss_pred             CC
Q psy6599          92 FK   93 (93)
Q Consensus        92 vq   93 (93)
                      |+
T Consensus        79 v~   80 (107)
T cd06955          79 IL   80 (107)
T ss_pred             cc
Confidence            75


No 23 
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=99.96  E-value=6.1e-31  Score=160.28  Aligned_cols=76  Identities=43%  Similarity=1.045  Sum_probs=70.5

Q ss_pred             CCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          14 LDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      .+.+|.|||++++++|||+.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         5 ~~~~C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~   80 (90)
T cd07168           5 SPKLCSICEDKATGLHYGIITCEGCKGFFKRTVQNKRVYTCVGDG----RCEITKAQRNRCQYCRFRKCIRKGMMLAAVR   80 (90)
T ss_pred             cCCCCcccCCcCcceEECceehhhhhHhhhhhhcCCCCccCCCCC----CccccccccccccccchhhhhhcCCCHHHhh
Confidence            456799999999999999999999999999999998899999764    6999999999999999999999999998876


No 24 
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or
Probab=99.96  E-value=3.3e-31  Score=160.56  Aligned_cols=76  Identities=50%  Similarity=1.085  Sum_probs=70.3

Q ss_pred             CCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          14 LDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      ..++|.|||++++++|||+.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         2 ~~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~Vq   77 (87)
T cd06967           2 PVELCVVCGDKASGRHYGAVSCEGCKGFFKRSIRKNLGYSCRGSK----DCVINKHHRNRCQYCRLQKCLAMGMKSDSVQ   77 (87)
T ss_pred             CCCCCeecCCcCCcCEeCcceEeeeeeEeeeeeeCCCCcccCCCC----ccccCccccccCccchhhhhhHcCCCHHHhc
Confidence            346799999999999999999999999999999988889998764    6999999999999999999999999999886


No 25 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=99.96  E-value=7.6e-31  Score=159.83  Aligned_cols=77  Identities=47%  Similarity=1.066  Sum_probs=71.2

Q ss_pred             CCCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCC
Q psy6599          13 LLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDF   92 (93)
Q Consensus        13 ~~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~v   92 (93)
                      ....+|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++|
T Consensus         4 ~~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v   79 (90)
T cd07169           4 AEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDK----NCVMSRKQRNRCQYCRLLKCLQMGMNRKAI   79 (90)
T ss_pred             ccCCCCeecCCcCcceEECcceehhhHHHHHHHhcCCCceecCCCC----cccccccccccccccchhhhccccCCHHHh
Confidence            4567799999999999999999999999999999999999998764    699999999999999999999999999988


Q ss_pred             C
Q psy6599          93 K   93 (93)
Q Consensus        93 q   93 (93)
                      |
T Consensus        80 ~   80 (90)
T cd07169          80 R   80 (90)
T ss_pred             c
Confidence            6


No 26 
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hing
Probab=99.96  E-value=4.6e-31  Score=161.34  Aligned_cols=75  Identities=64%  Similarity=1.367  Sum_probs=69.1

Q ss_pred             CCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          16 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        16 ~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      ++|.|||++++++|||+.+|+||++||||++..+..|.|..+.   ++|.++...|..|++|||+|||++||++++||
T Consensus         7 ~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~---~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~   81 (92)
T cd06970           7 LLCRVCGDTSSGKHYGIYACNGCSGFFKRSVRRKLIYRCQAGT---GMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQ   81 (92)
T ss_pred             CCCeecCCcCcccEECccEEeeeeeEeeeeeecCCCceeecCC---CcCccCCCccccCccchhhHhhHhCCCHHHcc
Confidence            4699999999999999999999999999999999999998752   26999998899999999999999999999886


No 27 
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-t
Probab=99.96  E-value=1.4e-30  Score=155.00  Aligned_cols=72  Identities=61%  Similarity=1.294  Sum_probs=67.8

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++|||+.+|++|++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         1 C~VCg~~~~g~hyG~~~C~~C~~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~   72 (78)
T cd07164           1 CRVCGDRASGKHYGVPSCDGCRGFFKRSIRRNLAYVCKENG----SCVVDVARRNQCQACRFKKCLQVNMNRDAVQ   72 (78)
T ss_pred             CcccCccCcceEECcchhhhhhhhhhhhccCCCCccCCCCC----cccccCcccccCccchhhhhhHhcCCHHHhc
Confidence            78999999999999999999999999999988899998865    6999999999999999999999999999886


No 28 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=99.96  E-value=2.1e-30  Score=157.02  Aligned_cols=73  Identities=45%  Similarity=1.023  Sum_probs=68.2

Q ss_pred             CceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          17 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        17 ~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      +|.|||++++++|||+.+|+||++||||++..+..|.|..++    +|.++...+..|++|||+|||++||++++||
T Consensus         1 ~C~VCg~~~~g~hygv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~   73 (87)
T cd07162           1 ICRVCGDRATGYHFNAMTCEGCKGFFRRAMKRNARLCCPFQK----GCVITKSNRRQCQACRLRKCLSIGMKKELIM   73 (87)
T ss_pred             CCcccCCcCcceEECcceehhhHHHHHhhhccCceeEcCCCC----ceecCCcccccCccchhhHHhHhCCCHHHcc
Confidence            499999999999999999999999999999988889998764    5999999999999999999999999999875


No 29 
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=99.96  E-value=3.5e-30  Score=154.54  Aligned_cols=73  Identities=41%  Similarity=0.960  Sum_probs=67.5

Q ss_pred             CCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCC
Q psy6599          15 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDD   91 (93)
Q Consensus        15 ~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~   91 (93)
                      ..+|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||+++.
T Consensus         3 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~   75 (82)
T cd07173           3 QKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN----DCTIDKFRRKNCPSCRLRKCFEAGMTLGA   75 (82)
T ss_pred             CCCCeecCCcCcceEECcchhhhHHHHHHHHhcCCCceecCCCC----ccccCCCccCcCcchhhhhhhhcCCCcCh
Confidence            35699999999999999999999999999999999999998765    69999999999999999999999999874


No 30 
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is
Probab=99.96  E-value=8.3e-31  Score=155.26  Aligned_cols=72  Identities=53%  Similarity=1.261  Sum_probs=67.8

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         1 C~vCg~~~~~~hygv~~C~aC~~FFrR~~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v~   72 (76)
T cd06960           1 CAVCGDRATGKHYGVLSCNGCKGFFRRSVRKNRTYTCRFGG----NCVVDKDKRNACRYCRFKKCLEVGMDPEAVQ   72 (76)
T ss_pred             CCccCccCcccEECcceeeeehheeCccccCCCceeCCCCC----cccccCcccccCccchhhhhhhcCCCHHHcc
Confidence            78999999999999999999999999999988899998765    6999999999999999999999999999886


No 31 
>cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members 
Probab=99.96  E-value=4.7e-31  Score=158.34  Aligned_cols=73  Identities=58%  Similarity=1.230  Sum_probs=67.5

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++||||.+|+||++||||++..+..|.|...+   ++|.|+...+..|++|||+|||++||++++||
T Consensus         1 C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~C~~~~---~~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~v~   73 (82)
T cd06957           1 CKVCGDKSYGKHYGVYCCDGCSCFFKRSVRKGIIYTCIAGN---GNCVVDKARRNWCPFCRLQKCFAVGMNRAAVQ   73 (82)
T ss_pred             CCccCccCcceEECcceEeeeeeEEEEeecCCCceEccCcc---CCCccCCCccCcccCcchhhcccccCCHHHhc
Confidence            78999999999999999999999999999998999998532   26999999999999999999999999999886


No 32 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=99.96  E-value=2e-30  Score=159.32  Aligned_cols=77  Identities=52%  Similarity=1.159  Sum_probs=71.1

