Query         psy6628
Match_columns 132
No_of_seqs    129 out of 1031
Neff          11.3
Searched_HMMs 46136
Date          Fri Aug 16 23:03:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6628.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6628hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 7.8E-30 1.7E-34  157.0   6.1  107    9-125   159-265 (279)
  2 KOG2462|consensus              100.0 2.3E-29 4.9E-34  155.0   5.8  117    9-132   128-244 (279)
  3 KOG1074|consensus               99.7 3.8E-19 8.1E-24  123.7   1.9   53   75-127   605-657 (958)
  4 KOG3576|consensus               99.7 1.6E-18 3.4E-23  103.3   2.6  113    9-129   115-238 (267)
  5 KOG1074|consensus               99.7 1.2E-18 2.7E-23  121.2   2.3   56   76-131   880-935 (958)
  6 KOG3623|consensus               99.7 1.9E-18 4.1E-23  119.0   1.6  111    9-125   208-331 (1007)
  7 KOG3608|consensus               99.7 4.3E-17 9.4E-22  104.3   4.2   80   44-127   264-345 (467)
  8 KOG3576|consensus               99.6 2.9E-17 6.4E-22   97.9   1.0   82   43-128   117-198 (267)
  9 KOG3623|consensus               99.6 2.1E-16 4.6E-21  109.1   2.0   78   42-123   893-970 (1007)
 10 KOG3608|consensus               99.5 4.3E-14 9.3E-19   90.8   6.7  111   11-129   263-378 (467)
 11 PHA00733 hypothetical protein   99.3 2.8E-12 6.2E-17   73.2   4.8   84   41-129    38-125 (128)
 12 PLN03086 PRLI-interacting fact  99.2 5.4E-11 1.2E-15   82.1   7.5  106    9-129   451-566 (567)
 13 PHA02768 hypothetical protein;  99.2 1.5E-11 3.2E-16   59.0   2.0   43   75-119     5-47  (55)
 14 PHA00733 hypothetical protein   99.0 3.8E-10 8.2E-15   64.5   4.4   84   10-100    39-124 (128)
 15 PF13465 zf-H2C2_2:  Zinc-finge  99.0 1.3E-10 2.9E-15   47.9   1.6   26   90-115     1-26  (26)
 16 PHA00616 hypothetical protein   99.0   3E-10 6.5E-15   52.0   1.5   29  103-131     1-29  (44)
 17 PLN03086 PRLI-interacting fact  98.9 1.9E-09 4.2E-14   74.7   4.6   78   44-131   454-541 (567)
 18 PHA02768 hypothetical protein;  98.9 8.4E-10 1.8E-14   53.0   1.9   43   11-62      5-47  (55)
 19 KOG3993|consensus               98.5 1.7E-08 3.8E-13   66.9   0.4  108   12-128   268-381 (500)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.5 3.8E-08 8.1E-13   40.5   1.3   25   61-86      1-25  (26)
 21 PHA00732 hypothetical protein   98.5 6.5E-08 1.4E-12   50.6   2.4   46   44-98      2-47  (79)
 22 PHA00616 hypothetical protein   98.5   4E-08 8.6E-13   45.0   1.4   39   75-113     1-39  (44)
 23 KOG3993|consensus               98.5 2.3E-08   5E-13   66.3   0.3  114   11-127   295-482 (500)
 24 PF05605 zf-Di19:  Drought indu  98.5 3.8E-07 8.2E-12   44.4   4.2   51   75-128     2-54  (54)
 25 PF00096 zf-C2H2:  Zinc finger,  98.4 2.9E-07 6.4E-12   36.7   2.2   23   12-34      1-23  (23)
 26 PF00096 zf-C2H2:  Zinc finger,  98.4 1.6E-07 3.5E-12   37.4   1.2   22  104-125     1-22  (23)
 27 PF09237 GAGA:  GAGA factor;  I  98.3 5.1E-07 1.1E-11   42.3   2.0   33   99-131    20-52  (54)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.3 4.2E-07 9.2E-12   36.4   1.6   24  104-127     1-24  (24)
 29 PHA00732 hypothetical protein   98.2 1.5E-06 3.2E-11   45.5   2.5   43   11-66      1-44  (79)
 30 PF05605 zf-Di19:  Drought indu  98.2   5E-06 1.1E-10   40.4   4.1   49   11-67      2-50  (54)
 31 PF13894 zf-C2H2_4:  C2H2-type   98.2 2.4E-06 5.2E-11   34.1   2.5   24   12-35      1-24  (24)
 32 PF13912 zf-C2H2_6:  C2H2-type   98.2 6.7E-07 1.5E-11   37.1   0.8   26  103-128     1-26  (27)
 33 PF13912 zf-C2H2_6:  C2H2-type   98.1 1.8E-06 3.8E-11   35.7   1.6   25   11-35      1-25  (27)
 34 COG5189 SFP1 Putative transcri  98.0 2.2E-06 4.7E-11   55.4   0.7   52   73-124   347-419 (423)
 35 PF09237 GAGA:  GAGA factor;  I  98.0 1.2E-05 2.6E-10   37.8   2.8   33    4-36     17-49  (54)
 36 PF12756 zf-C2H2_2:  C2H2 type   97.9 9.7E-06 2.1E-10   44.3   2.1   73   13-98      1-73  (100)
 37 PF12756 zf-C2H2_2:  C2H2 type   97.8 9.6E-06 2.1E-10   44.3   1.7   70   51-126     4-73  (100)
 38 smart00355 ZnF_C2H2 zinc finge  97.7 3.3E-05 7.1E-10   31.2   1.9   23  104-126     1-23  (26)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.6 3.7E-05 8.1E-10   30.7   1.6   24  104-128     1-24  (24)
 40 smart00355 ZnF_C2H2 zinc finge  97.6 7.3E-05 1.6E-09   30.1   2.0   24   12-35      1-24  (26)
 41 COG5189 SFP1 Putative transcri  97.6 2.3E-05   5E-10   50.8   0.5   70    9-96    347-419 (423)
 42 PF12874 zf-met:  Zinc-finger o  97.5 4.1E-05 8.9E-10   30.9   0.8   22  104-125     1-22  (25)
 43 PF12874 zf-met:  Zinc-finger o  97.3  0.0002 4.2E-09   28.8   1.8   23   12-34      1-23  (25)
 44 PRK04860 hypothetical protein;  97.2 0.00019   4E-09   42.8   1.5   38   75-116   119-156 (160)
 45 PF13909 zf-H2C2_5:  C2H2-type   97.1 0.00069 1.5E-08   26.9   2.5   23   12-35      1-23  (24)
 46 PF12171 zf-C2H2_jaz:  Zinc-fin  97.0 0.00013 2.8E-09   30.1  -0.2   22  104-125     2-23  (27)
 47 PF13913 zf-C2HC_2:  zinc-finge  96.8  0.0012 2.6E-08   26.6   1.7   21  104-125     3-23  (25)
 48 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7 0.00035 7.6E-09   28.7  -0.1   22   12-33      2-23  (27)
 49 KOG2231|consensus               96.7  0.0043 9.3E-08   44.7   4.8  106   12-128   100-237 (669)
 50 smart00451 ZnF_U1 U1-like zinc  96.2  0.0031 6.8E-08   27.4   1.3   23  103-125     3-25  (35)
 51 COG4049 Uncharacterized protei  95.7  0.0068 1.5E-07   29.1   1.3   29    8-36     14-42  (65)
 52 KOG2893|consensus               95.7  0.0035 7.5E-08   39.5   0.3   41   78-122    13-53  (341)
 53 COG4049 Uncharacterized protei  95.6  0.0081 1.8E-07   28.8   1.4   29   99-127    13-41  (65)
 54 cd00350 rubredoxin_like Rubred  95.6  0.0074 1.6E-07   26.0   1.2   24   76-111     2-25  (33)
 55 smart00451 ZnF_U1 U1-like zinc  95.4    0.02 4.3E-07   24.7   2.2   23   11-33      3-25  (35)
 56 KOG4173|consensus               95.1   0.014   3E-07   36.0   1.5   82   41-127    77-170 (253)
 57 PRK04860 hypothetical protein;  95.1    0.03 6.5E-07   33.5   3.0   37   44-88    120-156 (160)
 58 KOG1146|consensus               94.5   0.012 2.5E-07   45.5   0.3   25  101-125   516-540 (1406)
 59 COG1592 Rubrerythrin [Energy p  93.9   0.036 7.7E-07   33.3   1.4   25   74-111   133-157 (166)
 60 COG5236 Uncharacterized conser  93.1    0.16 3.4E-06   34.1   3.4   79   12-97    152-242 (493)
 61 COG5048 FOG: Zn-finger [Genera  92.8    0.02 4.3E-07   39.2  -0.9   56   75-130   289-350 (467)
 62 TIGR00622 ssl1 transcription f  92.8    0.31 6.8E-06   27.3   3.9   24   75-98     81-104 (112)
 63 KOG4173|consensus               92.8    0.03 6.5E-07   34.6  -0.1   75   12-96     80-167 (253)
 64 KOG1146|consensus               92.7   0.033   7E-07   43.3  -0.0  109   12-129  1229-1354(1406)
 65 cd00729 rubredoxin_SM Rubredox  92.6   0.071 1.5E-06   23.1   1.0   24   76-111     3-26  (34)
 66 PF02892 zf-BED:  BED zinc fing  92.1    0.13 2.9E-06   23.6   1.7   28  100-127    13-44  (45)
 67 PF04959 ARS2:  Arsenite-resist  92.0   0.083 1.8E-06   33.2   1.2   30  101-130    75-104 (214)
 68 KOG2893|consensus               91.0   0.059 1.3E-06   34.2  -0.2   46   14-70     13-58  (341)
 69 PF05443 ROS_MUCR:  ROS/MUCR tr  90.8    0.13 2.7E-06   29.8   1.0   27  101-130    70-96  (132)
 70 PF09538 FYDLN_acid:  Protein o  90.7    0.18 3.9E-06   28.1   1.6   30   44-88     10-39  (108)
 71 KOG2186|consensus               90.7    0.14   3E-06   32.8   1.2   46   44-96      4-49  (276)
 72 PF12907 zf-met2:  Zinc-binding  90.6   0.068 1.5E-06   24.1  -0.1   27  104-130     2-31  (40)
 73 KOG2482|consensus               89.9    0.42 9.2E-06   32.1   2.9   49   76-124   280-355 (423)
 74 PF09986 DUF2225:  Uncharacteri  89.9   0.049 1.1E-06   34.3  -1.3   14  103-116    48-61  (214)
 75 smart00614 ZnF_BED BED zinc fi  89.2     0.3 6.6E-06   23.1   1.5   22  104-125    19-45  (50)
 76 PF13717 zinc_ribbon_4:  zinc-r  89.2    0.27 5.8E-06   21.6   1.2   11   75-85     25-35  (36)
 77 smart00734 ZnF_Rad18 Rad18-lik  89.0    0.47   1E-05   19.2   1.8   19   13-32      3-21  (26)
 78 PF12013 DUF3505:  Protein of u  88.6    0.33 7.1E-06   27.1   1.6   25  104-128    81-109 (109)
 79 COG2888 Predicted Zn-ribbon RN  88.5    0.68 1.5E-05   22.7   2.4    9   75-83     50-58  (61)
 80 PRK00398 rpoP DNA-directed RNA  88.4     0.2 4.4E-06   23.2   0.6    8  104-111    22-29  (46)
 81 KOG2482|consensus               87.6     1.4   3E-05   29.8   4.1   25  104-128   280-304 (423)
 82 PF06524 NOA36:  NOA36 protein;  86.3     0.4 8.7E-06   31.0   1.2   41    4-47    135-175 (314)
 83 KOG2785|consensus               85.9    0.81 1.8E-05   31.2   2.4   79   44-125     4-90  (390)
 84 TIGR02605 CxxC_CxxC_SSSS putat  85.6    0.23   5E-06   23.6  -0.1   11   44-57      6-16  (52)
 85 COG5048 FOG: Zn-finger [Genera  85.5    0.29 6.3E-06   33.5   0.3   61   44-107   290-355 (467)
 86 PF13719 zinc_ribbon_5:  zinc-r  83.5       1 2.3E-05   19.8   1.5   10   76-85     26-35  (37)
 87 TIGR00373 conserved hypothetic  82.9     1.3 2.9E-05   26.5   2.3   32   73-113   107-138 (158)
 88 PF07754 DUF1610:  Domain of un  82.7    0.87 1.9E-05   18.1   1.0   11    9-19     14-24  (24)
 89 KOG4167|consensus               82.6    0.28 6.1E-06   36.2  -0.7   28    9-36    790-817 (907)
 90 smart00659 RPOLCX RNA polymera  82.3     0.9 1.9E-05   20.9   1.1    8   76-83     20-27  (44)
 91 PF13878 zf-C2H2_3:  zinc-finge  81.6     1.7 3.8E-05   19.6   1.9   23  104-126    14-38  (41)
 92 PRK00464 nrdR transcriptional   81.5    0.28 6.1E-06   29.2  -0.9   13   76-88     29-41  (154)
 93 TIGR02300 FYDLN_acid conserved  81.3     1.2 2.7E-05   25.5   1.6   30   44-88     10-39  (129)
 94 PRK14890 putative Zn-ribbon RN  80.3     1.8 3.9E-05   21.3   1.8    9   75-83     48-56  (59)
 95 TIGR02098 MJ0042_CXXC MJ0042 f  79.9     1.4 3.1E-05   19.3   1.3    7   77-83     27-33  (38)
 96 COG3357 Predicted transcriptio  79.8     1.3 2.8E-05   23.8   1.3   31   74-114    57-87  (97)
 97 PF10571 UPF0547:  Uncharacteri  79.7     1.1 2.3E-05   18.1   0.8   11   12-22     15-25  (26)
 98 PRK06266 transcription initiat  79.5     1.9   4E-05   26.5   2.1   31   74-113   116-146 (178)
 99 COG1997 RPL43A Ribosomal prote  78.5     1.1 2.4E-05   23.9   0.9   11  103-113    53-63  (89)
100 PF04780 DUF629:  Protein of un  76.0     2.1 4.6E-05   30.3   1.8   26  102-127    56-81  (466)
101 KOG2231|consensus               75.9      11 0.00024   28.2   5.3   90   23-124   161-260 (669)
102 smart00531 TFIIE Transcription  74.9     6.2 0.00014   23.3   3.4   14   43-59     99-112 (147)
103 smart00834 CxxC_CXXC_SSSS Puta  74.8     1.7 3.6E-05   19.3   0.8   14   11-24      5-18  (41)
104 PF05191 ADK_lid:  Adenylate ki  73.6     1.2 2.5E-05   19.6   0.1    8   77-84     23-30  (36)
105 COG5236 Uncharacterized conser  73.1     4.4 9.5E-05   27.6   2.7   75   45-128   222-306 (493)
106 PF13453 zf-TFIIB:  Transcripti  73.0     7.1 0.00015   17.4   2.7   12   51-62     24-35  (41)
107 COG1996 RPC10 DNA-directed RNA  72.7     1.7 3.8E-05   20.5   0.6    8   76-83     25-32  (49)
108 PHA00626 hypothetical protein   72.3     1.8 3.9E-05   21.0   0.6   15  101-115    21-35  (59)
109 KOG2186|consensus               72.3       3 6.5E-05   27.0   1.7   46   12-67      4-49  (276)
110 PRK09678 DNA-binding transcrip  71.7     1.3 2.9E-05   22.8   0.1   16   73-88     25-42  (72)
111 PF04959 ARS2:  Arsenite-resist  70.4     1.7 3.6E-05   27.5   0.3   27   73-99     75-101 (214)
112 KOG2785|consensus               70.3     5.3 0.00011   27.5   2.6   52   74-125   165-242 (390)
113 KOG4118|consensus               70.2     2.3 4.9E-05   21.3   0.7   27  104-130    39-65  (74)
114 PRK03824 hypA hydrogenase nick  70.0     1.7 3.6E-05   25.4   0.2   15   74-88     69-83  (135)
115 PF09723 Zn-ribbon_8:  Zinc rib  69.8     2.4 5.3E-05   19.2   0.7   14   11-24      5-18  (42)
116 PF15269 zf-C2H2_7:  Zinc-finge  68.1     3.2   7E-05   19.1   0.9   21  104-124    21-41  (54)
117 COG4957 Predicted transcriptio  67.1     2.6 5.7E-05   24.5   0.6   22  104-128    77-98  (148)
118 PF13451 zf-trcl:  Probable zin  67.1     3.5 7.6E-05   19.5   1.0   14    9-22      2-15  (49)
119 PF04423 Rad50_zn_hook:  Rad50   66.3     2.3   5E-05   20.4   0.3   11  105-115    22-32  (54)
120 PTZ00255 60S ribosomal protein  66.1     2.2 4.7E-05   23.0   0.2   11  103-113    54-64  (90)
121 smart00154 ZnF_AN1 AN1-like Zi  66.1     3.8 8.2E-05   18.3   0.9   14   11-24     12-25  (39)
122 PF08274 PhnA_Zn_Ribbon:  PhnA   66.1     2.1 4.6E-05   18.0   0.1    7  104-110    20-26  (30)
123 KOG3408|consensus               66.0     4.1 8.9E-05   23.2   1.2   26  100-125    54-79  (129)
124 PF03604 DNA_RNApol_7kD:  DNA d  65.5     3.1 6.7E-05   17.7   0.6    8   76-83     18-25  (32)
125 PF02176 zf-TRAF:  TRAF-type zi  65.4     3.2 6.9E-05   20.1   0.7   27   88-114    23-53  (60)
126 PF02891 zf-MIZ:  MIZ/SP-RING z  64.1     3.6 7.7E-05   19.5   0.7    9  103-111    41-49  (50)
127 KOG2807|consensus               62.8      14  0.0003   25.1   3.3   25  102-126   344-368 (378)
128 PLN02294 cytochrome c oxidase   62.8     3.6 7.7E-05   25.0   0.7   13    9-21    139-151 (174)
129 PF06397 Desulfoferrod_N:  Desu  62.3     5.2 0.00011   17.6   1.0   13    9-21      4-16  (36)
130 COG1655 Uncharacterized protei  62.0     1.3 2.9E-05   28.2  -1.2    8  104-111    63-70  (267)
131 KOG0717|consensus               60.7     4.2   9E-05   28.8   0.8   22  104-125   293-314 (508)
132 TIGR00280 L37a ribosomal prote  59.2     2.9 6.2E-05   22.6  -0.1   10   76-85     54-63  (91)
