Diaphorina citri psyllid: psy6602


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------
VQHERGPRKPKIHNAHHQDSKLEPHNPHHSPDLLPPNGISSVKIPPTVLYPPSGLKSPPPPSHHHPSMFLATHQPPPHPGLLQILMSAEKCQETTARLLFMAVRWVRCLAPFQTLSKRDQLLLLQESWKELFLLHLAQWSIPWDLSLLINCEKARERLPPDDVRVNNEIKLIQEILARFRQLSPDGSECGCMKAVILFTPETPGLVDAQPVEMLQDQAQCILGDYVRGRYSRQPTRFGRLLLMLPSLRAVRQSTIERLFFKETIGDIPIQRLLGDMYTMEKSYETPGLVDAQPVEMLQDQAQCILGDYVRGRYSRQPTRFGRLLLMLPSLRAVRQSTIERLFFKETIGDIPIQRLLGDMYTMEKSYG
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccHHHHHHHHHHHcccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcHHHHcccHHHHHHHHHcccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcHHHHcccHHHHHHHHHccccccccHHHHHHHHHHcccccc
********************************************************************************LLQILMSAEKCQETTARLLFMAVRWVRCLAPFQTLSKRDQLLLLQESWKELFLLHLAQWSIPWDLSLLINCEKARERLPPDDVRVNNEIKLIQEILARFRQLSPDGSECGCMKAVILFTPETPGLVDAQPVEMLQDQAQCILGDYVRGRYSRQPTRFGRLLLMLPSLRAVRQSTIERLFFKETIGDIPIQRLLGDMYTMEKSYETPGLVDAQPVEMLQDQAQCILGDYVRGRYSRQPTRFGRLLLMLPSLRAVRQSTIERLFFKETIGDIPIQRLLGDMYTM*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VQHERGPRKPKIHNAHHQDSKLEPHNPHHSPDLLPPNGISSVKIPPTVLYPPSGLKSPPPPSHHHPSMFLATHQPPPHPGLLQILMSAEKCQETTARLLFMAVRWVRCLAPFQTLSKRDQLLLLQESWKELFLLHLAQWSIPWDLSLLINCEKARERLPPDDVRVNNEIKLIQEILARFRQLSPDGSECGCMKAVILFTPETPGLVDAQPVEMLQDQAQCILGDYVRGRYSRQPTRFGRLLLMLPSLRAVRQSTIERLFFKETIGDIPIQRLLGDMYTMEKSYETPGLVDAQPVEMLQDQAQCILGDYVRGRYSRQPTRFGRLLLMLPSLRAVRQSTIERLFFKETIGDIPIQRLLGDMYTMEKSYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear receptor subfamily 2 group E member 1 Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity. May be required to pattern anterior brain differentiation (By similarity). Involved in the regulation of retinal development.confidentQ91379
Nuclear receptor subfamily 2 group E member 1 Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity (By similarity). Regulates cell cycle progression in neural stem cells of rhe developing brain. Involved in the regulation of retinal development and essential for vision. During retinogenesis, regulates PTEN-Cyclin D expression via binding to the promoter region of PTEN and suppressing its activity. May be involved in retinoic acid receptor (RAR) regulation in retinal cells.confidentQ64104
Nuclear receptor subfamily 2 group E member 1 Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity (By similarity). May be required to pattern anterior brain differentiation. Involved in the regulation of retinal development and essential for vision. During retinogenesis, regulates PTEN-Cyclin D expression via binding to the promoter region of PTEN and suppressing its activity (By similarity). May be involved in retinoic acic receptor (RAR) regulation in retinal cells.confidentQ9Y466

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001078 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0008289 [MF]lipid bindingprobableGO:0003674, GO:0005488
GO:0007530 [BP]sex determinationprobableGO:0032502, GO:0003006, GO:0008150, GO:0000003, GO:0022414
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0035206 [BP]regulation of hemocyte proliferationprobableGO:0042127, GO:0050793, GO:0050794, GO:0008150, GO:0002682, GO:0051239, GO:0065007, GO:0050789
GO:0048047 [BP]mating behavior, sex discriminationprobableGO:0044703, GO:0000003, GO:0007618, GO:0019098, GO:0007617, GO:0050896, GO:0007610, GO:0022414, GO:0008150, GO:0051705, GO:0051704
GO:0008049 [BP]male courtship behaviorprobableGO:0060179, GO:0044703, GO:0032501, GO:0032504, GO:0048609, GO:0007618, GO:0019098, GO:0007617, GO:0050896, GO:0007619, GO:0007610, GO:0022414, GO:0008150, GO:0044706, GO:0033057, GO:0000003, GO:0051705, GO:0051704
GO:0030900 [BP]forebrain developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0004886 [MF]9-cis retinoic acid receptor activityprobableGO:0003708, GO:0038023, GO:0003700, GO:0001071, GO:0060089, GO:0003674, GO:0004879, GO:0004871, GO:0000981, GO:0004872
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043566 [MF]structure-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0031641 [BP]regulation of myelinationprobableGO:0051239, GO:0044057, GO:0031644, GO:0032844, GO:0008150, GO:0050793, GO:2000021, GO:2000026, GO:0051960, GO:0023051, GO:0065007, GO:0051969, GO:0010646, GO:0050789, GO:0050794
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0030522 [BP]intracellular receptor mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CJW, chain A
Confidence level:very confident
Coverage over the Query: 86-147,163-284
View the alignment between query and template
View the model in PyMOL
Template: 3CJW, chain A
Confidence level:very confident
Coverage over the Query: 239-265,281-364
View the alignment between query and template
View the model in PyMOL
Template: 3MNP, chain A
Confidence level:very confident
Coverage over the Query: 64-280
View the alignment between query and template
View the model in PyMOL
Template: 1YJE, chain A
Confidence level:confident
Coverage over the Query: 37-42,55-280
View the alignment between query and template
View the model in PyMOL