Q ss_pred             CCCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCC
Q psy6599          13 LLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDF   92 (93)
Q Consensus        13 ~~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~v   92 (93)
                      +...+|.|||++++++|||+.+|++|++||||++..+..|.|..++    +|.++...+..|++|||+|||++||++++|
T Consensus         3 ~~~~~C~VCg~~~~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~V   78 (95)
T cd06968           3 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNVSYSCPRQK----NCLIDRTNRNRCQHCRLQKCLALGMSRDAV   78 (95)
T ss_pred             ccccCCcccCCcCcceEECceeehhhHHhhHHheeCCCceecCCCc----ccccccCCceeccccchhhcccccCChhhc
Confidence            3456899999999999999999999999999999988889998764    699999999999999999999999999988


Q ss_pred             C
Q psy6599          93 K   93 (93)
Q Consensus        93 q   93 (93)
                      |
T Consensus        79 ~   79 (95)
T cd06968          79 K   79 (95)
T ss_pred             c
Confidence            6


No 33 
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers. DNA-binding domain of REV-ERB receptor- like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. REV-ERB receptors are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. REV-ERB receptors bind as a monomer to a (A/G)GGTCA half-site with a 5' AT-rich extension or as a homodimer to a direct repeat 2 element (AGGTCA sequence with a 2-bp spacer), indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target genes. The porphyr
Probab=99.96  E-value=1e-30  Score=158.98  Aligned_cols=75  Identities=44%  Similarity=1.074  Sum_probs=69.3

Q ss_pred             CCCceecCCCCceeeeCcccchhhhhhhhhhhccCcee-ccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          15 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVY-TCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        15 ~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~-~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      ..+|.|||++++++|||+.+|+||++||||++..+..| .|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         3 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~   78 (89)
T cd07166           3 VVLCKVCGDKASGFHYGVHACEGCKGFFRRSIQQKIQYRKCTKNE----TCSIMRINRNRCQYCRFKKCLAVGMSRDAVR   78 (89)
T ss_pred             CCCCcccCccCcceEEChhhhhhHhhEecceeEcCCcchhhccCC----cccccccccccccchhhhhcccccCCHHHhc
Confidence            46799999999999999999999999999999988888 598765    6999999999999999999999999999886


No 34 
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This nuclear receptor family includes at least three subgroups of receptors that function in embryo development and differentiation, and other processes. FTZ-F1 interacts with the cis-acting DNA motif of ftz gene, which is required at several stages of development. Particularly, FTZ-F1 regulated genes are strongly linked to steroid biosynthesis and sex-determination; LRH-1 is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development; SF-1 is an essential regu
Probab=99.96  E-value=1.8e-30  Score=158.97  Aligned_cols=72  Identities=44%  Similarity=1.097  Sum_probs=67.9

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++||||.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         1 C~VCg~~a~g~hyGv~sC~aCk~FFRRsv~~~~~~~C~~~~----~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~Vq   72 (93)
T cd07167           1 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKRYTCIENQ----NCQIDKTQRKRCPYCRFQKCLSVGMKLEAVR   72 (93)
T ss_pred             CcccCccCcceEECchhhhhHHHHHHHHeeCCCccccCCCC----ccccCccccCcCCCcccchhhhccCCHHHhh
Confidence            78999999999999999999999999999999999999865    6999999999999999999999999998876


No 35 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=99.96  E-value=2.9e-30  Score=154.63  Aligned_cols=72  Identities=50%  Similarity=1.175  Sum_probs=67.9

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      |.|||++++++|||+.+|+||++||||++..+..|.|..++    +|.|+...+..|++|||+|||++||++++||
T Consensus         1 C~VCg~~~~g~hyG~~sC~aC~~FFRR~~~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~vGM~~~~V~   72 (81)
T cd07165           1 CKVCGDKASGYHYGVTSCEGCKGFFRRSIQKQIEYRCLRDG----KCEIIRLNRNRCQYCRFKKCLAAGMSKDSVR   72 (81)
T ss_pred             CCccCccCcceEECchhhhhHHHHHHhHhccCCceeCCCCC----CccccccccccccchhhhhcccccCCHHHcc
Confidence            78999999999999999999999999999988889998865    6999999999999999999999999999886


No 36 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=99.96  E-value=1.6e-30  Score=159.53  Aligned_cols=73  Identities=34%  Similarity=0.875  Sum_probs=68.7

Q ss_pred             CceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          17 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        17 ~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      +|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.++...+..|++|||+|||++||++++||
T Consensus         2 ~C~VCg~~a~g~hyGv~sC~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~V~   74 (94)
T cd06966           2 ICGVCGDKALGYNFNAITCESCKAFFRRNALKNKEFKCPFNE----SCEINVVTRRFCQKCRLDKCFAIGMKKEWIM   74 (94)
T ss_pred             CCeeCCCcCcceEECcceeeeehheehhcccCCCccccCCCC----ccccCccccccCccchhhhCcccCCCHHHcc
Confidence            699999999999999999999999999999988889999765    6999999999999999999999999999886


No 37 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=99.96  E-value=4.4e-30  Score=155.35  Aligned_cols=73  Identities=38%  Similarity=0.883  Sum_probs=66.4

Q ss_pred             CceecCCCCceeeeCcccchhhhhhhhhhhccCc--eeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          17 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNR--VYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        17 ~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~--~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      +|.|||++++++||||.+|+||++||||++..+.  .|.|..++    +|.++...+..|++|||+|||++||++++++
T Consensus         2 ~C~VCg~~a~g~hyGv~sC~aCk~FFRR~~~~~~~~~~~C~~~~----~C~i~~~~r~~Cr~CR~~KCl~vGM~~~~~~   76 (86)
T cd07157           2 TCQVCGEPAAGFHHGAYVCEACKKFFMRSSNAISFTISECPNGG----KCIIDKKNRTKCQACRYRKCLNVGMSLGGPR   76 (86)
T ss_pred             CCcccCCcCcccEECcceeeEeeeEEecceecCCCccccCCCCC----ccccCccccccCccchhhHHhHcCCCccccc
Confidence            6999999999999999999999999999998664  78898764    6999988899999999999999999988764


No 38 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=99.95  E-value=1.7e-29  Score=147.50  Aligned_cols=70  Identities=43%  Similarity=1.019  Sum_probs=65.5

Q ss_pred             CceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCC
Q psy6599          17 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD   90 (93)
Q Consensus        17 ~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~   90 (93)
                      +|.|||++++++||||.+|+||++||||++..+..|.|..++    +|.++...+..|++|||+|||++||+++
T Consensus         1 ~C~vC~~~~~~~hygv~~C~aC~~FFRR~v~~~~~~~C~~~~----~C~i~~~~r~~C~~CR~~KCl~~GM~~~   70 (70)
T smart00399        1 LCCVCGDHASGFHFGVCSCRACKAFFRRTVNLRYKYRCDRKN----NCSINKRYRCRCRACRLKKCLGVGMDPE   70 (70)
T ss_pred             CCeEeCCcCcccEeCCcEechhhhhhhhheeCCCCeecCCCc----ccccCCCccccCccCcChhHhhccCcCC
Confidence            599999999999999999999999999999988889999875    5999999999999999999999999975


No 39 
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=99.95  E-value=8.7e-30  Score=153.46  Aligned_cols=71  Identities=45%  Similarity=1.125  Sum_probs=65.6

Q ss_pred             CceecCCCCceeeeCcccchhhhhhhhhhhccCceec-cccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          17 PCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYT-CKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        17 ~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~-C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      +|.|||++++++||||.+|+||++||||++..+..|. |..      .|.|+...+..|++|||+|||++||++++||
T Consensus         1 ~C~VCg~~~~g~hyGv~sC~aCk~FFRR~v~~~~~~~~C~~------~C~i~~~~r~~Cr~CRl~KCl~vGM~~~~v~   72 (84)
T cd06965           1 ECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLVYKPCDL------SCKIHKKSRNKCQYCRFQKCLNVGMSHNAIR   72 (84)
T ss_pred             CCcccCccCcceEEChhhhhhhhhheeeeeecCCCcccccc------CCCcCccccccccchhhhhhhhccCCHHHcc
Confidence            5999999999999999999999999999999888884 864      3999999999999999999999999999886