133 PF01780 Ribosomal_L37ae:  Ribo  59.2     1.8 3.9E-05   23.3  -0.9   10  104-113    54-63  (90)
134 KOG2593|consensus               58.1     4.8  0.0001   28.2   0.7   17    9-25    126-142 (436)
135 KOG1842|consensus               56.7     6.6 0.00014   27.8   1.2   26   75-100    15-40  (505)
136 PF09845 DUF2072:  Zn-ribbon co  56.3     5.3 0.00012   23.2   0.6   15   11-25      1-15  (131)
137 PF10013 DUF2256:  Uncharacteri  56.0       5 0.00011   18.3   0.4   12  105-116    10-21  (42)
138 PF08790 zf-LYAR:  LYAR-type C2  56.0     1.7 3.7E-05   17.9  -1.0    8   78-85      3-10  (28)
139 COG3364 Zn-ribbon containing p  55.7     7.1 0.00015   21.6   1.0   16   10-25      1-16  (112)
140 PF10276 zf-CHCC:  Zinc-finger   55.3     3.6 7.8E-05   18.5  -0.1   12  102-113    28-39  (40)
141 PF13824 zf-Mss51:  Zinc-finger  53.9      12 0.00025   18.2   1.5   10   74-83     13-22  (55)
142 KOG4124|consensus               53.6     2.9 6.2E-05   28.5  -0.8   48   74-121   348-416 (442)
143 COG0068 HypF Hydrogenase matur  53.0     5.2 0.00011   30.0   0.3   55   51-113   128-183 (750)
144 KOG1842|consensus               52.9     8.4 0.00018   27.3   1.2   26   11-36     15-40  (505)
145 COG2331 Uncharacterized protei  51.9      11 0.00025   19.6   1.3   31   11-55     12-42  (82)
146 PF01428 zf-AN1:  AN1-like Zinc  51.7     6.3 0.00014   17.9   0.4   15   10-24     12-26  (43)
147 PRK03976 rpl37ae 50S ribosomal  51.3     4.4 9.6E-05   21.9  -0.2   10   76-85     55-64  (90)
148 smart00440 ZnF_C2C2 C2C2 Zinc   50.3     1.5 3.2E-05   19.7  -1.8    9   76-84     29-37  (40)
149 PF07975 C1_4:  TFIIH C1-like d  50.3     3.2 6.8E-05   19.9  -0.8   25   74-98     20-44  (51)
150 PF14353 CpXC:  CpXC protein     50.2     9.3  0.0002   21.9   1.0   13   11-23     38-50  (128)
151 COG4338 Uncharacterized protei  49.8     7.4 0.00016   18.2   0.4   12   14-25     15-26  (54)
152 TIGR00100 hypA hydrogenase nic  49.7     7.8 0.00017   21.9   0.6   25   75-111    70-94  (115)
153 cd00924 Cyt_c_Oxidase_Vb Cytoc  49.2     9.3  0.0002   21.0   0.8   18   97-115    74-91  (97)
154 KOG2907|consensus               49.1     6.7 0.00015   22.1   0.3   40   76-115    75-114 (116)
155 TIGR00319 desulf_FeS4 desulfof  49.1      11 0.00025   15.9   1.0   13    9-21      5-17  (34)
156 COG5151 SSL1 RNA polymerase II  48.9      14  0.0003   25.0   1.7   26  101-126   386-411 (421)
157 PF07800 DUF1644:  Protein of u  48.3      61  0.0013   19.7   5.2   53   74-127    79-132 (162)
158 cd00974 DSRD Desulforedoxin (D  48.2      12 0.00025   15.9   0.9   12   10-21      3-14  (34)
159 KOG4727|consensus               47.3      13 0.00027   22.8   1.2   22   11-32     75-96  (193)
160 PF06220 zf-U1:  U1 zinc finger  47.2      14  0.0003   16.3   1.1   22  103-124     3-26  (38)
161 PRK12380 hydrogenase nickel in  46.5      10 0.00022   21.4   0.8   25   75-111    70-94  (113)
162 KOG1280|consensus               46.4      26 0.00055   24.1   2.6   38    8-47     76-113 (381)
163 PTZ00448 hypothetical protein;  45.8      16 0.00036   25.2   1.7   23   11-33    314-336 (373)
164 COG5188 PRP9 Splicing factor 3  45.7      10 0.00022   26.1   0.7   24  102-125   237-260 (470)
165 COG1773 Rubredoxin [Energy pro  45.1      11 0.00023   18.4   0.6   13   11-23      3-15  (55)
166 cd00730 rubredoxin Rubredoxin;  45.1     9.7 0.00021   18.1   0.5   12   12-23      2-13  (50)
167 COG4530 Uncharacterized protei  44.9      12 0.00026   21.0   0.8   14   74-87     25-38  (129)
168 KOG2071|consensus               44.4      18 0.00039   26.7   1.8   27  101-127   416-442 (579)
169 PF00301 Rubredoxin:  Rubredoxi  44.0      11 0.00024   17.6   0.6   12   12-23      2-13  (47)
170 PRK00432 30S ribosomal protein  43.3      13 0.00029   17.6   0.8   10  103-112    37-46  (50)
171 COG1594 RPB9 DNA-directed RNA   43.3     4.5 9.7E-05   22.9  -1.0   13  102-114    99-111 (113)
172 TIGR01206 lysW lysine biosynth  42.9      11 0.00023   18.3   0.4   11   11-21      2-12  (54)
173 KOG4167|consensus               42.8     6.9 0.00015   29.5  -0.3   26  102-127   791-816 (907)
174 COG4391 Uncharacterized protei  42.7      13 0.00028   18.5   0.7   44   68-115    17-60  (62)
175 TIGR00686 phnA alkylphosphonat  41.9      11 0.00024   21.1   0.4   12   76-87     20-31  (109)
176 PF04780 DUF629:  Protein of un  41.2      29 0.00063   25.0   2.4   25   11-35     57-81  (466)
177 PF04810 zf-Sec23_Sec24:  Sec23  40.6       4 8.8E-05   18.2  -1.2    9  102-110    23-31  (40)
178 KOG2636|consensus               40.6      23 0.00049   25.3   1.8   29   96-124   394-423 (497)
179 smart00586 ZnF_DBF Zinc finger  40.5      19  0.0004   17.1   1.0   21  101-124     3-23  (49)
180 KOG0717|consensus               40.2      21 0.00045   25.6   1.6   22   12-33    293-314 (508)
181 PF08792 A2L_zn_ribbon:  A2L zi  39.5      19 0.00041   15.4   0.9   13   10-22     20-32  (33)
182 PRK00564 hypA hydrogenase nick  39.0      14 0.00029   21.1   0.5   13   75-87     71-83  (117)
183 KOG2071|consensus               38.5      23 0.00051   26.1   1.7   28    8-35    415-442 (579)
184 PF14803 Nudix_N_2:  Nudix N-te  38.0      12 0.00025   16.2   0.1    7   14-20      3-9   (34)
185 PF01363 FYVE:  FYVE zinc finge  37.9      19 0.00041   18.0   0.9   12   76-87     26-37  (69)
186 PF07282 OrfB_Zn_ribbon:  Putat  37.2      53  0.0011   16.3   2.5   12   12-23     29-40  (69)
187 PF01155 HypA:  Hydrogenase exp  37.1      12 0.00025   21.1   0.1   25   76-112    71-95  (113)
188 PF12760 Zn_Tnp_IS1595:  Transp  36.6      10 0.00023   17.4  -0.2    8   75-82     37-44  (46)
189 COG3677 Transposase and inacti  36.5      19 0.00041   20.9   0.8   14  101-114    51-64  (129)
190 PF07535 zf-DBF:  DBF zinc fing  35.9      31 0.00067   16.3   1.4   21  101-124     3-23  (49)
191 PF03884 DUF329:  Domain of unk  35.3      20 0.00044   17.6   0.7   11   12-22      3-13  (57)
192 PF03811 Zn_Tnp_IS1:  InsA N-te  35.2       7 0.00015   17.1  -0.8    8   74-81     28-35  (36)
193 PF06676 DUF1178:  Protein of u  35.2      28 0.00061   20.8   1.4   48   44-96      6-53  (148)
194 PRK03681 hypA hydrogenase nick  35.1      13 0.00028   21.0   0.0   12   75-86     70-81  (114)
195 COG4888 Uncharacterized Zn rib  35.0      23 0.00049   19.6   0.9   16    8-23     19-34  (104)
196 PF07295 DUF1451:  Protein of u  35.0      14 0.00031   21.9   0.2   28   74-111   111-138 (146)
197 COG1675 TFA1 Transcription ini  35.0      30 0.00064   21.4   1.5    7  104-110   133-139 (176)
198 TIGR00627 tfb4 transcription f  34.7      28 0.00061   23.2   1.5   24   76-113   256-279 (279)
199 PRK14873 primosome assembly pr  34.4      22 0.00047   26.9   1.1   11  102-112   421-431 (665)
200 KOG2857|consensus               33.9      21 0.00045   21.1   0.7   22  103-124    17-38  (157)
201 PHA02998 RNA polymerase subuni  33.3     6.2 0.00013   24.2  -1.5   14  102-115   170-183 (195)
202 PF11672 DUF3268:  Protein of u  33.3      18 0.00039   20.1   0.4    7  104-110    32-38  (102)
203 PF01286 XPA_N:  XPA protein N-  33.2      18 0.00039   15.7   0.3   12  105-116     5-16  (34)
204 PTZ00043 cytochrome c oxidase   33.1      19 0.00041   23.1   0.5   17    7-23    177-193 (268)
205 COG5216 Uncharacterized conser  33.1      23 0.00049   17.5   0.7   29   44-82     23-51  (67)
206 PF08271 TF_Zn_Ribbon:  TFIIB z  32.9      24 0.00051   15.9   0.7    9   12-20      1-9   (43)
207 PF04438 zf-HIT:  HIT zinc fing  32.9      44 0.00096   13.9   1.5   16    9-24     11-26  (30)
208 PLN03238 probable histone acet  32.8      30 0.00066   23.2   1.4   22   75-96     48-69  (290)
209 PF13821 DUF4187:  Domain of un  32.5      25 0.00054   17.1   0.8   18  102-119    26-43  (55)
210 PF11931 DUF3449:  Domain of un  31.3      16 0.00035   22.9   0.0    9  102-110   100-108 (196)
211 TIGR03831 YgiT_finger YgiT-typ  31.3      22 0.00047   15.9   0.4   11   12-22     33-43  (46)
212 PF02591 DUF164:  Putative zinc  30.7      38 0.00083   16.2   1.3   12    9-20     44-55  (56)
213 COG2879 Uncharacterized small   30.7      43 0.00093   16.8   1.4   16  116-131    25-40  (65)
214 PLN03238 probable histone acet  30.6      69  0.0015   21.6   2.8   25    8-32     45-69  (290)
215 PRK01343 zinc-binding protein;  30.6      31 0.00068   16.9   0.9   12   11-22      9-20  (57)
216 PF14369 zf-RING_3:  zinc-finge  30.4      24 0.00051   15.3   0.5   10   13-22     23-32  (35)
217 PLN02748 tRNA dimethylallyltra  29.6      40 0.00086   24.4   1.7   24   74-97    417-441 (468)
218 PF05495 zf-CHY:  CHY zinc fing  29.4     9.6 0.00021   19.5  -1.0    9  103-111    61-69  (71)
219 cd00065 FYVE FYVE domain; Zinc  29.3      45 0.00098   15.7   1.4   12   76-87     19-30  (57)
220 PRK10220 hypothetical protein;  29.2      40 0.00087   19.0   1.3   11   13-23      5-15  (111)
221 COG5112 UFD2 U1-like Zn-finger  29.1      28 0.00061   19.5   0.7   24  102-125    54-77  (126)
222 PRK05452 anaerobic nitric oxid  29.1      19 0.00041   25.9   0.1   39   73-111   423-466 (479)
223 PRK00420 hypothetical protein;  29.1      31 0.00066   19.6   0.9   12   75-86     40-51  (112)
224 PF05129 Elf1:  Transcription e  28.9      23  0.0005   18.7   0.4    9   10-18     21-29  (81)
225 KOG1994|consensus               28.9      20 0.00044   23.0   0.2   24  100-123   236-259 (268)
226 PF01927 Mut7-C:  Mut7-C RNAse   28.4      23  0.0005   20.9   0.3   39   76-114    92-135 (147)
227 COG1198 PriA Primosomal protei  28.4      14  0.0003   28.2  -0.7    8   14-21    438-445 (730)
228 PF14311 DUF4379:  Domain of un  27.9      27 0.00058   16.7   0.4   17  102-118    27-43  (55)
229 KOG0320|consensus               27.6      30 0.00065   21.4   0.7   15  102-116   166-180 (187)
230 PF08209 Sgf11:  Sgf11 (transcr  27.3      44 0.00096   14.3   1.0   11   11-21      4-14  (33)
231 PRK00762 hypA hydrogenase nick  27.3      22 0.00047   20.5   0.1   31   75-111    70-100 (124)
232 PF14255 Cys_rich_CPXG:  Cystei  27.3      30 0.00065   16.6   0.5   10  105-114     2-11  (52)
233 KOG2272|consensus               27.0      67  0.0015   21.2   2.2   16   73-88    219-234 (332)
234 TIGR03830 CxxCG_CxxCG_HTH puta  27.0      70  0.0015   18.0   2.2   22   11-32     31-52  (127)
235 COG1656 Uncharacterized conser  26.5      66  0.0014   19.7   2.0   10   51-60    135-144 (165)
236 PF02748 PyrI_C:  Aspartate car  26.5      35 0.00077   16.3   0.7   16    8-23     32-47  (52)
237 PF05741 zf-nanos:  Nanos RNA b  26.3      24 0.00053   17.2   0.1    9   12-20     34-42  (55)
238 PF05290 Baculo_IE-1:  Baculovi  26.2      29 0.00064   20.3   0.5   58   10-90     79-136 (140)
239 smart00064 FYVE Protein presen  26.0      43 0.00094   16.6   1.1   29   44-88     11-39  (68)
240 TIGR03829 YokU_near_AblA uncha  26.0      48   0.001   18.0   1.2   20   12-31     36-55  (89)
241 PF10263 SprT-like:  SprT-like   25.5      27 0.00059   20.6   0.3   32   75-114   123-154 (157)
242 PRK08222 hydrogenase 4 subunit  24.9      50  0.0011   20.4   1.3   21  101-121   112-132 (181)
243 PF13248 zf-ribbon_3:  zinc-rib  24.8      28  0.0006   13.7   0.2    6   14-19     19-24  (26)
244 PF12773 DZR:  Double zinc ribb  24.3      51  0.0011   15.1   1.1    8   77-84     31-38  (50)
245 PF01215 COX5B:  Cytochrome c o  24.3      22 0.00049   20.9  -0.2   18   97-115   107-124 (136)
246 smart00132 LIM Zinc-binding do  24.0      36 0.00077   14.1   0.5   11   12-22     28-38  (39)
247 PF14354 Lar_restr_allev:  Rest  23.8      36 0.00077   16.5   0.5    8   12-19      4-11  (61)
248 PF12230 PRP21_like_P:  Pre-mRN  23.8      26 0.00057   22.4   0.0   27    9-36    166-192 (229)
249 COG4306 Uncharacterized protei  23.6      64  0.0014   18.7   1.5   61   22-88     21-81  (160)
250 PLN00104 MYST -like histone ac  23.4      41 0.00088   24.2   0.8   25  101-125   196-220 (450)
251 PF11789 zf-Nse:  Zinc-finger o  23.2      30 0.00065   16.8   0.1   30   75-108    24-53  (57)
252 PF14787 zf-CCHC_5:  GAG-polypr  23.1      45 0.00097   14.7   0.7   13   13-25      4-16  (36)
253 PF14690 zf-ISL3:  zinc-finger   22.9      45 0.00097   15.0   0.7    9  103-111     2-10  (47)
254 PTZ00064 histone acetyltransfe  22.6      48   0.001   24.2   1.1   25  101-125   278-302 (552)
255 COG0675 Transposase and inacti  22.6      43 0.00094   22.4   0.9   11   76-86    323-333 (364)
256 PF03107 C1_2:  C1 domain;  Int  22.6      43 0.00092   13.7   0.5   10  104-113     1-10  (30)
257 PF14375 Cys_rich_CWC:  Cystein  22.5      50  0.0011   15.5   0.8   11   14-24      1-11  (50)
258 smart00661 RPOL9 RNA polymeras  22.4      52  0.0011   15.2   0.9   13   10-22     19-31  (52)
259 PF14447 Prok-RING_4:  Prokaryo  22.4      44 0.00095   16.3   0.6   11   12-22     40-50  (55)
260 PF07649 C1_3:  C1-like domain;  22.3      57  0.0012   13.2   0.9   12   10-21     14-25  (30)
261 COG3091 SprT Zn-dependent meta  22.1      31 0.00067   20.7   0.1   34   74-112   116-149 (156)
262 PLN03239 histone acetyltransfe  21.5      93   0.002   21.6   2.2   25    9-33    104-128 (351)
263 COG1885 Uncharacterized protei  21.0      50  0.0011   18.4   0.7   13   12-24     50-62  (115)
264 COG1998 RPS31 Ribosomal protei  20.9      45 0.00097   15.9   0.5    9  103-111    37-45  (51)
265 KOG0562|consensus               20.3      94   0.002   19.1   1.8   29  101-129   151-179 (184)
266 PF13696 zf-CCHC_2:  Zinc knuck  20.2      43 0.00093   14.3   0.3   11   10-20      7-17  (32)
267 COG3024 Uncharacterized protei  20.1      59  0.0013   16.4   0.8   13   11-23      7-19  (65)

No 1  
>KOG2462|consensus
Probab=99.96  E-value=7.8e-30  Score=157.04  Aligned_cols=107  Identities=31%  Similarity=0.646  Sum_probs=89.2

Q ss_pred             ceeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccCh
Q psy6628           9 RVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSK   88 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~   88 (132)
                      .+.+.|+.||++|.+..+|..|+++|..      +..|.   +||+.|...+.|+.|+ +.|+|+|||.|..|+++|.+.
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~l------~c~C~---iCGKaFSRPWLLQGHi-RTHTGEKPF~C~hC~kAFADR  228 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHTL------PCECG---ICGKAFSRPWLLQGHI-RTHTGEKPFSCPHCGKAFADR  228 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccCC------Ccccc---cccccccchHHhhccc-ccccCCCCccCCcccchhcch
Confidence            5567788888888888888888888753      27777   8888888888888888 778888888888888888888


Q ss_pred             hhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHh
Q psy6628          89 YDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus        89 ~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      ++|+.||++|.+.|.|+|+.|+|.|+..+.|.+|...
T Consensus       229 SNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  229 SNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            8888888888888888888888888888888888754


No 2  
>KOG2462|consensus
Probab=99.96  E-value=2.3e-29  Score=155.03  Aligned_cols=117  Identities=29%  Similarity=0.631  Sum_probs=107.3

Q ss_pred             ceeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccCh
Q psy6628           9 RVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSK   88 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~   88 (132)
                      ...|.|++||+.+....+|.+|..+|....+. ..+.|+   .|++.|.....|..|+ ++|+  -+++|.+||+.|...
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~-ka~~C~---~C~K~YvSmpALkMHi-rTH~--l~c~C~iCGKaFSRP  200 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSK-KAFSCK---YCGKVYVSMPALKMHI-RTHT--LPCECGICGKAFSRP  200 (279)
T ss_pred             CCceeccccccccccccccchhhccccccccc-ccccCC---CCCceeeehHHHhhHh-hccC--CCcccccccccccch
Confidence            34599999999999999999999999876644 448999   9999999999999998 6676  578999999999999


Q ss_pred             hhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHhhhhhccC
Q psy6628          89 YDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLHQMYEQ  132 (132)
Q Consensus        89 ~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  132 (132)
                      +.|..|+++|+|||||.|+.|++.|+++++|+.|+..|.+.|+|
T Consensus       201 WLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~  244 (279)
T KOG2462|consen  201 WLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKH  244 (279)
T ss_pred             HHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccc
Confidence            99999999999999999999999999999999999999988875


No 3  
>KOG1074|consensus
Probab=99.75  E-value=3.8e-19  Score=123.69  Aligned_cols=53  Identities=30%  Similarity=0.636  Sum_probs=49.8

Q ss_pred             CccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHhhh
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLH  127 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  127 (132)
                      |-+|..|.+++.-.+.|..|.++|+||+||+|.+|++.|+.+.+|+.|+.+|-
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHk  657 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHK  657 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccc
Confidence            45899999999999999999999999999999999999999999999998753


No 4  
>KOG3576|consensus
Probab=99.73  E-value=1.6e-18  Score=103.27  Aligned_cols=113  Identities=30%  Similarity=0.588  Sum_probs=97.9

Q ss_pred             ceeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccCh
Q psy6628           9 RVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSK   88 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~   88 (132)
                      ...|+|.+|++.|.-.+-|.+|+.-|...   . .+.|.   .|++.|.+...|.+|+ +.|+|.+||.|..|+++|...
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~v---k-r~lct---~cgkgfndtfdlkrh~-rthtgvrpykc~~c~kaftqr  186 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDV---K-RHLCT---FCGKGFNDTFDLKRHT-RTHTGVRPYKCSLCEKAFTQR  186 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHH---H-HHHHh---hccCcccchhhhhhhh-ccccCccccchhhhhHHHHhh
Confidence            44699999999999999999999888752   2 38998   8999999999999998 789999999999999999999


Q ss_pred             hhHHHHHHH-h----------cCCCCccCCCchhccccchHHHHHHHhhhhh
Q psy6628          89 YDHKIHSRV-H----------TGEKPYACEFCPLTFRHSSHLFRHRRSLHQM  129 (132)
Q Consensus        89 ~~l~~h~~~-h----------~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  129 (132)
                      ..|..|.+. |          ..++.|.|..||.+-.....+..|++.+|..
T Consensus       187 csleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  187 CSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             ccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence            999999763 2          2468899999999888888888898887753


No 5  
>KOG1074|consensus
Probab=99.73  E-value=1.2e-18  Score=121.19  Aligned_cols=56  Identities=34%  Similarity=0.595  Sum_probs=52.3

Q ss_pred             ccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHhhhhhcc
Q psy6628          76 YQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLHQMYE  131 (132)
Q Consensus        76 ~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  131 (132)
                      ..|.+|++.|...+.|..|+++|+++|||.|.+|++.|..+.+|+.|+..|+...|
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~  935 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQP  935 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCC
Confidence            47999999999999999999999999999999999999999999999998876543


No 6  
>KOG3623|consensus
Probab=99.71  E-value=1.9e-18  Score=119.02  Aligned_cols=111  Identities=32%  Similarity=0.687  Sum_probs=96.3

Q ss_pred             ceeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCC-------------CCC
Q psy6628           9 RVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQK-------------EKP   75 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~-------------~~~   75 (132)
                      ....+|++|++.+.....|.+|+...+..  ..+.|.|.   .|..+|.+...|.+|+ ..|..             .+.
T Consensus       208 sqlltcpycdrgykrltslkeHikyrhek--ne~nfsC~---lCsytFAyRtQLErhm-~~hkpg~dqa~sltqsa~lRK  281 (1007)
T KOG3623|consen  208 SQLLTCPYCDRGYKRLTSLKEHIKYRHEK--NEPNFSCM---LCSYTFAYRTQLERHM-QLHKPGGDQAISLTQSALLRK  281 (1007)
T ss_pred             hhhhcchhHHHHHHHHHHHHHHHHHHHhh--CCCCCcch---hhhhhhhhHHHHHHHH-HhhcCCCcccccccchhhhcc
Confidence            34578999999999999999999866543  33458999   9999999999999998 55532             367


Q ss_pred             ccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHh
Q psy6628          76 YQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus        76 ~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      |+|..|+++|+++-.|+.|+++|.|||||.|+-|++.|+...++-.|+..
T Consensus       282 FKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  282 FKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             ccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            99999999999999999999999999999999999999999988888754


No 7  
>KOG3608|consensus
Probab=99.67  E-value=4.3e-17  Score=104.33  Aligned_cols=80  Identities=31%  Similarity=0.708  Sum_probs=64.1

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHHHHHHHhcCCCCccCCC--chhccccchHHHH
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEF--CPLTFRHSSHLFR  121 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~--C~~~f~~~~~l~~  121 (132)
                      |+|+   .|+......++|..|++..|...|||+|+.|.+.+...+.|.+|...|. +..|+|..  |..+|.+...+++
T Consensus       264 ykCp---lCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~  339 (467)
T KOG3608|consen  264 YKCP---LCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRR  339 (467)
T ss_pred             cccc---ccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHH
Confidence            7787   8888888888888898778888999999999999999999999988776 56666654  6666666666666


Q ss_pred             HHHhhh
Q psy6628         122 HRRSLH  127 (132)
Q Consensus       122 H~~~~~  127 (132)
                      |.+.+|
T Consensus       340 H~~evh  345 (467)
T KOG3608|consen  340 HFLEVH  345 (467)
T ss_pred             HHHHhc
Confidence            666555


No 8  
>KOG3576|consensus
Probab=99.65  E-value=2.9e-17  Score=97.89  Aligned_cols=82  Identities=35%  Similarity=0.746  Sum_probs=77.5

Q ss_pred             ccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccchHHHHH
Q psy6628          43 RFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRH  122 (132)
Q Consensus        43 ~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H  122 (132)
                      .+.|.   .|++.|.....|.+|+ .-|...+.+.|..||+.|....+|++|+++|+|.+||+|..|++.|+++.+|..|
T Consensus       117 ~ftCr---vCgK~F~lQRmlnrh~-kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  117 SFTCR---VCGKKFGLQRMLNRHL-KCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             eeeee---hhhhhhhHHHHHHHHh-hhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            48888   9999999999999999 6788889999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhh
Q psy6628         123 RRSLHQ  128 (132)
Q Consensus       123 ~~~~~~  128 (132)
                      ++..||
T Consensus       193 l~kvhg  198 (267)
T KOG3576|consen  193 LKKVHG  198 (267)
T ss_pred             HHHHcC
Confidence            988776


No 9  
>KOG3623|consensus
Probab=99.61  E-value=2.1e-16  Score=109.13  Aligned_cols=78  Identities=36%  Similarity=0.787  Sum_probs=72.6

Q ss_pred             CccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccchHHHH
Q psy6628          42 PRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFR  121 (132)
Q Consensus        42 ~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~  121 (132)
                      ..|.|.   .|++.|.-.++|.+|. =.|+|++||+|..|.++|+.+-.|..|.+.|.|||||+|..|++.|+...+.-+
T Consensus       893 gmyaCD---qCDK~FqKqSSLaRHK-YEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQ  968 (1007)
T KOG3623|consen  893 GMYACD---QCDKAFQKQSSLARHK-YEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQ  968 (1007)
T ss_pred             ccchHH---HHHHHHHhhHHHHHhh-hhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHh
Confidence            349999   9999999999999996 779999999999999999999999999999999999999999999999988888


Q ss_pred             HH
Q psy6628         122 HR  123 (132)
Q Consensus       122 H~  123 (132)
                      |+
T Consensus       969 HM  970 (1007)
T KOG3623|consen  969 HM  970 (1007)
T ss_pred             hh
Confidence            87


No 10 
>KOG3608|consensus
Probab=99.52  E-value=4.3e-14  Score=90.83  Aligned_cols=111  Identities=29%  Similarity=0.578  Sum_probs=96.7

Q ss_pred             eeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCc--ccccccCh
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQ--CSKSFFSK   88 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~--C~~~~~~~   88 (132)
                      -|+|+.|+++....+.|..|++..+..  +.| |+|.   .|+..+.....|..|. ..|. +..|.|..  |..++.+.
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~--dkp-fKCd---~Cd~~c~~esdL~kH~-~~HS-~~~y~C~h~~C~~s~r~~  334 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSK--DKP-FKCD---ECDTRCVRESDLAKHV-QVHS-KTVYQCEHPDCHYSVRTY  334 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhcc--CCC-cccc---chhhhhccHHHHHHHH-Hhcc-ccceecCCCCCcHHHHHH
Confidence            489999999999999999999987663  444 9999   9999999999999998 6787 56799988  99999999


Q ss_pred             hhHHHHHHHhc-C--CCCccCCCchhccccchHHHHHHHhhhhh
Q psy6628          89 YDHKIHSRVHT-G--EKPYACEFCPLTFRHSSHLFRHRRSLHQM  129 (132)
Q Consensus        89 ~~l~~h~~~h~-~--~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  129 (132)
                      ..+.+|+..++ |  +-+|.|..|++.|++-.+|..|+...|+-
T Consensus       335 ~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f  378 (467)
T KOG3608|consen  335 TQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGF  378 (467)
T ss_pred             HHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcc
Confidence            99999997654 3  45799999999999999999999887763


No 11 
>PHA00733 hypothetical protein
Probab=99.33  E-value=2.8e-12  Score=73.17  Aligned_cols=84  Identities=21%  Similarity=0.388  Sum_probs=66.8

Q ss_pred             CCccccCCCCCCcccccChHHHHhh--h--hhccCCCCCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccc
Q psy6628          41 RPRFKCEGRGECDRVFTTRNMLNIH--I--KRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHS  116 (132)
Q Consensus        41 ~~~~~c~~~~~c~~~~~~~~~l~~h--~--~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~  116 (132)
                      ...+.|.   +|...|.....|..+  +  ...+.+.++|.|..|++.|.....|..|+..+  +.++.|.+|++.|...
T Consensus        38 ~~~~~~~---~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~  112 (128)
T PHA00733         38 QKRLIRA---VVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNT  112 (128)
T ss_pred             hhhHHHH---HHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCH
Confidence            3448888   788777766555444  1  02234578999999999999999999999876  4679999999999999


Q ss_pred             hHHHHHHHhhhhh
Q psy6628         117 SHLFRHRRSLHQM  129 (132)
Q Consensus       117 ~~l~~H~~~~~~~  129 (132)
                      ..|..|+...|++
T Consensus       113 ~sL~~H~~~~h~~  125 (128)
T PHA00733        113 DSTLDHVCKKHNI  125 (128)
T ss_pred             HHHHHHHHHhcCc
Confidence            9999999887764


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.22  E-value=5.4e-11  Score=82.13  Aligned_cols=106  Identities=17%  Similarity=0.400  Sum_probs=85.0

Q ss_pred             ceeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccC-
Q psy6628           9 RVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFS-   87 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~-   87 (132)
                      ++.+.|+.|++.|. ...|..|+.+++.      ++.|+    |+..+ ....|..|+ ..+...+++.|..|+..+.. 
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~Hk------pv~Cp----Cg~~~-~R~~L~~H~-~thCp~Kpi~C~fC~~~v~~g  517 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFHE------PLQCP----CGVVL-EKEQMVQHQ-ASTCPLRLITCRFCGDMVQAG  517 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcCC------CccCC----CCCCc-chhHHHhhh-hccCCCCceeCCCCCCccccC
Confidence            44578999999996 6789999998752      38897    77554 567899998 77899999999999998852 


Q ss_pred             ---------hhhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHhhhhh
Q psy6628          88 ---------KYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSLHQM  129 (132)
Q Consensus        88 ---------~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  129 (132)
                               ...|..|.... +.+++.|..|++.+..+ .+..|+...|.+
T Consensus       518 ~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~~  566 (567)
T PLN03086        518 GSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIAVHQK  566 (567)
T ss_pred             ccccchhhhhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHHhhcC
Confidence                     34788898875 88999999999999876 567888777653


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.17  E-value=1.5e-11  Score=59.01  Aligned_cols=43  Identities=16%  Similarity=0.360  Sum_probs=36.4

Q ss_pred             CccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccchHH
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHL  119 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l  119 (132)
                      .|.|+.||+.|...+.|..|++.|+  ++++|..|++.|.+.+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            4788889999999999999998887  688888899988877765


No 14 
>PHA00733 hypothetical protein
Probab=99.04  E-value=3.8e-10  Score=64.51  Aligned_cols=84  Identities=20%  Similarity=0.256  Sum_probs=65.5

Q ss_pred             eeeeCCCCccccCChhHHHHH--HHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccC
Q psy6628          10 VVFTCQVCSKIFSYENGLKAH--VRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFS   87 (132)
Q Consensus        10 ~~~~C~~C~~~f~~~~~l~~h--~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~   87 (132)
                      +.+.|.+|.+.|.....|..+  +..+....+..+ |.|+   .|++.|.....|..|+ ..+  ..++.|..|++.|..
T Consensus        39 ~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kP-y~C~---~Cgk~Fss~s~L~~H~-r~h--~~~~~C~~CgK~F~~  111 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSP-YVCP---LCLMPFSSSVSLKQHI-RYT--EHSKVCPVCGKEFRN  111 (128)
T ss_pred             hhHHHHHHhhhccChhhhcchHHHHhhcccCCCCC-ccCC---CCCCcCCCHHHHHHHH-hcC--CcCccCCCCCCccCC
Confidence            458899999998888877776  333322222444 9999   9999999999999998 544  357999999999999


Q ss_pred             hhhHHHHHHHhcC
Q psy6628          88 KYDHKIHSRVHTG  100 (132)
Q Consensus        88 ~~~l~~h~~~h~~  100 (132)
                      ...|..|+...++
T Consensus       112 ~~sL~~H~~~~h~  124 (128)
T PHA00733        112 TDSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHHHhcC
Confidence            9999999876543


No 15 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.03  E-value=1.3e-10  Score=47.94  Aligned_cols=26  Identities=46%  Similarity=1.027  Sum_probs=21.8

Q ss_pred             hHHHHHHHhcCCCCccCCCchhcccc
Q psy6628          90 DHKIHSRVHTGEKPYACEFCPLTFRH  115 (132)
Q Consensus        90 ~l~~h~~~h~~~~~~~C~~C~~~f~~  115 (132)
                      +|..|++.|++++||.|++|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            46788889999999999999988863


No 16 
>PHA00616 hypothetical protein
Probab=98.96  E-value=3e-10  Score=51.96  Aligned_cols=29  Identities=28%  Similarity=0.502  Sum_probs=14.4