No 40 
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=99.95  E-value=2.6e-29  Score=146.51  Aligned_cols=70  Identities=50%  Similarity=1.164  Sum_probs=61.1

Q ss_pred             CCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCC
Q psy6599          16 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNK   89 (93)
Q Consensus        16 ~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~   89 (93)
                      .+|+|||++++++||||.+|++|++||+|++..+..+.|..++    +|.++...+..|++|||+|||++||++
T Consensus         1 ~~C~VCg~~~~~~~ygv~sC~~C~~FFrR~~~~~~~~~C~~~~----~C~i~~~~~~~C~~CRf~KCl~~GM~k   70 (70)
T PF00105_consen    1 KKCKVCGDPASGYHYGVLSCNACKMFFRRSVKKKKPYKCKKNG----NCKIDKDNRRKCRSCRFQKCLEVGMKK   70 (70)
T ss_dssp             -BSTTTSSBESEEETTEEEEHHHHHHHHHHHHTTCG-STSSSS----T---STTTTTTSHHHHHHHHHHTTBSG
T ss_pred             CCCeECCCccCcccccccccccceeeeeecccccccccccccc----cccccccCCCEeCcchHHHHHHHCCcC
Confidence            3699999999999999999999999999999998889999875    599998888999999999999999974


No 41 
>KOG4846|consensus
Probab=99.95  E-value=1.7e-29  Score=185.85  Aligned_cols=74  Identities=46%  Similarity=1.069  Sum_probs=69.9

Q ss_pred             CCceecCCCCceeeeCcccchhhhhhhhhhhccCcee-ccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          16 IPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVY-TCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        16 ~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~-~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      ..|+||||.++||||||.+|++||+||||+|+.+..| .|-+..    +|.|...+|++|++|||+|||+|||++++|+
T Consensus       133 ~lCkVCgDkASGfHYGV~aCEGCKGFFRRSIQqkI~YrrClk~e----~C~I~R~nRNRCQ~CRfKKCL~vGMSrDaVR  207 (538)
T KOG4846|consen  133 SLCKVCGDKASGFHYGVTACEGCKGFFRRSIQQKIDYRRCLKQE----VCEIKRENRNRCQYCRFKKCLDVGMSRDAVR  207 (538)
T ss_pred             EeehhhccccccceeceeecccchHHHHHHHHHhhhHHHHhhhh----ceehhhhccchhhhhhHHHHHhcccchhhhh
Confidence            5699999999999999999999999999999999999 688764    6999999999999999999999999999986


No 42 
>KOG4216|consensus
Probab=99.94  E-value=2.2e-28  Score=178.75  Aligned_cols=75  Identities=53%  Similarity=1.184  Sum_probs=71.2

Q ss_pred             CCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          15 DIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        15 ~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      -.||.||||.++|.||||.+|++||+||||+-..+..|.|.++.    +|.|+..+|++|++|||+|||++||+.+||.
T Consensus        46 vIPCKiCGDKSSGiHYGVITCEGCKGFFRRSQ~s~a~YsCpRqk----nC~iDRtnRNRCQ~CRLqKClaLGMSRDAVK  120 (479)
T KOG4216|consen   46 IIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNANYSCPRQK----NCLIDRTNRNRCQHCRLQKCLALGMSRDAVK  120 (479)
T ss_pred             EEeeeeccCCCCcceeeeEeeccchHhhhhhhhccccccCCccc----CCcccccccchhhHHHHHHHHHhccchhhHH
Confidence            36799999999999999999999999999999999999999986    6999999999999999999999999999874


No 43 
>KOG4217|consensus
Probab=99.94  E-value=8e-28  Score=179.11  Aligned_cols=76  Identities=43%  Similarity=1.061  Sum_probs=71.5

Q ss_pred             CCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCCCCC
Q psy6599          14 LDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKDDFK   93 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~~vq   93 (93)
                      ....|.||||.+.--||||.+|++||+||+|||+++..|+|..++    +|+|++..|++|++|||||||+|||-+|-||
T Consensus       268 ~e~~CAVCgDnAaCqHYGvRTCEGCKGFFKRTVQKnaKYvClanK----nCPVDKRrRnRCQyCRfQKCL~VGMVKEVVR  343 (605)
T KOG4217|consen  268 AEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANK----NCPVDKRRRNRCQYCRFQKCLAVGMVKEVVR  343 (605)
T ss_pred             ccceeeecCChHHhhhcCccccccchHHHHHHHhcCCeeEeecCC----CCCcchhhhhhchhhhHhHHHHhhhhhhhee
Confidence            457899999999999999999999999999999999999999986    6999999999999999999999999887664


No 44 
>KOG4218|consensus
Probab=99.92  E-value=3.2e-26  Score=165.85  Aligned_cols=79  Identities=44%  Similarity=1.043  Sum_probs=73.9

Q ss_pred             CCCCCCCceecCCCCceeeeCcccchhhhhhhhhhhccCceeccccCCCCCCCCCCCCCCCCCCcchHHHHhHHhcCCCC
Q psy6599          11 DRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRVYTCKAQGDLKGHCPIDKTHRNQCRACRLNKCFMSAMNKD   90 (93)
Q Consensus        11 ~~~~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR~~~~~~~~~C~~~~~~~~~C~i~~~~r~~C~~CR~~KCl~~GM~~~   90 (93)
                      +.-..+.|.||||..+|||||..+|++||+||+|+++.++.|.|..+.    +|.|++..|.+|.+|||+|||.+||+.|
T Consensus        11 dedl~ElCPVCGDkVSGYHYGLLTCESCKGFFKRTVQNnK~YtC~e~q----nC~iDkTqRKRCP~CRFQKCLtvGMklE   86 (475)
T KOG4218|consen   11 DEDLGELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKQYTCSEEQ----NCHIDKTQRKRCPSCRFQKCLTVGMKLE   86 (475)
T ss_pred             ccccccccccccCccccceeeeeehhhhhhHHHHHhhcCcceeccccc----ccccchHhhccCCchhHHHHhhhhhhHH
Confidence            445678999999999999999999999999999999999999998875    6999999999999999999999999999


Q ss_pred             CCC
Q psy6599          91 DFK   93 (93)
Q Consensus        91 ~vq   93 (93)
                      ||+
T Consensus        87 AVR   89 (475)
T KOG4218|consen   87 AVR   89 (475)
T ss_pred             HHH
Confidence            885


No 45 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=74.45  E-value=2.5  Score=22.45  Aligned_cols=24  Identities=38%  Similarity=1.110  Sum_probs=19.1

Q ss_pred             CceecCCCC-ceee-eCcccchhhhh
Q psy6599          17 PCKVCGDRS-SGKH-YGIYSCDGCSG   40 (93)
Q Consensus        17 ~C~VCg~~~-~~~h-yGv~~C~~C~~   40 (93)
                      .|.||+.+. .|.| ||...|..|-.
T Consensus         1 ~CiiC~~~~~~GI~I~~~fIC~~CE~   26 (46)
T PF10764_consen    1 KCIICGKEKEEGIHIYGKFICSDCEK   26 (46)
T ss_pred             CeEeCCCcCCCCEEEECeEehHHHHH
Confidence            489999874 4765 99999999963


No 46 
>PRK00420 hypothetical protein; Validated
Probab=71.45  E-value=1.5  Score=27.71  Aligned_cols=31  Identities=23%  Similarity=0.397  Sum_probs=25.7