Q ss_pred             CccCCCchhccccchHHHHHHHhhhhhcc
Q psy6628         103 PYACEFCPLTFRHSSHLFRHRRSLHQMYE  131 (132)
Q Consensus       103 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  131 (132)
                      ||+|+.||+.|..+++|..|++.+||++|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            34455555555555555555555555443


No 17 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.91  E-value=1.9e-09  Score=74.65  Aligned_cols=78  Identities=19%  Similarity=0.432  Sum_probs=61.9

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccc---------
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFR---------  114 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~---------  114 (132)
                      +.|+   .|+..|. ...|..|+ ..+.  +++.|+ |+..+ ....|..|+..|..++++.|+.|++.|.         
T Consensus       454 ~~C~---~Cgk~f~-~s~LekH~-~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~  524 (567)
T PLN03086        454 VHCE---KCGQAFQ-QGEMEKHM-KVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVR  524 (567)
T ss_pred             ccCC---CCCCccc-hHHHHHHH-HhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchh
Confidence            5666   8999886 56789998 4453  789999 99765 5689999999999999999999999984         


Q ss_pred             -cchHHHHHHHhhhhhcc
Q psy6628         115 -HSSHLFRHRRSLHQMYE  131 (132)
Q Consensus       115 -~~~~l~~H~~~~~~~~~  131 (132)
                       ..+.|..|.... |.++
T Consensus       525 d~~s~Lt~HE~~C-G~rt  541 (567)
T PLN03086        525 DRLRGMSEHESIC-GSRT  541 (567)
T ss_pred             hhhhhHHHHHHhc-CCcc
Confidence             235788998774 5543


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.90  E-value=8.4e-10  Score=52.99  Aligned_cols=43  Identities=19%  Similarity=0.544  Sum_probs=32.7

Q ss_pred             eeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHH
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNML   62 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l   62 (132)
                      .|+|+.||+.|....+|..|+++|..      +++|.   .|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~k------~~kc~---~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHNT------NLKLS---NCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcCC------cccCC---cccceeccccee
Confidence            47888888888888888888888762      27787   788887766543


No 19 
>KOG3993|consensus
Probab=98.54  E-value=1.7e-08  Score=66.87  Aligned_cols=108  Identities=20%  Similarity=0.413  Sum_probs=68.8

Q ss_pred             eeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCcc-CCcc-cc-cccCh
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQ-CSQC-SK-SFFSK   88 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~-c~~C-~~-~~~~~   88 (132)
                      |.|..|-..|.+...|.+|...-....    .|.|+   +|++.|.-..+|..|. +=|.-..... -..- .+ .....
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~v----EYrCP---EC~KVFsCPANLASHR-RWHKPR~eaa~a~~~P~k~~~~~r  339 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHV----EYRCP---ECDKVFSCPANLASHR-RWHKPRPEAAKAGSPPPKQAVETR  339 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEe----eecCC---cccccccCchhhhhhh-cccCCchhhhhcCCCChhhhhhhh
Confidence            789999999999999999987544322    38999   8999999999999886 4342111000 0000 00 00000


Q ss_pred             hhHHHHHH---HhcCCCCccCCCchhccccchHHHHHHHhhhh
Q psy6628          89 YDHKIHSR---VHTGEKPYACEFCPLTFRHSSHLFRHRRSLHQ  128 (132)
Q Consensus        89 ~~l~~h~~---~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  128 (132)
                       .+.+-..   ....+..|.|..|+++|.....|++|+..|+.
T Consensus       340 -ae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  340 -AEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             -hhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence             0000000   01224589999999999999999999988765


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.54  E-value=3.8e-08  Score=40.51  Aligned_cols=25  Identities=52%  Similarity=0.975  Sum_probs=17.0

Q ss_pred             HHHhhhhhccCCCCCccCCccccccc
Q psy6628          61 MLNIHIKRDHQKEKPYQCSQCSKSFF   86 (132)
Q Consensus        61 ~l~~h~~~~~~~~~~~~c~~C~~~~~   86 (132)
                      +|..|+ ..|++++||.|+.|++.|.
T Consensus         1 ~l~~H~-~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHM-RTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHH-HHHSSSSSEEESSSSEEES
T ss_pred             CHHHHh-hhcCCCCCCCCCCCcCeeC
Confidence            356676 5577777777777777664


No 21 
>PHA00732 hypothetical protein
Probab=98.54  E-value=6.5e-08  Score=50.59  Aligned_cols=46  Identities=30%  Similarity=0.512  Sum_probs=29.1

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHHHHHHHh
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVH   98 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~h   98 (132)
                      |.|.   .|++.|....+|..|++..|.   ++.|+.|++.|.   .+..|..+.
T Consensus         2 y~C~---~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          2 FKCP---ICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             ccCC---CCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            5666   777777777777777632343   246777777776   355566443


No 22 
>PHA00616 hypothetical protein
Probab=98.54  E-value=4e-08  Score=45.03  Aligned_cols=39  Identities=23%  Similarity=0.342  Sum_probs=28.1

Q ss_pred             CccCCcccccccChhhHHHHHHHhcCCCCccCCCchhcc
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTF  113 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f  113 (132)
                      ||+|..||+.|...+.+..|+..|++++++.|..--..|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~y~~f   39 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYFYIYF   39 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeEEEEEE
Confidence            467788888888888888888888877777776543333


No 23 
>KOG3993|consensus
Probab=98.51  E-value=2.3e-08  Score=66.31  Aligned_cols=114  Identities=24%  Similarity=0.401  Sum_probs=69.4

Q ss_pred             eeeCCCCccccCChhHHHHHHHhhcCC-----C------------------------CCCCccccCCCCCCcccccChHH
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRNKHGS-----S------------------------EERPRFKCEGRGECDRVFTTRNM   61 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~~~~~-----~------------------------~~~~~~~c~~~~~c~~~~~~~~~   61 (132)
                      .|.|++|+++|..-.+|..|.+=|...     .                        .+..-|.|.   .|++.|....-
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~---~C~KkFrRqAY  371 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCH---TCGKKFRRQAY  371 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecH---HhhhhhHHHHH
Confidence            499999999999999999999866410     0                        001126666   78888888777


Q ss_pred             HHhhhhhccCCCCC----------------c-----------------------------cCCcccccccChhhHHHHHH
Q psy6628          62 LNIHIKRDHQKEKP----------------Y-----------------------------QCSQCSKSFFSKYDHKIHSR   96 (132)
Q Consensus        62 l~~h~~~~~~~~~~----------------~-----------------------------~c~~C~~~~~~~~~l~~h~~   96 (132)
                      |..|+...+.....                +                             .++.++..+..+..-..+..
T Consensus       372 LrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~r  451 (500)
T KOG3993|consen  372 LRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGR  451 (500)
T ss_pred             HHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCcccc
Confidence            77775222211100                0                             12223322222222222222


Q ss_pred             HhcCCCCccCCCchhccccchHHHHHHHhhh
Q psy6628          97 VHTGEKPYACEFCPLTFRHSSHLFRHRRSLH  127 (132)
Q Consensus        97 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  127 (132)
                      .-..+.-|.|.+|...|.+...|.+|+...|
T Consensus       452 lg~~~q~f~~ky~~atfyss~~ltrhin~~H  482 (500)
T KOG3993|consen  452 LGIAEQGFTCKYCPATFYSSPGLTRHINKCH  482 (500)
T ss_pred             ccchhhccccccchHhhhcCcchHhHhhhcC
Confidence            2223456899999999999999999987644


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.48  E-value=3.8e-07  Score=44.37  Aligned_cols=51  Identities=27%  Similarity=0.518  Sum_probs=33.6

Q ss_pred             CccCCcccccccChhhHHHHHHHh-cC-CCCccCCCchhccccchHHHHHHHhhhh
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVH-TG-EKPYACEFCPLTFRHSSHLFRHRRSLHQ  128 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h-~~-~~~~~C~~C~~~f~~~~~l~~H~~~~~~  128 (132)
                      .|.|+.|++ ..+...|..|.... .. .+.+.||+|...+.  .+|..|+..+|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            367777777 45566777776543 32 24678888887554  478888877664


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.40  E-value=2.9e-07  Score=36.66  Aligned_cols=23  Identities=39%  Similarity=0.905  Sum_probs=19.9

Q ss_pred             eeCCCCccccCChhHHHHHHHhh
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRNK   34 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~~   34 (132)
                      |+|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999998763


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.38  E-value=1.6e-07  Score=37.45  Aligned_cols=22  Identities=41%  Similarity=0.803  Sum_probs=17.8

Q ss_pred             ccCCCchhccccchHHHHHHHh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      |.|++|++.|...+.|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5688888888888888888876


No 27 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.30  E-value=5.1e-07  Score=42.28  Aligned_cols=33  Identities=30%  Similarity=0.480  Sum_probs=22.5

Q ss_pred             cCCCCccCCCchhccccchHHHHHHHhhhhhcc
Q psy6628          99 TGEKPYACEFCPLTFRHSSHLFRHRRSLHQMYE  131 (132)
Q Consensus        99 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  131 (132)
                      ..+.|..|++|+..+.+..+|++|++..|+.||
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            346788888888888888888888888888876


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.30  E-value=4.2e-07  Score=36.42  Aligned_cols=24  Identities=38%  Similarity=0.796  Sum_probs=17.9

Q ss_pred             ccCCCchhccccchHHHHHHHhhh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRSLH  127 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~~~  127 (132)
                      |.|++|++.|.+...|..|+..+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578888888888888888887765


No 29 
>PHA00732 hypothetical protein
Probab=98.18  E-value=1.5e-06  Score=45.49  Aligned_cols=43  Identities=30%  Similarity=0.603  Sum_probs=35.8

Q ss_pred             eeeCCCCccccCChhHHHHHHHh-hcCCCCCCCccccCCCCCCcccccChHHHHhhh
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRN-KHGSSEERPRFKCEGRGECDRVFTTRNMLNIHI   66 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~-~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~   66 (132)
                      +|.|..|++.|.....|..|++. |.+       +.|+   .|++.|..   +..|.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~-------~~C~---~CgKsF~~---l~~H~   44 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL-------TKCP---VCNKSYRR---LNQHF   44 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC-------CccC---CCCCEeCC---hhhhh
Confidence            58899999999999999999985 432       5788   99999984   66676


No 30 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.17  E-value=5e-06  Score=40.41  Aligned_cols=49  Identities=31%  Similarity=0.513  Sum_probs=30.8

Q ss_pred             eeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhh
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIK   67 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~   67 (132)
                      .|.||.|++ ..+...|..|....+...  ...+.||   +|...+.  .+|..|+.
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~--~~~v~CP---iC~~~~~--~~l~~Hl~   50 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSE--SKNVVCP---ICSSRVT--DNLIRHLN   50 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCC--CCCccCC---Cchhhhh--hHHHHHHH
Confidence            477888888 445677888877655432  1237788   7766433  36666763


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.17  E-value=2.4e-06  Score=34.12  Aligned_cols=24  Identities=38%  Similarity=0.927  Sum_probs=18.9

Q ss_pred             eeCCCCccccCChhHHHHHHHhhc
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRNKH   35 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~~~   35 (132)
                      |.|++|+..|.+...|..|+..++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999988763


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.17  E-value=6.7e-07  Score=37.06  Aligned_cols=26  Identities=38%  Similarity=0.680  Sum_probs=20.2

Q ss_pred             CccCCCchhccccchHHHHHHHhhhh
Q psy6628         103 PYACEFCPLTFRHSSHLFRHRRSLHQ  128 (132)
Q Consensus       103 ~~~C~~C~~~f~~~~~l~~H~~~~~~  128 (132)
                      ||.|.+|++.|.....|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57788888888888888888877654


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.11  E-value=1.8e-06  Score=35.75  Aligned_cols=25  Identities=36%  Similarity=0.692  Sum_probs=21.2

Q ss_pred             eeeCCCCccccCChhHHHHHHHhhc
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRNKH   35 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~~~   35 (132)
                      +|+|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5889999999999999999987764


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.97  E-value=2.2e-06  Score=55.37  Aligned_cols=52  Identities=35%  Similarity=0.756  Sum_probs=43.1

Q ss_pred             CCCccCCc--ccccccChhhHHHHHHH-h------------------cCCCCccCCCchhccccchHHHHHHH
Q psy6628          73 EKPYQCSQ--CSKSFFSKYDHKIHSRV-H------------------TGEKPYACEFCPLTFRHSSHLFRHRR  124 (132)
Q Consensus        73 ~~~~~c~~--C~~~~~~~~~l~~h~~~-h------------------~~~~~~~C~~C~~~f~~~~~l~~H~~  124 (132)
                      .|||.|++  |.+.+.+...|+-|+.. |                  ..+|||.|++|++.|.....|+-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            48999988  99999999999988763 2                  12589999999999999999887753


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.96  E-value=1.2e-05  Score=37.76  Aligned_cols=33  Identities=18%  Similarity=0.402  Sum_probs=21.5

Q ss_pred             cccccceeeeCCCCccccCChhHHHHHHHhhcC
Q psy6628           4 VHNIHRVVFTCQVCSKIFSYENGLKAHVRNKHG   36 (132)
Q Consensus         4 ~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~   36 (132)
                      .+..++.+.+|++|+.++.+..+|++|+...++
T Consensus        17 ~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   17 SKSQSEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             CCCTTS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             HhhccCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            455677788888888888888888888877665


No 36 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.87  E-value=9.7e-06  Score=44.31  Aligned_cols=73  Identities=26%  Similarity=0.508  Sum_probs=19.6

Q ss_pred             eCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHH
Q psy6628          13 TCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHK   92 (132)
Q Consensus        13 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~   92 (132)
                      .|..|+..|.+...|..|+...++.       ..+   .. ..+.....+...+ . ..-...+.|..|++.|.+...|.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~-------~~~---~~-~~l~~~~~~~~~~-~-~~~~~~~~C~~C~~~f~s~~~l~   67 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGF-------DIP---DQ-KYLVDPNRLLNYL-R-KKVKESFRCPYCNKTFRSREALQ   67 (100)
T ss_dssp             -------------------------------------------------------------SSEEBSSSS-EESSHHHHH
T ss_pred             Ccccccccccccccccccccccccc-------ccc---cc-ccccccccccccc-c-cccCCCCCCCccCCCCcCHHHHH
Confidence            4889999999999999998766652       111   01 1111222233332 1 11122578999998898888899


Q ss_pred             HHHHHh
Q psy6628          93 IHSRVH   98 (132)
Q Consensus        93 ~h~~~h   98 (132)
                      .|+..+
T Consensus        68 ~Hm~~~   73 (100)
T PF12756_consen   68 EHMRSK   73 (100)
T ss_dssp             HHHHHT
T ss_pred             HHHcCc
Confidence            998864


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.84  E-value=9.6e-06  Score=44.33  Aligned_cols=70  Identities=27%  Similarity=0.429  Sum_probs=21.7

Q ss_pred             CCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccchHHHHHHHhh
Q psy6628          51 ECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRHRRSL  126 (132)
Q Consensus        51 ~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  126 (132)
                      .|+..|.....|..|+...|.-..+     ....+.....+..+..... ...+.|.+|++.|.+...|..|++.+
T Consensus         4 ~C~~~f~~~~~l~~H~~~~H~~~~~-----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    4 FCDESFSSVDDLLQHMKKKHGFDIP-----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ---------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccc-----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            8999999999999998665643322     1111223333333333222 23799999999999999999999864


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.70  E-value=3.3e-05  Score=31.18  Aligned_cols=23  Identities=35%  Similarity=0.621  Sum_probs=19.3

Q ss_pred             ccCCCchhccccchHHHHHHHhh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRSL  126 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~~  126 (132)
                      |.|+.|++.|...+.|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            57888999999999999998754


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.64  E-value=3.7e-05  Score=30.73  Aligned_cols=24  Identities=33%  Similarity=0.672  Sum_probs=17.2

Q ss_pred             ccCCCchhccccchHHHHHHHhhhh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRSLHQ  128 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~~~~  128 (132)
                      |+|+.|+.... .+.|..|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            57888887777 7788888887764


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.57  E-value=7.3e-05  Score=30.09  Aligned_cols=24  Identities=33%  Similarity=0.834  Sum_probs=19.1

Q ss_pred             eeCCCCccccCChhHHHHHHHhhc
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRNKH   35 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~~~   35 (132)
                      |.|+.|++.|.....|..|+..|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            568888888888888888887553


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.55  E-value=2.3e-05  Score=50.78  Aligned_cols=70  Identities=29%  Similarity=0.525  Sum_probs=42.4

Q ss_pred             ceeeeCCC--CccccCChhHHHHHHHhhcCCCCCCC-ccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccc
Q psy6628           9 RVVFTCQV--CSKIFSYENGLKAHVRNKHGSSEERP-RFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSF   85 (132)
Q Consensus         9 ~~~~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~~-~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~   85 (132)
                      +++|+|++  |.+.+.+...|+=|+.--+.  .... +-.-+   +--.             ......|||+|.+|++.+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~--~~~~~~~p~p---~~~~-------------~F~~~~KPYrCevC~KRY  408 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQ--NQKLHENPSP---EKMN-------------IFSAKDKPYRCEVCDKRY  408 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhcccc--CcccCCCCCc---cccc-------------cccccCCceeccccchhh
Confidence            37788877  77777777777777532111  0000 00011   1101             123456899999999999


Q ss_pred             cChhhHHHHHH
Q psy6628          86 FSKYDHKIHSR   96 (132)
Q Consensus        86 ~~~~~l~~h~~   96 (132)
                      ++...|+-|..
T Consensus       409 KNlNGLKYHr~  419 (423)
T COG5189         409 KNLNGLKYHRK  419 (423)
T ss_pred             ccCccceeccc
Confidence            99988888764


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.51  E-value=4.1e-05  Score=30.89  Aligned_cols=22  Identities=32%  Similarity=0.736  Sum_probs=17.5

Q ss_pred             ccCCCchhccccchHHHHHHHh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      |.|.+|.+.|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5688888888888888888765


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.32  E-value=0.0002  Score=28.83  Aligned_cols=23  Identities=52%  Similarity=1.051  Sum_probs=18.2

Q ss_pred             eeCCCCccccCChhHHHHHHHhh
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRNK   34 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~~   34 (132)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57888888888888888887643


No 44 
>PRK04860 hypothetical protein; Provisional
Probab=97.20  E-value=0.00019  Score=42.79  Aligned_cols=38  Identities=34%  Similarity=0.766  Sum_probs=32.9

Q ss_pred             CccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccccc
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHS  116 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~  116 (132)
                      +|.|. |+.   ....+.+|.+++.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            58897 987   666789999999999999999999988754


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.13  E-value=0.00069  Score=26.92  Aligned_cols=23  Identities=35%  Similarity=0.736  Sum_probs=16.4

Q ss_pred             eeCCCCccccCChhHHHHHHHhhc
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRNKH   35 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~~~   35 (132)
                      |.|+.|+.... ...|..|+..++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67888888777 778888887754


No 46 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.04  E-value=0.00013  Score=30.05  Aligned_cols=22  Identities=27%  Similarity=0.635  Sum_probs=15.5

Q ss_pred             ccCCCchhccccchHHHHHHHh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      |.|.+|++.|.+...+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777777654


No 47 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.78  E-value=0.0012  Score=26.61  Aligned_cols=21  Identities=24%  Similarity=0.616  Sum_probs=15.0

Q ss_pred             ccCCCchhccccchHHHHHHHh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      ..|+.|++.| ..+.|.+|+..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4688888888 56667777654


No 48 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.73  E-value=0.00035  Score=28.72  Aligned_cols=22  Identities=50%  Similarity=0.969  Sum_probs=15.4

Q ss_pred             eeCCCCccccCChhHHHHHHHh
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRN   33 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~   33 (132)
                      |.|..|++.|.+...+..|+..
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777766543


No 49 
>KOG2231|consensus
Probab=96.67  E-value=0.0043  Score=44.75  Aligned_cols=106  Identities=25%  Similarity=0.453  Sum_probs=64.6

Q ss_pred             eeCCCCcccc---------------CChhHHHHHHHhhcCCCCCCCccccCCCC-------CCcccccChHHHHhhhhhc
Q psy6628          12 FTCQVCSKIF---------------SYENGLKAHVRNKHGSSEERPRFKCEGRG-------ECDRVFTTRNMLNIHIKRD   69 (132)
Q Consensus        12 ~~C~~C~~~f---------------~~~~~l~~h~~~~~~~~~~~~~~~c~~~~-------~c~~~~~~~~~l~~h~~~~   69 (132)
                      +.|.+|+..|               .....|+.|+..-+..      +.|..|.       .+.+. .....|..|+..-
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~~------~~c~lC~~~~kif~~e~k~-Yt~~el~~h~~~g  172 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHKL------HLCSLCLQNLKIFINERKL-YTRAELNLHLMFG  172 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhhh------hccccccccceeeeeeeeh-ehHHHHHHHHhcC
Confidence            5677777665               3668899998544431      4444221       12222 2345567776322


Q ss_pred             cCCCCC----ccCCcccccccChhhHHHHHHHhcCCCCccCCCc------hhccccchHHHHHHHhhhh
Q psy6628          70 HQKEKP----YQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFC------PLTFRHSSHLFRHRRSLHQ  128 (132)
Q Consensus        70 ~~~~~~----~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~~~~~  128 (132)
                      -.++..    -.|..|...|.....|.+|+..++    |.|..|      ...|.....|..|.+..|-
T Consensus       173 d~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~Hf  237 (669)
T KOG2231|consen  173 DPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGHF  237 (669)
T ss_pred             CCccccccCCccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcCc
Confidence            221221    368889999999999999988654    455555      3466778888888877664


No 50 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.18  E-value=0.0031  Score=27.39  Aligned_cols=23  Identities=22%  Similarity=0.587  Sum_probs=19.1

Q ss_pred             CccCCCchhccccchHHHHHHHh
Q psy6628         103 PYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       103 ~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      +|.|.+|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57899999999988888888764


No 51 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.69  E-value=0.0068  Score=29.11  Aligned_cols=29  Identities=24%  Similarity=0.555  Sum_probs=23.5

Q ss_pred             cceeeeCCCCccccCChhHHHHHHHhhcC
Q psy6628           8 HRVVFTCQVCSKIFSYENGLKAHVRNKHG   36 (132)
Q Consensus         8 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~   36 (132)
                      ++..+.||.||.+|....+..+|....++
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            66678899999999999889888876554


No 52 
>KOG2893|consensus
Probab=95.66  E-value=0.0035  Score=39.45  Aligned_cols=41  Identities=22%  Similarity=0.441  Sum_probs=24.0

Q ss_pred             CCcccccccChhhHHHHHHHhcCCCCccCCCchhccccchHHHHH
Q psy6628          78 CSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRHSSHLFRH  122 (132)
Q Consensus        78 c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H  122 (132)
                      |..|++.|..+..|.+|++.    |.|+|.+|.+...+-..|..|
T Consensus        13 cwycnrefddekiliqhqka----khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceee
Confidence            55566666666666666653    446677776655444444444


No 53 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.60  E-value=0.0081  Score=28.85  Aligned_cols=29  Identities=31%  Similarity=0.633  Sum_probs=18.7

Q ss_pred             cCCCCccCCCchhccccchHHHHHHHhhh
Q psy6628          99 TGEKPYACEFCPLTFRHSSHLFRHRRSLH  127 (132)
Q Consensus        99 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  127 (132)
                      .||..+.|+.|++.|...-+..+|....|
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            45666777777777777666666655443


No 54 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.60  E-value=0.0074  Score=26.03  Aligned_cols=24  Identities=25%  Similarity=0.769  Sum_probs=14.5

Q ss_pred             ccCCcccccccChhhHHHHHHHhcCCCCccCCCchh
Q psy6628          76 YQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPL  111 (132)
Q Consensus        76 ~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  111 (132)
                      |.|..||..+....            .++.|++|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            46677766653321            6677777764


No 55 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.37  E-value=0.02  Score=24.75  Aligned_cols=23  Identities=30%  Similarity=0.723  Sum_probs=18.2

Q ss_pred             eeeCCCCccccCChhHHHHHHHh
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRN   33 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~   33 (132)
                      .|.|..|++.|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47788888888888888888754


No 56 
>KOG4173|consensus
Probab=95.10  E-value=0.014  Score=36.01  Aligned_cols=82  Identities=27%  Similarity=0.466  Sum_probs=59.5

Q ss_pred             CCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHHHHHHH----------hcCCCCccCC--C
Q psy6628          41 RPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSRV----------HTGEKPYACE--F  108 (132)
Q Consensus        41 ~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~----------h~~~~~~~C~--~  108 (132)
                      .+.+.|+.-+ |.++|........|..+.|.    -.|.+|.+.|...--|-.|+..          ..|.-.|+|-  .
T Consensus        77 ~~~~~cqvag-c~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEg  151 (253)
T KOG4173|consen   77 VPAFACQVAG-CCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEG  151 (253)
T ss_pred             cccccccccc-hHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHh
Confidence            3457787554 77788877777888744443    3799999999988888888653          2355679994  4


Q ss_pred             chhccccchHHHHHHHhhh
Q psy6628         109 CPLTFRHSSHLFRHRRSLH  127 (132)
Q Consensus       109 C~~~f~~~~~l~~H~~~~~  127 (132)
                      |+-.|...-....|+-..|
T Consensus       152 Ct~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  152 CTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhhhhhhHHHHhc
Confidence            9999998888888875433


No 57 
>PRK04860 hypothetical protein; Provisional
Probab=95.09  E-value=0.03  Score=33.53  Aligned_cols=37  Identities=24%  Similarity=0.672  Sum_probs=27.0

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccCh
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSK   88 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~   88 (132)
                      |.|.    |+.   ...++..|. .+++++++|.|..|+..|...
T Consensus       120 Y~C~----C~~---~~~~~rrH~-ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        120 YRCK----CQE---HQLTVRRHN-RVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEcC----CCC---eeCHHHHHH-HHhcCCccEECCCCCceeEEe
Confidence            7774    654   445677887 778888888888888877654


No 58 
>KOG1146|consensus
Probab=94.49  E-value=0.012  Score=45.49  Aligned_cols=25  Identities=32%  Similarity=0.612  Sum_probs=20.0

Q ss_pred             CCCccCCCchhccccchHHHHHHHh
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      .++|.|..|...++...+|-+|+..
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHH
Confidence            4678888888888888888888753


No 59 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=93.86  E-value=0.036  Score=33.31  Aligned_cols=25  Identities=32%  Similarity=0.813  Sum_probs=20.2

Q ss_pred             CCccCCcccccccChhhHHHHHHHhcCCCCccCCCchh
Q psy6628          74 KPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPL  111 (132)
Q Consensus        74 ~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  111 (132)
                      +.|.|.+||..+             .++.|.+||+|+.
T Consensus       133 ~~~vC~vCGy~~-------------~ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYTH-------------EGEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCcc-------------cCCCCCcCCCCCC
Confidence            369999998774             4578999999983


No 60 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=93.06  E-value=0.16  Score=34.13  Aligned_cols=79  Identities=23%  Similarity=0.423  Sum_probs=40.3

Q ss_pred             eeCCC--CccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCccccc------ChHHHHhhhhhccCCCCCc----cCC
Q psy6628          12 FTCQV--CSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFT------TRNMLNIHIKRDHQKEKPY----QCS   79 (132)
Q Consensus        12 ~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~------~~~~l~~h~~~~~~~~~~~----~c~   79 (132)
                      |.||.  |..+...-..|..|..+.++      .+.|..|..-.+.|+      ....|..|. .....+-.|    .|.
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~------~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~-~~G~~e~GFKGHP~C~  224 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG------FVLCSECIGNKKDFWNEIRLFRSSTLRDHK-NGGLEEEGFKGHPLCI  224 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC------cEEhHhhhcCcccCccceeeeecccccccc-cCCccccCcCCCchhh
Confidence            67776  66665556778888776554      144542211112222      223344443 222222112    466


Q ss_pred             cccccccChhhHHHHHHH
Q psy6628          80 QCSKSFFSKYDHKIHSRV   97 (132)
Q Consensus        80 ~C~~~~~~~~~l~~h~~~   97 (132)
                      .|..-|-....|.+|++.
T Consensus       225 FC~~~FYdDDEL~~HcR~  242 (493)
T COG5236         225 FCKIYFYDDDELRRHCRL  242 (493)
T ss_pred             hccceecChHHHHHHHHh
Confidence            677667677777777664


No 61 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.82  E-value=0.02  Score=39.17  Aligned_cols=56  Identities=32%  Similarity=0.554  Sum_probs=43.8

Q ss_pred             CccCCcccccccChhhHHHHHH--HhcCC--CCccCC--CchhccccchHHHHHHHhhhhhc
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSR--VHTGE--KPYACE--FCPLTFRHSSHLFRHRRSLHQMY  130 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~  130 (132)
                      ++.|..|...|.....+..|..  .|.++  +++.|+  .|++.|.....+..|...+.+..
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  350 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSIS  350 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCC
Confidence            5677778888888888888888  68888  888888  68888888888877776665543


No 62 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.77  E-value=0.31  Score=27.33  Aligned_cols=24  Identities=29%  Similarity=0.686  Sum_probs=15.4

Q ss_pred             CccCCcccccccChhhHHHHHHHh
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVH   98 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h   98 (132)
                      .|+|..|...|...-++..|...|
T Consensus        81 ~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        81 RYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ceeCCCCCCccccccchhhhhhcc
Confidence            466777777776666666665544


No 63 
>KOG4173|consensus
Probab=92.76  E-value=0.03  Score=34.57  Aligned_cols=75  Identities=35%  Similarity=0.690  Sum_probs=49.2

Q ss_pred             eeCCC--CccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhcc---------CCCCCccCCc
Q psy6628          12 FTCQV--CSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDH---------QKEKPYQCSQ   80 (132)
Q Consensus        12 ~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~---------~~~~~~~c~~   80 (132)
                      +.|++  |.++|....+...|-.+-++       ..|.   .|.+.|+....|..|+...|         .|..-|+|-+
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~-------~sCs---~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~Clv  149 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG-------NSCS---FCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLV  149 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc-------chhH---HHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHH
Confidence            66776  55677666666666555444       5677   78888888877877764333         2344477755


Q ss_pred             --ccccccChhhHHHHHH
Q psy6628          81 --CSKSFFSKYDHKIHSR   96 (132)
Q Consensus        81 --C~~~~~~~~~l~~h~~   96 (132)
                        |+..|.....-..|+-
T Consensus       150 EgCt~KFkT~r~RkdH~I  167 (253)
T KOG4173|consen  150 EGCTEKFKTSRDRKDHMI  167 (253)
T ss_pred             HhhhhhhhhhhhhhhHHH
Confidence              7777777766666653


No 64 
>KOG1146|consensus
Probab=92.69  E-value=0.033  Score=43.26  Aligned_cols=109  Identities=18%  Similarity=0.216  Sum_probs=69.1

Q ss_pred             eeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhH
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDH   91 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l   91 (132)
                      ..|..|...|........+-.-........-.+.|.   +|...+.....+. ++-    ....|.|.+|...|.....+
T Consensus      1229 l~~~~~e~~f~~~~~~~~~a~~~~~~~~~sGe~~c~---~~~~~~~~~~~~~-~l~----~~~~~~~~~~~~~~~~~~~l 1300 (1406)
T KOG1146|consen 1229 LLPNALEQPFPQEPEPTATAPPKPPELPASGEGECG---AVDELLTPSFGIS-TLD----VTHRYLCRQCKMAFDGEAPL 1300 (1406)
T ss_pred             ccHHhhhcCccCcccccccCCCCCCcCcCCCcchhh---hccccccCcccee-ecc----cchhHHHHHHHhhhcchhHH
Confidence            445556666655554433322111100111125666   7877777666555 442    23468999999999999999


Q ss_pred             HHHHHHh-----------------cCCCCccCCCchhccccchHHHHHHHhhhhh
Q psy6628          92 KIHSRVH-----------------TGEKPYACEFCPLTFRHSSHLFRHRRSLHQM  129 (132)
Q Consensus        92 ~~h~~~h-----------------~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  129 (132)
                      ..|.+.-                 ..-++| |..|...|.....|+.|+++.+.+
T Consensus      1301 ~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~~~ 1354 (1406)
T KOG1146|consen 1301 TAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSAHR 1354 (1406)
T ss_pred             HHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhhhc
Confidence            8887531                 122456 999999999999999999875443


No 65 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.64  E-value=0.071  Score=23.11  Aligned_cols=24  Identities=25%  Similarity=0.653  Sum_probs=14.9

Q ss_pred             ccCCcccccccChhhHHHHHHHhcCCCCccCCCchh
Q psy6628          76 YQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPL  111 (132)
Q Consensus        76 ~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  111 (132)
                      |.|..||..+...            +.|..|++|+.
T Consensus         3 ~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           3 WVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             EECCCCCCEeECC------------cCCCcCcCCCC
Confidence            6677777665332            24567777774


No 66 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=92.07  E-value=0.13  Score=23.56  Aligned_cols=28  Identities=29%  Similarity=0.586  Sum_probs=15.7

Q ss_pred             CCCCccCCCchhcccc----chHHHHHHHhhh
Q psy6628         100 GEKPYACEFCPLTFRH----SSHLFRHRRSLH  127 (132)
Q Consensus       100 ~~~~~~C~~C~~~f~~----~~~l~~H~~~~~  127 (132)
                      ++.-..|..|++.+..    .+.|..|++..|
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            3455677777776654    477778875433


No 67 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=92.00  E-value=0.083  Score=33.17  Aligned_cols=30  Identities=20%  Similarity=0.418  Sum_probs=20.2

Q ss_pred             CCCccCCCchhccccchHHHHHHHhhhhhc
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRRSLHQMY  130 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~  130 (132)
                      +.-|.|++|+|.|....-+++|+...|.++
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            345888888888888888888887776654


No 68 
>KOG2893|consensus
Probab=91.01  E-value=0.059  Score=34.15  Aligned_cols=46  Identities=35%  Similarity=0.636  Sum_probs=32.8

Q ss_pred             CCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhcc
Q psy6628          14 CQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDH   70 (132)
Q Consensus        14 C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~   70 (132)
                      |=.|++.|.+..-|.+|+...+        |+|.   +|.+.......|..|..+.|
T Consensus        13 cwycnrefddekiliqhqkakh--------fkch---ichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAKH--------FKCH---ICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeecccccchhhhhhhhhhhcc--------ceee---eehhhhccCCCceeehhhhh
Confidence            6678899999999988887543        7888   77777665555666643334


No 69 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=90.81  E-value=0.13  Score=29.85  Aligned_cols=27  Identities=30%  Similarity=0.456  Sum_probs=13.2