Q ss_pred             CCCCCCceecCCCCceeeeCcccchhhhhhh
Q psy6599          12 RLLDIPCKVCGDRSSGKHYGIYSCDGCSGFF   42 (93)
Q Consensus        12 ~~~~~~C~VCg~~~~~~hyGv~~C~~C~~FF   42 (93)
                      .+....|++||.+-...+-|...|..|..+.
T Consensus        20 ~ml~~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~   50 (112)
T PRK00420         20 KMLSKHCPVCGLPLFELKDGEVVCPVHGKVY   50 (112)
T ss_pred             HHccCCCCCCCCcceecCCCceECCCCCCee
Confidence            3456889999999888888999999998754


No 47 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=70.50  E-value=2  Score=26.76  Aligned_cols=32  Identities=28%  Similarity=0.695  Sum_probs=21.3

Q ss_pred             CCCCCceecCCCCce---eeeCcccchhhhhhhhh
Q psy6599          13 LLDIPCKVCGDRSSG---KHYGIYSCDGCSGFFKR   44 (93)
Q Consensus        13 ~~~~~C~VCg~~~~~---~hyGv~~C~~C~~FFrR   44 (93)
                      .....|.-||.+...   ..||+..|..|++..|.
T Consensus        11 ~~N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~   45 (116)
T PF01412_consen   11 PGNKVCADCGAPNPTWASLNYGIFLCLECAGIHRS   45 (116)
T ss_dssp             TTCTB-TTT-SBS--EEETTTTEEE-HHHHHHHHH
T ss_pred             cCcCcCCCCCCCCCCEEEeecChhhhHHHHHHHHH
Confidence            345679999987643   58999999999998654


No 48 
>KOG2879|consensus
Probab=57.22  E-value=12  Score=27.29  Aligned_cols=52  Identities=23%  Similarity=0.331  Sum_probs=32.4

Q ss_pred             CCCCCCCCCCCCCCCCceecCCCCceeeeC----cccchhhhhhhhhhhccCceecccc
Q psy6599           2 NVGTDNSLGDRLLDIPCKVCGDRSSGKHYG----IYSCDGCSGFFKRSIHRNRVYTCKA   56 (93)
Q Consensus         2 ~~~~~~~~~~~~~~~~C~VCg~~~~~~hyG----v~~C~~C~~FFrR~~~~~~~~~C~~   56 (93)
                      +.+++.+.+.......|.+||.+....|-+    ...|..|..-   +..-...+.|..
T Consensus       226 ~~ap~~sss~~t~~~~C~~Cg~~PtiP~~~~~C~HiyCY~Ci~t---s~~~~asf~Cp~  281 (298)
T KOG2879|consen  226 DRAPKFSSSTGTSDTECPVCGEPPTIPHVIGKCGHIYCYYCIAT---SRLWDASFTCPL  281 (298)
T ss_pred             cCCCCcccccccCCceeeccCCCCCCCeeeccccceeehhhhhh---hhcchhhcccCc
Confidence            445666677777788899999887665543    3567777631   222233456654


No 49 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=56.09  E-value=7.9  Score=20.81  Aligned_cols=31  Identities=23%  Similarity=0.607  Sum_probs=22.1

Q ss_pred             CCCceecCCCCce-e---eeCc-ccchhhhhhhhhh
Q psy6599          15 DIPCKVCGDRSSG-K---HYGI-YSCDGCSGFFKRS   45 (93)
Q Consensus        15 ~~~C~VCg~~~~~-~---hyGv-~~C~~C~~FFrR~   45 (93)
                      +..|..|+...+- .   -.|. ..|++|..+|+..
T Consensus         3 ~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~   38 (52)
T smart00401        3 GRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKH   38 (52)
T ss_pred             CCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHc
Confidence            4678889876543 2   3454 7899999999864


No 50 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=56.01  E-value=5.1  Score=18.99  Aligned_cols=21  Identities=33%  Similarity=0.865  Sum_probs=14.5

Q ss_pred             CceecCCCCceeeeCcccchhhh
Q psy6599          17 PCKVCGDRSSGKHYGIYSCDGCS   39 (93)
Q Consensus        17 ~C~VCg~~~~~~hyGv~~C~~C~   39 (93)
                      .|.||+...+++.  ...|..|.
T Consensus         2 ~C~~C~~~~~~~~--~Y~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGFY--FYHCSECC   22 (30)
T ss_pred             CCCCCCCCcCCCE--eEEeCCCC
Confidence            4788888888874  44666655


No 51 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=53.78  E-value=5.7  Score=19.51  Aligned_cols=14  Identities=21%  Similarity=0.593  Sum_probs=9.5

Q ss_pred             CCCCceecCCCCce
Q psy6599          14 LDIPCKVCGDRSSG   27 (93)
Q Consensus        14 ~~~~C~VCg~~~~~   27 (93)
                      .+..|.|||.+...
T Consensus        17 ~p~~CP~Cg~~~~~   30 (34)
T cd00729          17 APEKCPICGAPKEK   30 (34)
T ss_pred             CCCcCcCCCCchHH
Confidence            45678888876543


No 52 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=52.27  E-value=9.5  Score=23.58  Aligned_cols=30  Identities=27%  Similarity=0.736  Sum_probs=23.8

Q ss_pred             CCCceecCCCCc---eeeeCcccchhhhhhhhh
Q psy6599          15 DIPCKVCGDRSS---GKHYGIYSCDGCSGFFKR   44 (93)
Q Consensus        15 ~~~C~VCg~~~~---~~hyGv~~C~~C~~FFrR   44 (93)
                      ...|.-|+.+..   ...||+..|..|.+.-|.
T Consensus         3 N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~   35 (112)
T smart00105        3 NKKCFDCGAPNPTWASVNLGVFLCIECSGIHRS   35 (112)
T ss_pred             CCcccCCCCCCCCcEEeccceeEhHHhHHHHHh
Confidence            456888887643   468999999999998765


No 53 
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=50.09  E-value=8.5  Score=23.50  Aligned_cols=21  Identities=33%  Similarity=0.847  Sum_probs=16.6

Q ss_pred             CCCceecCCCCceeeeCcccchhhhh
Q psy6599          15 DIPCKVCGDRSSGKHYGIYSCDGCSG   40 (93)
Q Consensus        15 ~~~C~VCg~~~~~~hyGv~~C~~C~~   40 (93)
                      ...|.+||.++++-     .|.+|+.
T Consensus        80 ~~~C~~CG~pss~~-----iC~~C~l  100 (104)
T TIGR00269        80 LRRCERCGEPTSGR-----ICKACKF  100 (104)
T ss_pred             CCcCCcCcCcCCcc-----ccHhhhh
Confidence            35699999999863     7888873


No 54 
>PTZ00218 40S ribosomal protein S29; Provisional
Probab=48.63  E-value=9.4  Score=21.03  Aligned_cols=23  Identities=35%  Similarity=1.003  Sum_probs=18.3

Q ss_pred             CCceecCCCCc-eeeeCcccchhh
Q psy6599          16 IPCKVCGDRSS-GKHYGIYSCDGC   38 (93)
Q Consensus        16 ~~C~VCg~~~~-~~hyGv~~C~~C   38 (93)
                      ..|.|||.+.. ...||...|.-|
T Consensus        17 r~C~vCg~~~gliRkygL~~CRqC   40 (54)
T PTZ00218         17 RQCRVCSNRHGLIRKYGLNVCRQC   40 (54)
T ss_pred             CeeecCCCcchhhhhcCcchhhHH
Confidence            66999998753 457999888877


No 55 
>PHA03124 dUTPase; Provisional
Probab=45.65  E-value=11  Score=28.84  Aligned_cols=16  Identities=31%  Similarity=1.014  Sum_probs=13.0