Q ss_pred             CCCccCCCchhccccchHHHHHHHhhhhhc
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRRSLHQMY  130 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~  130 (132)
                      +.-..|-+||+.|.   .|.+|+..|||..
T Consensus        70 ~d~i~clecGk~~k---~LkrHL~~~~glt   96 (132)
T PF05443_consen   70 PDYIICLECGKKFK---TLKRHLRTHHGLT   96 (132)
T ss_dssp             SS-EE-TBT--EES---BHHHHHHHTT-S-
T ss_pred             cCeeEEccCCcccc---hHHHHHHHccCCC
Confidence            34466667777665   3467777776644


No 70 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.69  E-value=0.18  Score=28.15  Aligned_cols=30  Identities=27%  Similarity=0.685  Sum_probs=17.2

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccCh
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSK   88 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~   88 (132)
                      ..|+   .||..|....            ..|..|+.||..|.-.
T Consensus        10 R~Cp---~CG~kFYDLn------------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCP---SCGAKFYDLN------------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCC---CCcchhccCC------------CCCccCCCCCCccCcc
Confidence            4566   6666666431            1355677777666544


No 71 
>KOG2186|consensus
Probab=90.66  E-value=0.14  Score=32.77  Aligned_cols=46  Identities=24%  Similarity=0.592  Sum_probs=28.1

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHHHHHH
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSR   96 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~   96 (132)
                      |.|.   .|+....-. .+..|+.+ -.+ ..|.|..|+..|.. .....|..
T Consensus         4 FtCn---vCgEsvKKp-~vekH~sr-Crn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCN---VCGESVKKP-QVEKHMSR-CRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehh---hhhhhcccc-chHHHHHh-ccC-CeeEEeeccccccc-chhhhhhh
Confidence            6677   777665543 35667633 333 45778888888766 44555544


No 72 
>PF12907 zf-met2:  Zinc-binding
Probab=90.62  E-value=0.068  Score=24.11  Aligned_cols=27  Identities=26%  Similarity=0.503  Sum_probs=18.4

Q ss_pred             ccCCCchhccc---cchHHHHHHHhhhhhc
Q psy6628         104 YACEFCPLTFR---HSSHLFRHRRSLHQMY  130 (132)
Q Consensus       104 ~~C~~C~~~f~---~~~~l~~H~~~~~~~~  130 (132)
                      +.|.+|...|.   ....|..|....|.+.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            57888887664   4466888877666554


No 73 
>KOG2482|consensus
Probab=89.91  E-value=0.42  Score=32.11  Aligned_cols=49  Identities=20%  Similarity=0.320  Sum_probs=37.3

Q ss_pred             ccCCcccccccChhhHHHHHHHhcC---------------------------CCCccCCCchhccccchHHHHHHH
Q psy6628          76 YQCSQCSKSFFSKYDHKIHSRVHTG---------------------------EKPYACEFCPLTFRHSSHLFRHRR  124 (132)
Q Consensus        76 ~~c~~C~~~~~~~~~l~~h~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~~  124 (132)
                      ..|..|.....+...|..||+.-+.                           .+.-.|..|.-.|-....|..|+.
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~  355 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMV  355 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcc
Confidence            5788898888888889999874221                           123566778889999999999975


No 74 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=89.85  E-value=0.049  Score=34.26  Aligned_cols=14  Identities=14%  Similarity=0.451  Sum_probs=9.8

Q ss_pred             CccCCCchhccccc
Q psy6628         103 PYACEFCPLTFRHS  116 (132)
Q Consensus       103 ~~~C~~C~~~f~~~  116 (132)
                      .+.||.||.+|...
T Consensus        48 V~vCP~CgyA~~~~   61 (214)
T PF09986_consen   48 VWVCPHCGYAAFEE   61 (214)
T ss_pred             EEECCCCCCccccc
Confidence            47888888766543


No 75 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=89.23  E-value=0.3  Score=23.05  Aligned_cols=22  Identities=36%  Similarity=0.680  Sum_probs=14.3

Q ss_pred             ccCCCchhccccc-----hHHHHHHHh
Q psy6628         104 YACEFCPLTFRHS-----SHLFRHRRS  125 (132)
Q Consensus       104 ~~C~~C~~~f~~~-----~~l~~H~~~  125 (132)
                      -.|..|++.+...     ++|.+|+..
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            4566676666543     577788774


No 76 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=89.16  E-value=0.27  Score=21.59  Aligned_cols=11  Identities=36%  Similarity=1.014  Sum_probs=5.9

Q ss_pred             CccCCcccccc
Q psy6628          75 PYQCSQCSKSF   85 (132)
Q Consensus        75 ~~~c~~C~~~~   85 (132)
                      ..+|..|+..|
T Consensus        25 ~v~C~~C~~~f   35 (36)
T PF13717_consen   25 KVRCSKCGHVF   35 (36)
T ss_pred             EEECCCCCCEe
Confidence            34566665544


No 77 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=89.02  E-value=0.47  Score=19.16  Aligned_cols=19  Identities=32%  Similarity=0.625  Sum_probs=13.1

Q ss_pred             eCCCCccccCChhHHHHHHH
Q psy6628          13 TCQVCSKIFSYENGLKAHVR   32 (132)
Q Consensus        13 ~C~~C~~~f~~~~~l~~h~~   32 (132)
                      .||+|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            588888877 4466666654


No 78 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=88.57  E-value=0.33  Score=27.06  Aligned_cols=25  Identities=28%  Similarity=0.578  Sum_probs=20.4

Q ss_pred             ccC----CCchhccccchHHHHHHHhhhh
Q psy6628         104 YAC----EFCPLTFRHSSHLFRHRRSLHQ  128 (132)
Q Consensus       104 ~~C----~~C~~~f~~~~~l~~H~~~~~~  128 (132)
                      |.|    ..|+..+.+...+.+|.+.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            777    7888888888888888888775


No 79 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=88.47  E-value=0.68  Score=22.74  Aligned_cols=9  Identities=44%  Similarity=1.438  Sum_probs=5.0

Q ss_pred             CccCCcccc
Q psy6628          75 PYQCSQCSK   83 (132)
Q Consensus        75 ~~~c~~C~~   83 (132)
                      +|.|+.||.
T Consensus        50 ~Y~Cp~CGF   58 (61)
T COG2888          50 PYRCPKCGF   58 (61)
T ss_pred             ceECCCcCc
Confidence            456666653


No 80 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=88.39  E-value=0.2  Score=23.22  Aligned_cols=8  Identities=25%  Similarity=1.011  Sum_probs=3.7

Q ss_pred             ccCCCchh
Q psy6628         104 YACEFCPL  111 (132)
Q Consensus       104 ~~C~~C~~  111 (132)
                      ..|+.||.
T Consensus        22 ~~Cp~CG~   29 (46)
T PRK00398         22 VRCPYCGY   29 (46)
T ss_pred             eECCCCCC
Confidence            44444443


No 81 
>KOG2482|consensus
Probab=87.64  E-value=1.4  Score=29.82  Aligned_cols=25  Identities=28%  Similarity=0.709  Sum_probs=21.0

Q ss_pred             ccCCCchhccccchHHHHHHHhhhh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRSLHQ  128 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~~~~  128 (132)
                      .+|-.|....-....|..|++..|.
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe  304 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHE  304 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHH
Confidence            5888898888888899999988765


No 82 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=86.34  E-value=0.4  Score=30.97  Aligned_cols=41  Identities=22%  Similarity=0.475  Sum_probs=24.1

Q ss_pred             cccccceeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccC
Q psy6628           4 VHNIHRVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCE   47 (132)
Q Consensus         4 ~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~   47 (132)
                      +|..+.++|.|..|..-+ ..-.--+|+..-.... .. .|+|.
T Consensus       135 vw~hGGrif~CsfC~~fl-CEDDQFEHQAsCQvLe-~E-~~KC~  175 (314)
T PF06524_consen  135 VWDHGGRIFKCSFCDNFL-CEDDQFEHQASCQVLE-SE-TFKCQ  175 (314)
T ss_pred             cccCCCeEEEeecCCCee-eccchhhhhhhhhhhh-cc-ccccc
Confidence            566788999999998743 3333344665432221 12 37776


No 83 
>KOG2785|consensus
Probab=85.90  E-value=0.81  Score=31.22  Aligned_cols=79  Identities=22%  Similarity=0.335  Sum_probs=44.8

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCC----CCCcc-CCcccccccChhhHHHH---HHHhcCCCCccCCCchhcccc
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQK----EKPYQ-CSQCSKSFFSKYDHKIH---SRVHTGEKPYACEFCPLTFRH  115 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~----~~~~~-c~~C~~~~~~~~~l~~h---~~~h~~~~~~~C~~C~~~f~~  115 (132)
                      |+|.   .|...|........|++.....    .+... .++-...|...-....-   .....++-++.|.+|.+.|..
T Consensus         4 ftC~---tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s   80 (390)
T KOG2785|consen    4 FTCN---TCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFAS   80 (390)
T ss_pred             ceee---ceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccC
Confidence            8898   8999999887777777422111    01111 11111222111111000   111344568999999999999


Q ss_pred             chHHHHHHHh
Q psy6628         116 SSHLFRHRRS  125 (132)
Q Consensus       116 ~~~l~~H~~~  125 (132)
                      ......|+..
T Consensus        81 ~~a~~~hl~S   90 (390)
T KOG2785|consen   81 PKAHENHLKS   90 (390)
T ss_pred             hhhHHHHHHH
Confidence            9888888764


No 84 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=85.58  E-value=0.23  Score=23.58  Aligned_cols=11  Identities=27%  Similarity=1.099  Sum_probs=5.8

Q ss_pred             cccCCCCCCccccc
Q psy6628          44 FKCEGRGECDRVFT   57 (132)
Q Consensus        44 ~~c~~~~~c~~~~~   57 (132)
                      |.|.   .|+..|.
T Consensus         6 y~C~---~Cg~~fe   16 (52)
T TIGR02605         6 YRCT---ACGHRFE   16 (52)
T ss_pred             EEeC---CCCCEeE
Confidence            4555   5555554


No 85 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=85.45  E-value=0.29  Score=33.51  Aligned_cols=61  Identities=30%  Similarity=0.556  Sum_probs=44.6

Q ss_pred             cccCCCCCCcccccChHHHHhhhhh-ccCCC--CCccCC--cccccccChhhHHHHHHHhcCCCCccCC
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKR-DHQKE--KPYQCS--QCSKSFFSKYDHKIHSRVHTGEKPYACE  107 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~-~~~~~--~~~~c~--~C~~~~~~~~~l~~h~~~h~~~~~~~C~  107 (132)
                      +.|.   .|...|.....+..|... .|.++  +++.|.  .|++.|.....+..|...|.+..+..+.
T Consensus       290 ~~~~---~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         290 IKSK---QCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             CCCc---cccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            5555   677777777777777732 67777  788888  6888888888888888877776665553


No 86 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=83.47  E-value=1  Score=19.79  Aligned_cols=10  Identities=30%  Similarity=1.075  Sum_probs=4.7

Q ss_pred             ccCCcccccc
Q psy6628          76 YQCSQCSKSF   85 (132)
Q Consensus        76 ~~c~~C~~~~   85 (132)
                      .+|..|+..|
T Consensus        26 vrC~~C~~~f   35 (37)
T PF13719_consen   26 VRCPKCGHVF   35 (37)
T ss_pred             EECCCCCcEe
Confidence            4455554443


No 87 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=82.94  E-value=1.3  Score=26.52  Aligned_cols=32  Identities=13%  Similarity=0.304  Sum_probs=19.8

Q ss_pred             CCCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhcc
Q psy6628          73 EKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTF  113 (132)
Q Consensus        73 ~~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f  113 (132)
                      ..-|.|+.|+..|.+...+.         .-|.|+.||...
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            34566777777776665553         247777777543


No 88 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=82.75  E-value=0.87  Score=18.05  Aligned_cols=11  Identities=36%  Similarity=0.781  Sum_probs=8.5

Q ss_pred             ceeeeCCCCcc
Q psy6628           9 RVVFTCQVCSK   19 (132)
Q Consensus         9 ~~~~~C~~C~~   19 (132)
                      ...|.||.||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            45699999984


No 89 
>KOG4167|consensus
Probab=82.62  E-value=0.28  Score=36.23  Aligned_cols=28  Identities=25%  Similarity=0.579  Sum_probs=24.6

Q ss_pred             ceeeeCCCCccccCChhHHHHHHHhhcC
Q psy6628           9 RVVFTCQVCSKIFSYENGLKAHVRNKHG   36 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~   36 (132)
                      .-.|.|.+|+++|.....+..||..|..
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            3469999999999999999999998863


No 90 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=82.31  E-value=0.9  Score=20.95  Aligned_cols=8  Identities=25%  Similarity=0.966  Sum_probs=3.8

Q ss_pred             ccCCcccc
Q psy6628          76 YQCSQCSK   83 (132)
Q Consensus        76 ~~c~~C~~   83 (132)
                      ..|+.||.
T Consensus        20 irC~~CG~   27 (44)
T smart00659       20 VRCRECGY   27 (44)
T ss_pred             eECCCCCc
Confidence            44555543


No 91 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=81.63  E-value=1.7  Score=19.60  Aligned_cols=23  Identities=13%  Similarity=0.348  Sum_probs=14.0

Q ss_pred             ccCCCchhccc--cchHHHHHHHhh
Q psy6628         104 YACEFCPLTFR--HSSHLFRHRRSL  126 (132)
Q Consensus       104 ~~C~~C~~~f~--~~~~l~~H~~~~  126 (132)
                      -.|+.|+..|.  ...+-..|.+.|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            47777777665  345555665544


No 92 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=81.45  E-value=0.28  Score=29.24  Aligned_cols=13  Identities=31%  Similarity=0.692  Sum_probs=8.0

Q ss_pred             ccCCcccccccCh
Q psy6628          76 YQCSQCSKSFFSK   88 (132)
Q Consensus        76 ~~c~~C~~~~~~~   88 (132)
                      ++|+.||..|...
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            5666676666543


No 93 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.26  E-value=1.2  Score=25.52  Aligned_cols=30  Identities=17%  Similarity=0.256  Sum_probs=18.8

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccCh
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSK   88 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~   88 (132)
                      ..|+   .|+..|....            ..|..|+.||..|.-.
T Consensus        10 r~Cp---~cg~kFYDLn------------k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICP---NTGSKFYDLN------------RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCC---CcCccccccC------------CCCccCCCcCCccCcc
Confidence            5677   7777766431            2466777777776554


No 94 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=80.29  E-value=1.8  Score=21.32  Aligned_cols=9  Identities=44%  Similarity=1.383  Sum_probs=5.6

Q ss_pred             CccCCcccc
Q psy6628          75 PYQCSQCSK   83 (132)
Q Consensus        75 ~~~c~~C~~   83 (132)
                      +|.|+.||.
T Consensus        48 ~Y~CP~CGF   56 (59)
T PRK14890         48 PYTCPKCGF   56 (59)
T ss_pred             ceECCCCCC
Confidence            466766654


No 95 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=79.92  E-value=1.4  Score=19.27  Aligned_cols=7  Identities=29%  Similarity=1.303  Sum_probs=2.9

Q ss_pred             cCCcccc
Q psy6628          77 QCSQCSK   83 (132)
Q Consensus        77 ~c~~C~~   83 (132)
                      .|..|+.
T Consensus        27 ~C~~C~~   33 (38)
T TIGR02098        27 RCGKCGH   33 (38)
T ss_pred             ECCCCCC
Confidence            3444443


No 96 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=79.80  E-value=1.3  Score=23.83  Aligned_cols=31  Identities=26%  Similarity=0.635  Sum_probs=21.4

Q ss_pred             CCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccc
Q psy6628          74 KPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFR  114 (132)
Q Consensus        74 ~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~  114 (132)
                      +|-.|..||..|...          .-.+|-.|+.|.....
T Consensus        57 ~Pa~CkkCGfef~~~----------~ik~pSRCP~CKSE~I   87 (97)
T COG3357          57 RPARCKKCGFEFRDD----------KIKKPSRCPKCKSEWI   87 (97)
T ss_pred             cChhhcccCcccccc----------ccCCcccCCcchhhcc
Confidence            567888898888662          1246788888875543


No 97 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=79.73  E-value=1.1  Score=18.15  Aligned_cols=11  Identities=27%  Similarity=0.516  Sum_probs=8.1

Q ss_pred             eeCCCCccccC
Q psy6628          12 FTCQVCSKIFS   22 (132)
Q Consensus        12 ~~C~~C~~~f~   22 (132)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            45888888774


No 98 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=79.45  E-value=1.9  Score=26.48  Aligned_cols=31  Identities=16%  Similarity=0.388  Sum_probs=18.7

Q ss_pred             CCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhcc
Q psy6628          74 KPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTF  113 (132)
Q Consensus        74 ~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f  113 (132)
                      ..|.|+.|+..|.+...+.         .-|.|+.||...
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            4466777777666655431         247777777543


No 99 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=78.50  E-value=1.1  Score=23.85  Aligned_cols=11  Identities=27%  Similarity=0.772  Sum_probs=5.3

Q ss_pred             CccCCCchhcc
Q psy6628         103 PYACEFCPLTF  113 (132)
Q Consensus       103 ~~~C~~C~~~f  113 (132)
                      .|.|..|+..|
T Consensus        53 IW~C~kCg~~f   63 (89)
T COG1997          53 IWKCRKCGAKF   63 (89)
T ss_pred             eEEcCCCCCee
Confidence            34555554444


No 100
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=75.98  E-value=2.1  Score=30.34  Aligned_cols=26  Identities=19%  Similarity=0.470  Sum_probs=19.7

Q ss_pred             CCccCCCchhccccchHHHHHHHhhh
Q psy6628         102 KPYACEFCPLTFRHSSHLFRHRRSLH  127 (132)
Q Consensus       102 ~~~~C~~C~~~f~~~~~l~~H~~~~~  127 (132)
                      +.|.|+.|.+.|.....+..|+...|
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhh
Confidence            46778888888888888888876544


No 101
>KOG2231|consensus
Probab=75.86  E-value=11  Score=28.24  Aligned_cols=90  Identities=23%  Similarity=0.349  Sum_probs=50.5

Q ss_pred             ChhHHHHHHHhhcC-CCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCccc------ccccChhhHHHHH
Q psy6628          23 YENGLKAHVRNKHG-SSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCS------KSFFSKYDHKIHS   95 (132)
Q Consensus        23 ~~~~l~~h~~~~~~-~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~------~~~~~~~~l~~h~   95 (132)
                      .+..|..|+..-.. .....--..|.   .|...|.....|..|++..|     +.|..|.      .-|.+...|..|-
T Consensus       161 t~~el~~h~~~gd~d~~s~rGhp~C~---~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~Hf  232 (669)
T KOG2231|consen  161 TRAELNLHLMFGDPDDESCRGHPLCK---FCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHF  232 (669)
T ss_pred             hHHHHHHHHhcCCCccccccCCccch---hhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHh
Confidence            34667777654332 11111113566   88899999999999985433     4566663      3345556666666


Q ss_pred             HHhcCCCCccCC--Cch-hccccchHHHHHHH
Q psy6628          96 RVHTGEKPYACE--FCP-LTFRHSSHLFRHRR  124 (132)
Q Consensus        96 ~~h~~~~~~~C~--~C~-~~f~~~~~l~~H~~  124 (132)
                      +.    ..|.|.  .|. +.|.....+..+++
T Consensus       233 R~----~HflCE~~~C~~~~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  233 RK----GHFLCEEEFCRTKKFYVAFELEIELK  260 (669)
T ss_pred             hh----cCccccccccccceeeehhHHHHHHH
Confidence            54    346776  454 34444434455554


No 102
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=74.94  E-value=6.2  Score=23.32  Aligned_cols=14  Identities=29%  Similarity=0.764  Sum_probs=8.0

Q ss_pred             ccccCCCCCCcccccCh
Q psy6628          43 RFKCEGRGECDRVFTTR   59 (132)
Q Consensus        43 ~~~c~~~~~c~~~~~~~   59 (132)
                      .|.|+   .|+..|...
T Consensus        99 ~Y~Cp---~C~~~y~~~  112 (147)
T smart00531       99 YYKCP---NCQSKYTFL  112 (147)
T ss_pred             EEECc---CCCCEeeHH
Confidence            36666   566665543


No 103
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=74.82  E-value=1.7  Score=19.25  Aligned_cols=14  Identities=21%  Similarity=0.679  Sum_probs=10.6

Q ss_pred             eeeCCCCccccCCh
Q psy6628          11 VFTCQVCSKIFSYE   24 (132)
Q Consensus        11 ~~~C~~C~~~f~~~   24 (132)
                      .|.|+.||..|.-.
T Consensus         5 ~y~C~~Cg~~fe~~   18 (41)
T smart00834        5 EYRCEDCGHTFEVL   18 (41)
T ss_pred             EEEcCCCCCEEEEE
Confidence            48899999887543


No 104
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=73.62  E-value=1.2  Score=19.58  Aligned_cols=8  Identities=25%  Similarity=0.924  Sum_probs=3.9

Q ss_pred             cCCccccc
Q psy6628          77 QCSQCSKS   84 (132)
Q Consensus        77 ~c~~C~~~   84 (132)
                      .|+.||..
T Consensus        23 ~Cd~cg~~   30 (36)
T PF05191_consen   23 VCDNCGGE   30 (36)
T ss_dssp             BCTTTTEB
T ss_pred             ccCCCCCe
Confidence            45555543


No 105
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=73.07  E-value=4.4  Score=27.64  Aligned_cols=75  Identities=28%  Similarity=0.481  Sum_probs=43.6

Q ss_pred             ccCCCCCCcccccChHHHHhhhhhccCCCCCccCCccccc----ccChhhHHHHHHHhcCCCCccCCC--ch----hccc
Q psy6628          45 KCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKS----FFSKYDHKIHSRVHTGEKPYACEF--CP----LTFR  114 (132)
Q Consensus        45 ~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~----~~~~~~l~~h~~~h~~~~~~~C~~--C~----~~f~  114 (132)
                      .|.   .|...|.....|..|++..|  ++=+.|+.-+..    |.+...|..|.+    ...|.|.+  |.    ..|.
T Consensus       222 ~C~---FC~~~FYdDDEL~~HcR~~H--E~ChICD~v~p~~~QYFK~Y~~Le~HF~----~~hy~ct~qtc~~~k~~vf~  292 (493)
T COG5236         222 LCI---FCKIYFYDDDELRRHCRLRH--EACHICDMVGPIRYQYFKSYEDLEAHFR----NAHYCCTFQTCRVGKCYVFP  292 (493)
T ss_pred             hhh---hccceecChHHHHHHHHhhh--hhhhhhhccCccchhhhhCHHHHHHHhh----cCceEEEEEEEecCcEEEec
Confidence            455   78888888888888874433  333344433221    444455555544    23366643  32    3567


Q ss_pred             cchHHHHHHHhhhh
Q psy6628         115 HSSHLFRHRRSLHQ  128 (132)
Q Consensus       115 ~~~~l~~H~~~~~~  128 (132)
                      +...|..|+-..|+
T Consensus       293 ~~~el~~h~~~~h~  306 (493)
T COG5236         293 YHTELLEHLTRFHK  306 (493)
T ss_pred             cHHHHHHHHHHHhh
Confidence            77788888766655


No 106
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=73.03  E-value=7.1  Score=17.44  Aligned_cols=12  Identities=17%  Similarity=0.476  Sum_probs=5.6

Q ss_pred             CCcccccChHHH
Q psy6628          51 ECDRVFTTRNML   62 (132)
Q Consensus        51 ~c~~~~~~~~~l   62 (132)
                      .|+-.+.....+
T Consensus        24 ~C~G~W~d~~el   35 (41)
T PF13453_consen   24 SCGGIWFDAGEL   35 (41)
T ss_pred             CCCeEEccHHHH
Confidence            455554444433


No 107
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=72.73  E-value=1.7  Score=20.53  Aligned_cols=8  Identities=25%  Similarity=0.957  Sum_probs=4.1

Q ss_pred             ccCCcccc
Q psy6628          76 YQCSQCSK   83 (132)
Q Consensus        76 ~~c~~C~~   83 (132)
                      ..|+.||.
T Consensus        25 irCp~Cg~   32 (49)
T COG1996          25 IRCPYCGS   32 (49)
T ss_pred             eeCCCCCc
Confidence            45555553


No 108
>PHA00626 hypothetical protein
Probab=72.31  E-value=1.8  Score=21.02  Aligned_cols=15  Identities=20%  Similarity=0.405  Sum_probs=11.3

Q ss_pred             CCCccCCCchhcccc
Q psy6628         101 EKPYACEFCPLTFRH  115 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~  115 (132)
                      ...|.|+.|+..|+-
T Consensus        21 snrYkCkdCGY~ft~   35 (59)
T PHA00626         21 SDDYVCCDCGYNDSK   35 (59)
T ss_pred             CcceEcCCCCCeech
Confidence            356888888887763


No 109
>KOG2186|consensus
Probab=72.29  E-value=3  Score=27.03  Aligned_cols=46  Identities=26%  Similarity=0.596  Sum_probs=34.0

Q ss_pred             eeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhh
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIK   67 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~   67 (132)
                      |.|..||..... ..+..|+..-.+     ..|.|-   .|+..|.. ..+..|..
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn-----~~fSCI---DC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRN-----AYFSCI---DCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccC-----CeeEEe---eccccccc-chhhhhhh
Confidence            789999998765 456668876544     238898   89999987 56777764


No 110
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=71.71  E-value=1.3  Score=22.81  Aligned_cols=16  Identities=38%  Similarity=0.798  Sum_probs=8.9

Q ss_pred             CCCccCC--cccccccCh
Q psy6628          73 EKPYQCS--QCSKSFFSK   88 (132)
Q Consensus        73 ~~~~~c~--~C~~~~~~~   88 (132)
                      ++.++|.  .||..|...
T Consensus        25 ~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         25 ERYHQCQNVNCSATFITY   42 (72)
T ss_pred             eeeeecCCCCCCCEEEEE
Confidence            3445665  566666543


No 111
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=70.41  E-value=1.7  Score=27.53  Aligned_cols=27  Identities=22%  Similarity=0.327  Sum_probs=20.3

Q ss_pred             CCCccCCcccccccChhhHHHHHHHhc
Q psy6628          73 EKPYQCSQCSKSFFSKYDHKIHSRVHT   99 (132)
Q Consensus        73 ~~~~~c~~C~~~~~~~~~l~~h~~~h~   99 (132)
                      +..|.|.+|++.|.....+.+|+..-+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcC
Confidence            345899999999999999999987544


No 112
>KOG2785|consensus
Probab=70.32  E-value=5.3  Score=27.53  Aligned_cols=52  Identities=25%  Similarity=0.362  Sum_probs=41.9

Q ss_pred             CCccCCcccccccChhhHHHHHHHhcCC-----------------------CCccCCCch---hccccchHHHHHHHh
Q psy6628          74 KPYQCSQCSKSFFSKYDHKIHSRVHTGE-----------------------KPYACEFCP---LTFRHSSHLFRHRRS  125 (132)
Q Consensus        74 ~~~~c~~C~~~~~~~~~l~~h~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~  125 (132)
                      .|-.|..|+..+.....-..||..+++-                       .-+.|-.|.   +.|.+....+.|+..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            3467899999999999999999877651                       236677777   999999999999864


No 113
>KOG4118|consensus
Probab=70.16  E-value=2.3  Score=21.33  Aligned_cols=27  Identities=15%  Similarity=0.310  Sum_probs=15.6

Q ss_pred             ccCCCchhccccchHHHHHHHhhhhhc
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRSLHQMY  130 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~~~~~~  130 (132)
                      |.|.+|...-...-.+..|....|++.
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~   65 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKE   65 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCC
Confidence            566666655555555566665555443


No 114
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=70.00  E-value=1.7  Score=25.40  Aligned_cols=15  Identities=20%  Similarity=0.581  Sum_probs=10.0

Q ss_pred             CCccCCcccccccCh
Q psy6628          74 KPYQCSQCSKSFFSK   88 (132)
Q Consensus        74 ~~~~c~~C~~~~~~~   88 (132)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            346788888776553


No 115
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=69.80  E-value=2.4  Score=19.17  Aligned_cols=14  Identities=21%  Similarity=0.653  Sum_probs=10.7

Q ss_pred             eeeCCCCccccCCh
Q psy6628          11 VFTCQVCSKIFSYE   24 (132)
Q Consensus        11 ~~~C~~C~~~f~~~   24 (132)
                      .|.|..||..|...
T Consensus         5 ey~C~~Cg~~fe~~   18 (42)
T PF09723_consen    5 EYRCEECGHEFEVL   18 (42)
T ss_pred             EEEeCCCCCEEEEE
Confidence            48899999887554


No 116
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=68.14  E-value=3.2  Score=19.10  Aligned_cols=21  Identities=48%  Similarity=0.991  Sum_probs=12.6

Q ss_pred             ccCCCchhccccchHHHHHHH
Q psy6628         104 YACEFCPLTFRHSSHLFRHRR  124 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~  124 (132)
                      |+|-.|......++.|-+|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            445556556666666666664


No 117
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=67.14  E-value=2.6  Score=24.48  Aligned_cols=22  Identities=23%  Similarity=0.174  Sum_probs=11.3

Q ss_pred             ccCCCchhccccchHHHHHHHhhhh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRSLHQ  128 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~~~~  128 (132)
                      ..|-++|+.|.   +|++|+..|++
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            34445555554   45555555544


No 118
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=67.05  E-value=3.5  Score=19.51  Aligned_cols=14  Identities=29%  Similarity=0.653  Sum_probs=8.4

Q ss_pred             ceeeeCCCCccccC
Q psy6628           9 RVVFTCQVCSKIFS   22 (132)
Q Consensus         9 ~~~~~C~~C~~~f~   22 (132)
                      ++++.|..||..|.
T Consensus         2 Dk~l~C~dCg~~Fv   15 (49)
T PF13451_consen    2 DKTLTCKDCGAEFV   15 (49)
T ss_pred             CeeEEcccCCCeEE
Confidence            45566666666553


No 119
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=66.25  E-value=2.3  Score=20.36  Aligned_cols=11  Identities=18%  Similarity=0.709  Sum_probs=6.0

Q ss_pred             cCCCchhcccc
Q psy6628         105 ACEFCPLTFRH  115 (132)
Q Consensus       105 ~C~~C~~~f~~  115 (132)
                      .||+|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            89999999874


No 120
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=66.13  E-value=2.2  Score=23.03  Aligned_cols=11  Identities=27%  Similarity=0.600  Sum_probs=5.2

Q ss_pred             CccCCCchhcc
Q psy6628         103 PYACEFCPLTF  113 (132)
Q Consensus       103 ~~~C~~C~~~f  113 (132)
                      .|.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PTZ00255         54 IWRCKGCKKTV   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            34444444444


No 121
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=66.08  E-value=3.8  Score=18.28  Aligned_cols=14  Identities=36%  Similarity=0.880  Sum_probs=11.4

Q ss_pred             eeeCCCCccccCCh
Q psy6628          11 VFTCQVCSKIFSYE   24 (132)
Q Consensus        11 ~~~C~~C~~~f~~~   24 (132)
                      +++|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899999988653


No 122
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=66.05  E-value=2.1  Score=17.96  Aligned_cols=7  Identities=29%  Similarity=0.814  Sum_probs=2.9

Q ss_pred             ccCCCch
Q psy6628         104 YACEFCP  110 (132)
Q Consensus       104 ~~C~~C~  110 (132)
                      +.|+.|+
T Consensus        20 ~vCp~C~   26 (30)
T PF08274_consen   20 LVCPECG   26 (30)
T ss_dssp             EEETTTT
T ss_pred             EeCCccc
Confidence            4444443


No 123
>KOG3408|consensus
Probab=65.97  E-value=4.1  Score=23.25  Aligned_cols=26  Identities=23%  Similarity=0.423  Sum_probs=19.4

Q ss_pred             CCCCccCCCchhccccchHHHHHHHh
Q psy6628         100 GEKPYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       100 ~~~~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      |...|.|-.|.+-|.+...|..|.+.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            44457888888888888888888764


No 124
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=65.46  E-value=3.1  Score=17.73  Aligned_cols=8  Identities=25%  Similarity=1.120  Sum_probs=3.8

Q ss_pred             ccCCcccc
Q psy6628          76 YQCSQCSK   83 (132)
Q Consensus        76 ~~c~~C~~   83 (132)
                      ..|..||.
T Consensus        18 irC~~CG~   25 (32)
T PF03604_consen   18 IRCPECGH   25 (32)
T ss_dssp             SSBSSSS-
T ss_pred             EECCcCCC
Confidence            45555554


No 125
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=65.41  E-value=3.2  Score=20.10  Aligned_cols=27  Identities=15%  Similarity=0.401  Sum_probs=13.7

Q ss_pred             hhhHHHHHHHhcCCCCccCCC----chhccc
Q psy6628          88 KYDHKIHSRVHTGEKPYACEF----CPLTFR  114 (132)
Q Consensus        88 ~~~l~~h~~~h~~~~~~~C~~----C~~~f~  114 (132)
                      ...|..|....-..++..|+.    |...+.
T Consensus        23 r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen   23 RKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             CCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             HHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            345666666544456666666    665553


No 126
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=64.15  E-value=3.6  Score=19.47  Aligned_cols=9  Identities=22%  Similarity=0.873  Sum_probs=3.4

Q ss_pred             CccCCCchh
Q psy6628         103 PYACEFCPL  111 (132)
Q Consensus       103 ~~~C~~C~~  111 (132)
                      .|+|++|++
T Consensus        41 ~W~CPiC~~   49 (50)
T PF02891_consen   41 KWKCPICNK   49 (50)
T ss_dssp             --B-TTT--
T ss_pred             CeECcCCcC
Confidence            388888865


No 127
>KOG2807|consensus
Probab=62.81  E-value=14  Score=25.15  Aligned_cols=25  Identities=28%  Similarity=0.506  Sum_probs=15.9

Q ss_pred             CCccCCCchhccccchHHHHHHHhh
Q psy6628         102 KPYACEFCPLTFRHSSHLFRHRRSL  126 (132)
Q Consensus       102 ~~~~C~~C~~~f~~~~~l~~H~~~~  126 (132)
                      -.|.|..|...|-...+.-.|...|
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh
Confidence            3477777777776666666665543


No 128
>PLN02294 cytochrome c oxidase subunit Vb
Probab=62.77  E-value=3.6  Score=25.01  Aligned_cols=13  Identities=38%  Similarity=0.991  Sum_probs=6.5

Q ss_pred             ceeeeCCCCcccc
Q psy6628           9 RVVFTCQVCSKIF   21 (132)
Q Consensus         9 ~~~~~C~~C~~~f   21 (132)
                      ++++.|++||..|
T Consensus       139 Gkp~RCpeCG~~f  151 (174)
T PLN02294        139 GKSFECPVCTQYF  151 (174)
T ss_pred             CCceeCCCCCCEE
Confidence            3445555555544


No 129
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=62.28  E-value=5.2  Score=17.58  Aligned_cols=13  Identities=23%  Similarity=0.779  Sum_probs=7.0