Q ss_pred             cccchhhhhhhhhhhc
Q psy6599          32 IYSCDGCSGFFKRSIH   47 (93)
Q Consensus        32 v~~C~~C~~FFrR~~~   47 (93)
                      -.-|-+|++||||...
T Consensus       190 ~~~~~~~~~~~~~~~~  205 (418)
T PHA03124        190 NFGCMGCKAFYRRLFE  205 (418)
T ss_pred             cccccchHHHHHHHHH
Confidence            3459999999999864


No 56 
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit
Probab=44.53  E-value=16  Score=31.19  Aligned_cols=36  Identities=25%  Similarity=0.617  Sum_probs=22.7

Q ss_pred             CCCCCCCCCCCCCCCCCceecCCC----CceeeeCcccchhh
Q psy6599           1 MNVGTDNSLGDRLLDIPCKVCGDR----SSGKHYGIYSCDGC   38 (93)
Q Consensus         1 ~~~~~~~~~~~~~~~~~C~VCg~~----~~~~hyGv~~C~~C   38 (93)
                      |++-.+....+......|+|||+.    .+|--|  .+|+.|
T Consensus         1 ~~~~~~~~~~~~~~~~~c~iCGd~vg~~~~Ge~F--VAC~eC   40 (1044)
T PLN02915          1 MDDEDRPPTRQSADAKTCRVCGDEVGVKEDGQPF--VACHVC   40 (1044)
T ss_pred             CCcccCCccccCCCcchhhccccccCcCCCCCEE--EEeccC
Confidence            455555556667777889999986    345444  344444


No 57 
>PF03002 Somatostatin:  Somatostatin/Cortistatin family;  InterPro: IPR018142 Somatostatin inhibits the release of the pituitary growth hormone, somatotropin and inhibits the release of glucagon and insulin from the pancreas of fasted animals. Cortistatin is a cortical neuropeptide with neuronal depressant and sleep-modulating properties [].; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=42.83  E-value=5.9  Score=16.89  Aligned_cols=10  Identities=40%  Similarity=1.142  Sum_probs=7.0

Q ss_pred             hhhhhhhhhh
Q psy6599          37 GCSGFFKRSI   46 (93)
Q Consensus        37 ~C~~FFrR~~   46 (93)
                      +|+.||..+.
T Consensus         6 ~CknffWK~~   15 (18)
T PF03002_consen    6 GCKNFFWKTF   15 (18)
T ss_pred             cccceeeccc
Confidence            5888887553


No 58 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=40.31  E-value=10  Score=19.55  Aligned_cols=27  Identities=30%  Similarity=0.604  Sum_probs=16.4

Q ss_pred             CCCCCCceecCCCCceeeeCcccchhh
Q psy6599          12 RLLDIPCKVCGDRSSGKHYGIYSCDGC   38 (93)
Q Consensus        12 ~~~~~~C~VCg~~~~~~hyGv~~C~~C   38 (93)
                      .+..+.|..|+.+-...+=|...|-.|
T Consensus        14 ~ML~~~Cp~C~~PL~~~k~g~~~Cv~C   40 (41)
T PF06677_consen   14 TMLDEHCPDCGTPLMRDKDGKIYCVSC   40 (41)
T ss_pred             hHhcCccCCCCCeeEEecCCCEECCCC
Confidence            355677888877655544455555544


No 59 
>PRK12495 hypothetical protein; Provisional
Probab=35.66  E-value=15  Score=25.94  Aligned_cols=33  Identities=21%  Similarity=0.424  Sum_probs=25.8

Q ss_pred             CCCCCCCceecCCCCceeeeCcccchhhhhhhhh
Q psy6599          11 DRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKR   44 (93)
Q Consensus        11 ~~~~~~~C~VCg~~~~~~hyGv~~C~~C~~FFrR   44 (93)
                      ..+....|.+||.+...+ =|+..|-.|...+-+
T Consensus        38 atmsa~hC~~CG~PIpa~-pG~~~Cp~CQ~~~~~   70 (226)
T PRK12495         38 ATMTNAHCDECGDPIFRH-DGQEFCPTCQQPVTE   70 (226)
T ss_pred             cccchhhcccccCcccCC-CCeeECCCCCCcccc
Confidence            345667899999998843 699999999976643


No 60 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=35.45  E-value=17  Score=17.90  Aligned_cols=16  Identities=25%  Similarity=0.717  Sum_probs=12.0

Q ss_pred             eCcc-cchhhhhhhhhh
Q psy6599          30 YGIY-SCDGCSGFFKRS   45 (93)
Q Consensus        30 yGv~-~C~~C~~FFrR~   45 (93)
                      .|.. .|++|-.+|++.
T Consensus        17 ~g~~~LCn~Cg~~~kk~   33 (36)
T PF00320_consen   17 NGNRTLCNACGLYYKKY   33 (36)
T ss_dssp             TSEE-EEHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHh
Confidence            3444 799999998864


No 61 
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=34.16  E-value=25  Score=24.08  Aligned_cols=34  Identities=21%  Similarity=0.551  Sum_probs=25.6

Q ss_pred             CCCceecCCCCceeee---Ccccchhhhhhhhhhhcc
Q psy6599          15 DIPCKVCGDRSSGKHY---GIYSCDGCSGFFKRSIHR   48 (93)
Q Consensus        15 ~~~C~VCg~~~~~~hy---Gv~~C~~C~~FFrR~~~~   48 (93)
                      ...|.+|.+....|-|   .+..|..|++.|.+....
T Consensus       152 GfiCe~C~~~~~IfPF~~~~~~~C~~C~~v~H~~C~~  188 (202)
T PF13901_consen  152 GFICEICNSDDIIFPFQIDTTVRCPKCKSVFHKSCFR  188 (202)
T ss_pred             CCCCccCCCCCCCCCCCCCCeeeCCcCccccchhhcC
Confidence            4579999987766655   457799999999876543


No 62 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=33.63  E-value=16  Score=17.62  Aligned_cols=14  Identities=29%  Similarity=0.601  Sum_probs=9.4

Q ss_pred             CCCCceecCCCCce
Q psy6599          14 LDIPCKVCGDRSSG   27 (93)
Q Consensus        14 ~~~~C~VCg~~~~~   27 (93)
                      .+..|.+||.+...
T Consensus        16 ~~~~CP~Cg~~~~~   29 (33)
T cd00350          16 APWVCPVCGAPKDK   29 (33)
T ss_pred             CCCcCcCCCCcHHH
Confidence            55678888876543


No 63 
>KOG3277|consensus
Probab=33.56  E-value=16  Score=24.46  Aligned_cols=26  Identities=38%  Similarity=0.917  Sum_probs=19.1

Q ss_pred             CceecCCCCce------eeeCcc--cchhhhhhh
Q psy6599          17 PCKVCGDRSSG------KHYGIY--SCDGCSGFF   42 (93)
Q Consensus        17 ~C~VCg~~~~~------~hyGv~--~C~~C~~FF   42 (93)
                      .|.||+.+++-      ||-|+.  .|.+|+.+.
T Consensus        81 TCkvCntRs~ktisk~AY~~GvVivqC~gC~~~H  114 (165)
T KOG3277|consen   81 TCKVCNTRSTKTISKQAYEKGVVIVQCPGCKNHH  114 (165)
T ss_pred             EeeccCCccccccChhhhhCceEEEECCCCccce
Confidence            39999987642      566754  699998764


No 64 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.09  E-value=28  Score=18.18  Aligned_cols=13  Identities=38%  Similarity=0.743  Sum_probs=9.3

Q ss_pred             CCCCCCceecCCC
Q psy6599          12 RLLDIPCKVCGDR   24 (93)
Q Consensus        12 ~~~~~~C~VCg~~   24 (93)
                      .+....|.|||.+
T Consensus         5 ~lp~K~C~~C~rp   17 (42)
T PF10013_consen    5 NLPSKICPVCGRP   17 (42)
T ss_pred             cCCCCcCcccCCc
Confidence            3455779999865


No 65 
>PF00357 Integrin_alpha:  Integrin alpha cytoplasmic region;  InterPro: IPR018184 Some alpha subunits are cleaved post- translationally to produce a heavy and a light chain linked by a disulphide bond [, ]. Integrin alpha chains share a conserved sequence which is found at the beginning of the cytoplasmic domain, just after the end of the transmembrane region. Within the N-terminal domain of alpha subunits, seven sequence repeats, each of approximately 60 amino acids, have been found []. It has been predicted that these repeats assume the beta-propeller fold. The domains contain seven four-stranded beta-sheets arranged in a torus around a pseudosymmetry axis []. Integrin ligands and a putative Mg2+ ion are predicted to bind to the upper face of the propeller, in a manner analogous to the way in which the trimeric G-protein beta subunit (G beta) (which also has a beta-propeller fold) binds the G protein alpha subunit []. Integrin cytoplasmic domains are normally less than 50 amino acids in length, with the beta-subunit sequences exhibiting greater homology to each other than the alpha-subunit sequences []. This is consistent with current evidence that the beta subunit is the principal site for binding of cytoskeletal and signalling molecules, whereas the alpha subunit has a regulatory role. The first ten residues of the alpha-subunit cytoplasmic domain appear to form an alpha helix that is terminated by a proline residue. The remainder of the domain is highly acidic in nature and this loops back to contact the membrane-proximal lysine anchor residue. This entry represents the conserved site of the C-terminal integrin alpha chain. ; PDB: 2LKJ_A 2LKE_A 2K8O_A 1DPK_A 2K9J_A 1DPQ_A 1S4W_A 1M8O_A 2K1A_A 2KNC_A ....
Probab=32.69  E-value=19  Score=14.66  Aligned_cols=8  Identities=63%  Similarity=1.049  Sum_probs=5.7

Q ss_pred             hhhhhhhc
Q psy6599          40 GFFKRSIH   47 (93)
Q Consensus        40 ~FFrR~~~   47 (93)
                      +||+|.-.
T Consensus         3 GFFKR~~~   10 (15)
T PF00357_consen    3 GFFKRQRP   10 (15)
T ss_dssp             CHHHHHHH
T ss_pred             ccccccCc
Confidence            58988653


No 66 
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=32.27  E-value=22  Score=18.22  Aligned_cols=24  Identities=29%  Similarity=0.959  Sum_probs=10.5

Q ss_pred             CCCceecCCCCceeee------Ccccchhh
Q psy6599          15 DIPCKVCGDRSSGKHY------GIYSCDGC   38 (93)
Q Consensus        15 ~~~C~VCg~~~~~~hy------Gv~~C~~C   38 (93)
                      ..+|++||....-..|      |...|+.|
T Consensus         3 h~pCP~CGG~DrFri~~d~~~~G~~~C~~C   32 (40)
T PF08273_consen    3 HGPCPICGGKDRFRIFDDKDGRGTWICRQC   32 (40)
T ss_dssp             EE--TTTT-TTTEEEETT----S-EEETTT
T ss_pred             CCCCCCCcCccccccCcCcccCCCEECCCC
Confidence            3578899864322213      44556555


No 67 
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=31.26  E-value=53  Score=18.57  Aligned_cols=24  Identities=25%  Similarity=0.663  Sum_probs=19.6

Q ss_pred             CCCCceecCCCCceeeeCcccchhhh
Q psy6599          14 LDIPCKVCGDRSSGKHYGIYSCDGCS   39 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyGv~~C~~C~   39 (93)
                      .+.+|..||..  .||.--..|.+|-
T Consensus        16 tHt~CrRCG~~--syh~qK~~CasCG   39 (62)
T PRK04179         16 THIRCRRCGRH--SYNVRKKYCAACG   39 (62)
T ss_pred             ccchhcccCcc--cccccccchhhcC
Confidence            67889999977  4787778888886


No 68 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=30.41  E-value=27  Score=17.60  Aligned_cols=10  Identities=40%  Similarity=1.006  Sum_probs=7.4

Q ss_pred             CCCceecCCC
Q psy6599          15 DIPCKVCGDR   24 (93)
Q Consensus        15 ~~~C~VCg~~   24 (93)
                      ..+|++||..
T Consensus         3 ~~pCP~CGG~   12 (37)
T smart00778        3 HGPCPNCGGS   12 (37)
T ss_pred             ccCCCCCCCc
Confidence            4678999864


No 69 
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=30.28  E-value=8.3  Score=19.96  Aligned_cols=25  Identities=32%  Similarity=0.978  Sum_probs=15.6

Q ss_pred             ceecCCCCceeeeCcccchhhhhhhhh
Q psy6599          18 CKVCGDRSSGKHYGIYSCDGCSGFFKR   44 (93)
Q Consensus        18 C~VCg~~~~~~hyGv~~C~~C~~FFrR   44 (93)
                      |.||+.  ....-..+.|..|..+|..
T Consensus         2 C~vC~~--~~~~~~~i~C~~C~~~~H~   26 (51)
T PF00628_consen    2 CPVCGQ--SDDDGDMIQCDSCNRWYHQ   26 (51)
T ss_dssp             BTTTTS--SCTTSSEEEBSTTSCEEET
T ss_pred             CcCCCC--cCCCCCeEEcCCCChhhCc
Confidence            677877  2223346678888876643


No 70 
>TIGR03124 ctirate_citX holo-ACP synthase CitX. Members of this protein family are the CitX protein, or CitX domain of the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems.
Probab=29.45  E-value=23  Score=23.71  Aligned_cols=13  Identities=15%  Similarity=0.501  Sum_probs=10.9

Q ss_pred             CCCCceecCCCCc
Q psy6599          14 LDIPCKVCGDRSS   26 (93)
Q Consensus        14 ~~~~C~VCg~~~~   26 (93)
                      .++.|.||++++.
T Consensus       129 ~~R~CliC~~~Ak  141 (165)
T TIGR03124       129 PPRKCLLCEEDAK  141 (165)
T ss_pred             CCCeeecCCchHH
Confidence            5688999999874


No 71 
>PRK08359 transcription factor; Validated
Probab=27.65  E-value=37  Score=23.04  Aligned_cols=31  Identities=26%  Similarity=0.606  Sum_probs=22.0

Q ss_pred             CCCCceecCCCCceeeeC-------cccchhhhhhhhh
Q psy6599          14 LDIPCKVCGDRSSGKHYG-------IYSCDGCSGFFKR   44 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyG-------v~~C~~C~~FFrR   44 (93)
                      .+..|-+||.+..|.-|-       ...|..|+.=|..
T Consensus         5 ~~~~CEiCG~~i~g~~~~v~ieGael~VC~~Ca~k~G~   42 (176)
T PRK08359          5 KPRYCEICGAEIRGPGHRIRIEGAELLVCDRCYEKYGR   42 (176)
T ss_pred             CcceeecCCCccCCCCeEEEEcCeEEehHHHHHHHhCC
Confidence            345699999998776333       3589999944444


No 72 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=27.45  E-value=21  Score=16.62  Aligned_cols=14  Identities=36%  Similarity=0.914  Sum_probs=4.7

Q ss_pred             CceecCCCCce-eee
Q psy6599          17 PCKVCGDRSSG-KHY   30 (93)
Q Consensus        17 ~C~VCg~~~~~-~hy   30 (93)
                      +|.+|+.+..+ ..|
T Consensus         2 ~C~~C~~~~~~~~~Y   16 (30)
T PF07649_consen    2 RCDACGKPIDGGWFY   16 (30)
T ss_dssp             --TTTS----S--EE
T ss_pred             cCCcCCCcCCCCceE
Confidence            47777777666 445


No 73 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=26.84  E-value=20  Score=24.16  Aligned_cols=14  Identities=21%  Similarity=0.525  Sum_probs=8.9

Q ss_pred             CCCCCceecCCCCc
Q psy6599          13 LLDIPCKVCGDRSS   26 (93)
Q Consensus        13 ~~~~~C~VCg~~~~   26 (93)
                      ..|..|+|||.+..
T Consensus       147 e~P~~CPiCga~k~  160 (166)
T COG1592         147 EAPEVCPICGAPKE  160 (166)
T ss_pred             CCCCcCCCCCChHH
Confidence            35667777776643


No 74 
>PRK01392 citX 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA:apo-citrate lyase; Reviewed
Probab=26.73  E-value=26  Score=23.80  Aligned_cols=14  Identities=29%  Similarity=0.686  Sum_probs=11.3

Q ss_pred             CCCCCceecCCCCc
Q psy6599          13 LLDIPCKVCGDRSS   26 (93)
Q Consensus        13 ~~~~~C~VCg~~~~   26 (93)
                      ..++.|.||++++.
T Consensus       137 ~p~R~CliC~~~Ak  150 (180)
T PRK01392        137 LPPRRCLLCGQDAK  150 (180)
T ss_pred             CCCCeeecCCchHH
Confidence            35688999999874


No 75 
>PF03802 CitX:  Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase;  InterPro: IPR005551 Members of this protein family are annotated as CitX, containing the CitX domain, the domain is also found in the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25 from EC), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems.; GO: 0051191 prosthetic group biosynthetic process
Probab=26.18  E-value=26  Score=23.44  Aligned_cols=13  Identities=23%  Similarity=0.623  Sum_probs=10.9

Q ss_pred             CCCCceecCCCCc
Q psy6599          14 LDIPCKVCGDRSS   26 (93)
Q Consensus        14 ~~~~C~VCg~~~~   26 (93)
                      .++.|.||++++.
T Consensus       131 ~~R~CliC~~~Ak  143 (170)
T PF03802_consen  131 PPRRCLICGRPAK  143 (170)
T ss_pred             CCCcccCCChhHH
Confidence            6688999999874


No 76 
>PTZ00073 60S ribosomal protein L37; Provisional
Probab=25.85  E-value=74  Score=19.34  Aligned_cols=26  Identities=31%  Similarity=0.648  Sum_probs=20.5

Q ss_pred             CCCCCCceecCCCCceeeeCcccchhhh
Q psy6599          12 RLLDIPCKVCGDRSSGKHYGIYSCDGCS   39 (93)
Q Consensus        12 ~~~~~~C~VCg~~~~~~hyGv~~C~~C~   39 (93)
                      ...+.+|..||..+  ||.--..|.+|-
T Consensus        13 ~ktHtlCrRCG~~s--yH~qK~~CasCG   38 (91)
T PTZ00073         13 GKTHTLCRRCGKRS--FHVQKKRCASCG   38 (91)
T ss_pred             CcCcchhcccCccc--cccccccchhcC
Confidence            34678899999765  777777899886


No 77 
>PRK06424 transcription factor; Provisional
Probab=25.59  E-value=29  Score=22.67  Aligned_cols=27  Identities=26%  Similarity=0.701  Sum_probs=19.6

Q ss_pred             CceecCCCCceeee------Ccccchhhhhhhh
Q psy6599          17 PCKVCGDRSSGKHY------GIYSCDGCSGFFK   43 (93)
Q Consensus        17 ~C~VCg~~~~~~hy------Gv~~C~~C~~FFr   43 (93)
                      .|.+||....+.+.      -...|..|+-|=.
T Consensus         2 ~CE~CG~~~~~~~~v~ieg~~l~vC~~Ca~~G~   34 (144)
T PRK06424          2 ECEMCGKKVPQTTKVMIDGAILNVCDDCAKFGT   34 (144)
T ss_pred             cccccCcccCCceEEEEcCeeeehhHHHHHcCC
Confidence            39999998776632      1348999998854


No 78 
>PRK05766 rps14P 30S ribosomal protein S14P; Reviewed
Probab=25.49  E-value=89  Score=16.87  Aligned_cols=27  Identities=30%  Similarity=0.801  Sum_probs=18.9

Q ss_pred             CCCCCCceecCCCCce-eeeCcccchhh
Q psy6599          12 RLLDIPCKVCGDRSSG-KHYGIYSCDGC   38 (93)
Q Consensus        12 ~~~~~~C~VCg~~~~~-~hyGv~~C~~C   38 (93)
                      ......|.|||.+..- ..||...|.-|
T Consensus        11 ~r~~nrC~~~Gr~rgvirkf~l~lcR~~   38 (52)
T PRK05766         11 GKGARECQRCGRKQGLIRKYGLYLCRQC   38 (52)
T ss_pred             CCCCceeecCCCCceeHHhhCCcccHHH
Confidence            3344679999987544 47887777765


No 79 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=25.14  E-value=35  Score=16.94  Aligned_cols=9  Identities=67%  Similarity=1.571  Sum_probs=6.5

Q ss_pred             CCceecCCC
Q psy6599          16 IPCKVCGDR   24 (93)
Q Consensus        16 ~~C~VCg~~   24 (93)
                      .+|.+|+..
T Consensus         9 ~~C~~C~~~   17 (36)
T PF11781_consen    9 EPCPVCGSR   17 (36)
T ss_pred             CcCCCCCCe
Confidence            458888865


No 80 
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=25.01  E-value=31  Score=19.30  Aligned_cols=16  Identities=38%  Similarity=0.773  Sum_probs=11.5

Q ss_pred             CCCCceecCCCCceee
Q psy6599          14 LDIPCKVCGDRSSGKH   29 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~h   29 (93)
                      +.+.|.+||..+...|
T Consensus        16 Lke~Cp~CG~~t~~~~   31 (59)
T COG2260          16 LKEKCPVCGGDTKVPH   31 (59)
T ss_pred             ecccCCCCCCccccCC
Confidence            4478999998765544


No 81 
>PF09180 ProRS-C_1:  Prolyl-tRNA synthetase, C-terminal;  InterPro: IPR016061 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Prolyl tRNA synthetase (6.1.1.15 from EC) exists in two forms, which are loosely related. The first form is present in the majority of eubacteria species. The second one, present in some eubacteria, is essentially present in archaea and eukaryota. Prolyl-tRNA synthetase belongs to class IIa.  This domain is found at the C-terminal in archaeal and eukaryotic enzymes, as well as in certain bacterial ones.; GO: 0000166 nucleotide binding, 0004827 proline-tRNA ligase activity, 0005524 ATP binding, 0006433 prolyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1NJ6_A 1NJ2_A 1NJ5_A 1NJ1_A 1H4T_C 1H4S_A 1HC7_C 1H4Q_B 3IAL_B.
Probab=24.76  E-value=36  Score=19.14  Aligned_cols=18  Identities=22%  Similarity=0.340  Sum_probs=10.5

Q ss_pred             CCCCCCCceecCCCCcee
Q psy6599          11 DRLLDIPCKVCGDRSSGK   28 (93)
Q Consensus        11 ~~~~~~~C~VCg~~~~~~   28 (93)
                      +......|.+||+++...
T Consensus        44 ~~~~~~~Ci~cgk~a~~~   61 (68)
T PF09180_consen   44 QEPEGGKCIVCGKPAKKW   61 (68)
T ss_dssp             CEBTT-B-TTT-SB-SCE
T ss_pred             CCCCCCeeecCCChhhEE
Confidence            456678899999998754


No 82 
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=23.97  E-value=33  Score=22.60  Aligned_cols=25  Identities=32%  Similarity=0.982  Sum_probs=18.5

Q ss_pred             CceecCCCCceeeeC-------cccchhhhhh
Q psy6599          17 PCKVCGDRSSGKHYG-------IYSCDGCSGF   41 (93)
Q Consensus        17 ~C~VCg~~~~~~hyG-------v~~C~~C~~F   41 (93)
                      .|-+||.+..+.-|-       ...|..|+-|
T Consensus         2 ~CEiCG~~i~~~~~~v~iega~l~vC~~C~k~   33 (154)
T TIGR00270         2 NCEICGRKIKGKGFKIVIEGSEMTVCGECRKF   33 (154)
T ss_pred             ccccCCCccCCCCeEEEEcCeEEehhhhHHhc
Confidence            499999887765332       4589999955


No 83 
>PRK01343 zinc-binding protein; Provisional
Probab=23.77  E-value=73  Score=17.67  Aligned_cols=27  Identities=22%  Similarity=0.535  Sum_probs=17.7

Q ss_pred             CCCCceecCCCCceeeeCcccchhhhhh
Q psy6599          14 LDIPCKVCGDRSSGKHYGIYSCDGCSGF   41 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyGv~~C~~C~~F   41 (93)
                      ....|.||+.+... .|--+....|+..
T Consensus         8 p~~~CP~C~k~~~~-~~rPFCS~RC~~i   34 (57)
T PRK01343          8 PTRPCPECGKPSTR-EAYPFCSERCRDI   34 (57)
T ss_pred             CCCcCCCCCCcCcC-CCCcccCHHHhhh
Confidence            45779999998653 3445566667643


No 84 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=23.56  E-value=20  Score=18.62  Aligned_cols=28  Identities=29%  Similarity=0.452  Sum_probs=16.3

Q ss_pred             CCCCceecCCCCceeeeCcccchhhhhh
Q psy6599          14 LDIPCKVCGDRSSGKHYGIYSCDGCSGF   41 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyGv~~C~~C~~F   41 (93)
                      .+..|.+|++.-.|.-.-..-|..|...
T Consensus        10 ~~~~C~~C~~~i~g~~~~g~~C~~C~~~   37 (53)
T PF00130_consen   10 KPTYCDVCGKFIWGLGKQGYRCSWCGLV   37 (53)
T ss_dssp             STEB-TTSSSBECSSSSCEEEETTTT-E
T ss_pred             CCCCCcccCcccCCCCCCeEEECCCCCh
Confidence            4556888887765544445567777643


No 85 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=23.49  E-value=28  Score=21.06  Aligned_cols=28  Identities=29%  Similarity=0.724  Sum_probs=20.8

Q ss_pred             CCCceecCCCCc-eeeeCcccchhhhhhh
Q psy6599          15 DIPCKVCGDRSS-GKHYGIYSCDGCSGFF   42 (93)
Q Consensus        15 ~~~C~VCg~~~~-~~hyGv~~C~~C~~FF   42 (93)
                      .-.|+.|+.... -...|++.|..|..-|
T Consensus        35 ~~~Cp~C~~~~VkR~a~GIW~C~kCg~~f   63 (89)
T COG1997          35 KHVCPFCGRTTVKRIATGIWKCRKCGAKF   63 (89)
T ss_pred             CCcCCCCCCcceeeeccCeEEcCCCCCee
Confidence            345999998854 3578999999997544


No 86 
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=22.67  E-value=29  Score=21.41  Aligned_cols=29  Identities=21%  Similarity=0.473  Sum_probs=19.9

Q ss_pred             CCCCceecCCCCceeeeCcccchhhhhhh
Q psy6599          14 LDIPCKVCGDRSSGKHYGIYSCDGCSGFF   42 (93)
Q Consensus        14 ~~~~C~VCg~~~~~~hyGv~~C~~C~~FF   42 (93)
                      ....|.||++..-...=+...|.+|..=|
T Consensus        34 a~daCeiC~~~GY~q~g~~lvC~~C~~~~   62 (102)
T PF10080_consen   34 AFDACEICGPKGYYQEGDQLVCKNCGVRF   62 (102)
T ss_pred             EEEeccccCCCceEEECCEEEEecCCCEE
Confidence            34569999666555555677899997544


No 87 
>PF06147 DUF968:  Protein of unknown function (DUF968);  InterPro: IPR010373 This is a family of uncharacterised prophage proteins that are also found in bacteria and humans.
Probab=22.28  E-value=48  Score=22.72  Aligned_cols=18  Identities=28%  Similarity=0.722  Sum_probs=12.6

Q ss_pred             CCCCCceecCCC-Cceeee
Q psy6599          13 LLDIPCKVCGDR-SSGKHY   30 (93)
Q Consensus        13 ~~~~~C~VCg~~-~~~~hy   30 (93)
                      +...+|.|||.+ +...|+
T Consensus       125 v~~~~C~iCGk~~~d~hH~  143 (200)
T PF06147_consen  125 VKSRPCVICGKPPADIHHI  143 (200)
T ss_pred             hccCccccCCCCcccccee
Confidence            355789999975 445565


No 88 
>KOG3116|consensus
Probab=22.26  E-value=48  Score=22.21  Aligned_cols=9  Identities=33%  Similarity=0.785  Sum_probs=7.9

Q ss_pred             HHHHhHHhc
Q psy6599          78 RLNKCFMSA   86 (93)
Q Consensus        78 R~~KCl~~G   86 (93)
                      |-||||++|
T Consensus        29 rCQKClq~G   37 (177)
T KOG3116|consen   29 RCQKCLQAG   37 (177)
T ss_pred             hHHHHHhhc
Confidence            778999998


No 89 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=21.42  E-value=47  Score=17.04  Aligned_cols=11  Identities=45%  Similarity=1.053  Sum_probs=7.0

Q ss_pred             CCCCCcchHHH
Q psy6599          70 HRNQCRACRLN   80 (93)
Q Consensus        70 ~r~~C~~CR~~   80 (93)
                      .+..|+.||.+
T Consensus        36 ~~~~C~~C~~q   46 (46)
T PF12760_consen   36 GRYRCKACRKQ   46 (46)
T ss_pred             CeEECCCCCCc
Confidence            45578777753


No 90 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=20.75  E-value=89  Score=15.32  Aligned_cols=25  Identities=24%  Similarity=0.442  Sum_probs=13.7

Q ss_pred             CCCceecCCCCceeeeCcccchhhhh
Q psy6599          15 DIPCKVCGDRSSGKHYGIYSCDGCSG   40 (93)
Q Consensus        15 ~~~C~VCg~~~~~~hyGv~~C~~C~~   40 (93)
                      +..|.+|++...+.. -..-|..|+.
T Consensus        11 ~~~C~~C~~~i~~~~-~~~~C~~C~~   35 (49)
T smart00109       11 PTKCCVCRKSIWGSF-QGLRCSWCKV   35 (49)
T ss_pred             CCCccccccccCcCC-CCcCCCCCCc
Confidence            455777777654322 2345666654


No 91 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=20.45  E-value=95  Score=15.62  Aligned_cols=27  Identities=33%  Similarity=0.924  Sum_probs=15.2

Q ss_pred             ceecCCCCce----eeeC----cccchhhhhhhhh
Q psy6599          18 CKVCGDRSSG----KHYG----IYSCDGCSGFFKR   44 (93)
Q Consensus        18 C~VCg~~~~~----~hyG----v~~C~~C~~FFrR   44 (93)
                      |..||++..+    +.++    ...|+.|..=|++
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fCC~tC~~~fk~   35 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFCCPTCLSQFKK   35 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEECHHHHHHHHh
Confidence            4566665443    2222    3467888777654


No 92 
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=20.44  E-value=67  Score=16.99  Aligned_cols=15  Identities=27%  Similarity=0.585  Sum_probs=10.9

Q ss_pred             CCceecCCCCceeee
Q psy6599          16 IPCKVCGDRSSGKHY   30 (93)
Q Consensus        16 ~~C~VCg~~~~~~hy   30 (93)
                      .+|+.||.....+++
T Consensus         2 kPCPfCGg~~~~~~~   16 (53)
T TIGR03655         2 KPCPFCGGADVYLRR   16 (53)
T ss_pred             CCCCCCCCcceeeEe
Confidence            479999987765553


Done!