Q ss_pred             ceeeeCCCCcccc
Q psy6628           9 RVVFTCQVCSKIF   21 (132)
Q Consensus         9 ~~~~~C~~C~~~f   21 (132)
                      .+.|+|..||...
T Consensus         4 ~~~YkC~~CGniV   16 (36)
T PF06397_consen    4 GEFYKCEHCGNIV   16 (36)
T ss_dssp             TEEEE-TTT--EE
T ss_pred             ccEEEccCCCCEE
Confidence            3568888888754


No 130
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=62.04  E-value=1.3  Score=28.20  Aligned_cols=8  Identities=25%  Similarity=0.808  Sum_probs=5.6

Q ss_pred             ccCCCchh
Q psy6628         104 YACEFCPL  111 (132)
Q Consensus       104 ~~C~~C~~  111 (132)
                      +.||.|..
T Consensus        63 vvCP~C~y   70 (267)
T COG1655          63 VVCPICYY   70 (267)
T ss_pred             EEcchhhH
Confidence            67777764


No 131
>KOG0717|consensus
Probab=60.70  E-value=4.2  Score=28.84  Aligned_cols=22  Identities=27%  Similarity=0.582  Sum_probs=20.0

Q ss_pred             ccCCCchhccccchHHHHHHHh
Q psy6628         104 YACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       104 ~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      +.|.+|.+.|.+...|.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            8899999999999999999754


No 132
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=59.24  E-value=2.9  Score=22.62  Aligned_cols=10  Identities=30%  Similarity=1.182  Sum_probs=4.8

Q ss_pred             ccCCcccccc
Q psy6628          76 YQCSQCSKSF   85 (132)
Q Consensus        76 ~~c~~C~~~~   85 (132)
                      |.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (91)
T TIGR00280        54 WTCRKCGAKF   63 (91)
T ss_pred             EEcCCCCCEE
Confidence            4454444444


No 133
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=59.24  E-value=1.8  Score=23.35  Aligned_cols=10  Identities=30%  Similarity=0.932  Sum_probs=5.0

Q ss_pred             ccCCCchhcc
Q psy6628         104 YACEFCPLTF  113 (132)
Q Consensus       104 ~~C~~C~~~f  113 (132)
                      |.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (90)
T PF01780_consen   54 WKCKKCGKKF   63 (90)
T ss_dssp             EEETTTTEEE
T ss_pred             eecCCCCCEE
Confidence            5555555444


No 134
>KOG2593|consensus
Probab=58.05  E-value=4.8  Score=28.20  Aligned_cols=17  Identities=18%  Similarity=0.483  Sum_probs=9.4

Q ss_pred             ceeeeCCCCccccCChh
Q psy6628           9 RVVFTCQVCSKIFSYEN   25 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~   25 (132)
                      ...|.|+.|.+.|....
T Consensus       126 ~~~Y~Cp~C~kkyt~Le  142 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLE  142 (436)
T ss_pred             cccccCCccccchhhhH
Confidence            34466666666665443


No 135
>KOG1842|consensus
Probab=56.74  E-value=6.6  Score=27.75  Aligned_cols=26  Identities=15%  Similarity=0.149  Sum_probs=17.9

Q ss_pred             CccCCcccccccChhhHHHHHHHhcC
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTG  100 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~  100 (132)
                      .|.|+.|...|.+...|..|....+.
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcc
Confidence            36777777777777777777655443


No 136
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=56.31  E-value=5.3  Score=23.17  Aligned_cols=15  Identities=20%  Similarity=0.669  Sum_probs=12.2

Q ss_pred             eeeCCCCccccCChh
Q psy6628          11 VFTCQVCSKIFSYEN   25 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~   25 (132)
                      |+.|..||++|.+..
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            578999999998764


No 137
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=55.96  E-value=5  Score=18.28  Aligned_cols=12  Identities=25%  Similarity=0.664  Sum_probs=9.1

Q ss_pred             cCCCchhccccc
Q psy6628         105 ACEFCPLTFRHS  116 (132)
Q Consensus       105 ~C~~C~~~f~~~  116 (132)
                      .|.+|++.|+.+
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            578888888754


No 138
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=55.95  E-value=1.7  Score=17.93  Aligned_cols=8  Identities=63%  Similarity=1.456  Sum_probs=3.9

Q ss_pred             CCcccccc
Q psy6628          78 CSQCSKSF   85 (132)
Q Consensus        78 c~~C~~~~   85 (132)
                      |..|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            44455554


No 139
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=55.71  E-value=7.1  Score=21.58  Aligned_cols=16  Identities=19%  Similarity=0.629  Sum_probs=12.9

Q ss_pred             eeeeCCCCccccCChh
Q psy6628          10 VVFTCQVCSKIFSYEN   25 (132)
Q Consensus        10 ~~~~C~~C~~~f~~~~   25 (132)
                      +++.|.-||.+|....
T Consensus         1 MpH~CtrCG~vf~~g~   16 (112)
T COG3364           1 MPHQCTRCGEVFDDGS   16 (112)
T ss_pred             CCceeccccccccccc
Confidence            3678999999998864


No 140
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=55.31  E-value=3.6  Score=18.55  Aligned_cols=12  Identities=25%  Similarity=0.974  Sum_probs=7.7

Q ss_pred             CCccCCCchhcc
Q psy6628         102 KPYACEFCPLTF  113 (132)
Q Consensus       102 ~~~~C~~C~~~f  113 (132)
                      ++..|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            356677777665


No 141
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=53.93  E-value=12  Score=18.25  Aligned_cols=10  Identities=20%  Similarity=0.893  Sum_probs=5.0

Q ss_pred             CCccCCcccc
Q psy6628          74 KPYQCSQCSK   83 (132)
Q Consensus        74 ~~~~c~~C~~   83 (132)
                      ..|.|+.||-
T Consensus        13 v~~~Cp~cGi   22 (55)
T PF13824_consen   13 VNFECPDCGI   22 (55)
T ss_pred             cCCcCCCCCC
Confidence            3455555553


No 142
>KOG4124|consensus
Probab=53.57  E-value=2.9  Score=28.48  Aligned_cols=48  Identities=33%  Similarity=0.739  Sum_probs=33.8

Q ss_pred             CCccCCc--ccccccChhhHHHHHHH---------------hc----CCCCccCCCchhccccchHHHH
Q psy6628          74 KPYQCSQ--CSKSFFSKYDHKIHSRV---------------HT----GEKPYACEFCPLTFRHSSHLFR  121 (132)
Q Consensus        74 ~~~~c~~--C~~~~~~~~~l~~h~~~---------------h~----~~~~~~C~~C~~~f~~~~~l~~  121 (132)
                      +++.|.+  |.+.+.....|..|-..               |.    ..|+|.|++|.+.+.....|.-
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~  416 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKY  416 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCc
Confidence            6778877  88888877777666432               11    2589999999998876655543


No 143
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=52.99  E-value=5.2  Score=30.02  Aligned_cols=55  Identities=22%  Similarity=0.533  Sum_probs=35.4

Q ss_pred             CCcccccChHHHHhhhhhccCCCCCc-cCCcccccccChhhHHHHHHHhcCCCCccCCCchhcc
Q psy6628          51 ECDRVFTTRNMLNIHIKRDHQKEKPY-QCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTF  113 (132)
Q Consensus        51 ~c~~~~~~~~~l~~h~~~~~~~~~~~-~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f  113 (132)
                      .||-+|+....|--..  ..+.-+.| -|+.|.+.+.+..+-+-|      ..|..|+.||-..
T Consensus       128 ~CGPRfTIi~alPYDR--~nTsM~~F~lC~~C~~EY~dP~nRRfH------AQp~aCp~CGP~~  183 (750)
T COG0068         128 NCGPRFTIIEALPYDR--ENTSMADFPLCPFCDKEYKDPLNRRFH------AQPIACPKCGPHL  183 (750)
T ss_pred             CCCcceeeeccCCCCc--ccCccccCcCCHHHHHHhcCccccccc------cccccCcccCCCe
Confidence            8888888766554432  23333334 588898888776654333      3678899998533


No 144
>KOG1842|consensus
Probab=52.89  E-value=8.4  Score=27.26  Aligned_cols=26  Identities=23%  Similarity=0.408  Sum_probs=23.4

Q ss_pred             eeeCCCCccccCChhHHHHHHHhhcC
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRNKHG   36 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~~~~   36 (132)
                      .|.||+|...|.+...|..|...-+.
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcc
Confidence            48999999999999999999987664


No 145
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=51.92  E-value=11  Score=19.58  Aligned_cols=31  Identities=26%  Similarity=0.698  Sum_probs=18.6

Q ss_pred             eeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCccc
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRV   55 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~   55 (132)
                      .|+|..|+..|    .+.+++.       +.|.-.|+   .|+..
T Consensus        12 ~Y~c~~cg~~~----dvvq~~~-------ddplt~ce---~c~a~   42 (82)
T COG2331          12 SYECTECGNRF----DVVQAMT-------DDPLTTCE---ECGAR   42 (82)
T ss_pred             EEeecccchHH----HHHHhcc-------cCccccCh---hhChH
Confidence            48888888754    4444443       33335777   67643


No 146
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=51.67  E-value=6.3  Score=17.88  Aligned_cols=15  Identities=33%  Similarity=0.882  Sum_probs=9.3

Q ss_pred             eeeeCCCCccccCCh
Q psy6628          10 VVFTCQVCSKIFSYE   24 (132)
Q Consensus        10 ~~~~C~~C~~~f~~~   24 (132)
                      .++.|..|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            578899999988543


No 147
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=51.26  E-value=4.4  Score=21.88  Aligned_cols=10  Identities=30%  Similarity=1.238  Sum_probs=4.9

Q ss_pred             ccCCcccccc
Q psy6628          76 YQCSQCSKSF   85 (132)
Q Consensus        76 ~~c~~C~~~~   85 (132)
                      |.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PRK03976         55 WECRKCGAKF   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            4455555444


No 148
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=50.34  E-value=1.5  Score=19.72  Aligned_cols=9  Identities=33%  Similarity=1.224  Sum_probs=4.0

Q ss_pred             ccCCccccc
Q psy6628          76 YQCSQCSKS   84 (132)
Q Consensus        76 ~~c~~C~~~   84 (132)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            444444433


No 149
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=50.32  E-value=3.2  Score=19.86  Aligned_cols=25  Identities=32%  Similarity=0.743  Sum_probs=12.7

Q ss_pred             CCccCCcccccccChhhHHHHHHHh
Q psy6628          74 KPYQCSQCSKSFFSKYDHKIHSRVH   98 (132)
Q Consensus        74 ~~~~c~~C~~~~~~~~~l~~h~~~h   98 (132)
                      ..|+|+.|...|...-++..|...|
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CeEECCCCCCccccCcChhhhcccc
Confidence            3577888888777777766664444


No 150
>PF14353 CpXC:  CpXC protein
Probab=50.23  E-value=9.3  Score=21.88  Aligned_cols=13  Identities=38%  Similarity=0.922  Sum_probs=10.4

Q ss_pred             eeeCCCCccccCC
Q psy6628          11 VFTCQVCSKIFSY   23 (132)
Q Consensus        11 ~~~C~~C~~~f~~   23 (132)
                      .++||.||..|.-
T Consensus        38 ~~~CP~Cg~~~~~   50 (128)
T PF14353_consen   38 SFTCPSCGHKFRL   50 (128)
T ss_pred             EEECCCCCCceec
Confidence            5899999987743


No 151
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=49.76  E-value=7.4  Score=18.25  Aligned_cols=12  Identities=42%  Similarity=1.137  Sum_probs=6.8

Q ss_pred             CCCCccccCChh
Q psy6628          14 CQVCSKIFSYEN   25 (132)
Q Consensus        14 C~~C~~~f~~~~   25 (132)
                      |+.|+..|..+.
T Consensus        15 CpvCqRPFsWRk   26 (54)
T COG4338          15 CPVCQRPFSWRK   26 (54)
T ss_pred             hhhhcCchHHHH
Confidence            666666665443


No 152
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=49.73  E-value=7.8  Score=21.93  Aligned_cols=25  Identities=28%  Similarity=0.666  Sum_probs=16.4

Q ss_pred             CccCCcccccccChhhHHHHHHHhcCCCCccCCCchh
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPL  111 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  111 (132)
                      .+.|..|+..|.....            .+.||.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~~~CP~Cgs   94 (115)
T TIGR00100        70 ECECEDCSEEVSPEID------------LYRCPKCHG   94 (115)
T ss_pred             EEEcccCCCEEecCCc------------CccCcCCcC
Confidence            3678888877654321            367888874


No 153
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=49.22  E-value=9.3  Score=20.99  Aligned_cols=18  Identities=33%  Similarity=0.739  Sum_probs=13.7

Q ss_pred             HhcCCCCccCCCchhcccc
Q psy6628          97 VHTGEKPYACEFCPLTFRH  115 (132)
Q Consensus        97 ~h~~~~~~~C~~C~~~f~~  115 (132)
                      .+.+ +|..|+.||..|..
T Consensus        74 l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          74 LEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EeCC-CceeCCCCCcEEEE
Confidence            3454 79999999988863


No 154
>KOG2907|consensus
Probab=49.07  E-value=6.7  Score=22.08  Aligned_cols=40  Identities=20%  Similarity=0.415  Sum_probs=20.4

Q ss_pred             ccCCcccccccChhhHHHHHHHhcCCCCccCCCchhcccc
Q psy6628          76 YQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRH  115 (132)
Q Consensus        76 ~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~  115 (132)
                      ..|+.||..=-....+.-.-.....-..|.|+.|+..|+.
T Consensus        75 ~kCpkCghe~m~Y~T~QlRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQLRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhhcccccCCceEEEEcCccceeeec
Confidence            4688887552221111111001112356999999988864


No 155
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=49.06  E-value=11  Score=15.95  Aligned_cols=13  Identities=38%  Similarity=1.012  Sum_probs=9.9

Q ss_pred             ceeeeCCCCcccc
Q psy6628           9 RVVFTCQVCSKIF   21 (132)
Q Consensus         9 ~~~~~C~~C~~~f   21 (132)
                      -+.|+|..||...
T Consensus         5 ~~~ykC~~Cgniv   17 (34)
T TIGR00319         5 GQVYKCEVCGNIV   17 (34)
T ss_pred             CcEEEcCCCCcEE
Confidence            3478899998765


No 156
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=48.86  E-value=14  Score=24.99  Aligned_cols=26  Identities=31%  Similarity=0.621  Sum_probs=18.1

Q ss_pred             CCCccCCCchhccccchHHHHHHHhh
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRRSL  126 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~~~  126 (132)
                      .-.|.|+.|...|-...+.-.|...|
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHh
Confidence            34588888888887777776665443


No 157
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=48.25  E-value=61  Score=19.68  Aligned_cols=53  Identities=23%  Similarity=0.277  Sum_probs=32.8

Q ss_pred             CCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccc-cchHHHHHHHhhh
Q psy6628          74 KPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFR-HSSHLFRHRRSLH  127 (132)
Q Consensus        74 ~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~-~~~~l~~H~~~~~  127 (132)
                      ....|++|......+.... ..+.+...|+-.|..=+=.|. +...|++|.+..|
T Consensus        79 ~~L~CPLCRG~V~GWtvve-~AR~~LN~K~RsC~~e~C~F~GtY~eLrKHar~~H  132 (162)
T PF07800_consen   79 PELACPLCRGEVKGWTVVE-PARRFLNAKKRSCSQESCSFSGTYSELRKHARSEH  132 (162)
T ss_pred             ccccCccccCceeceEEch-HHHHHhccCCccCcccccccccCHHHHHHHHHhhC
Confidence            3467888876665554432 345555567777765333343 5678899987644


No 158
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=48.20  E-value=12  Score=15.94  Aligned_cols=12  Identities=33%  Similarity=1.104  Sum_probs=8.7

Q ss_pred             eeeeCCCCcccc
Q psy6628          10 VVFTCQVCSKIF   21 (132)
Q Consensus        10 ~~~~C~~C~~~f   21 (132)
                      +.|+|..||...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            467888888764


No 159
>KOG4727|consensus
Probab=47.30  E-value=13  Score=22.76  Aligned_cols=22  Identities=18%  Similarity=0.489  Sum_probs=19.3

Q ss_pred             eeeCCCCccccCChhHHHHHHH
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVR   32 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~   32 (132)
                      .|.|.+|+-++...-++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            4899999999999988888874


No 160
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=47.23  E-value=14  Score=16.35  Aligned_cols=22  Identities=32%  Similarity=0.643  Sum_probs=9.1

Q ss_pred             CccCCCchhccc-cc-hHHHHHHH
Q psy6628         103 PYACEFCPLTFR-HS-SHLFRHRR  124 (132)
Q Consensus       103 ~~~C~~C~~~f~-~~-~~l~~H~~  124 (132)
                      .|.|.+|...|+ +. +..+.|..
T Consensus         3 ryyCdyC~~~~~~d~~~~Rk~H~~   26 (38)
T PF06220_consen    3 RYYCDYCKKYLTHDSPSIRKQHER   26 (38)
T ss_dssp             S-B-TTT--B-S--SHHHHHHHT-
T ss_pred             CeecccccceecCCChHHHHHhhc
Confidence            477888888884 33 34466654


No 161
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=46.53  E-value=10  Score=21.41  Aligned_cols=25  Identities=20%  Similarity=0.347  Sum_probs=15.6

Q ss_pred             CccCCcccccccChhhHHHHHHHhcCCCCccCCCchh
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPL  111 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  111 (132)
                      .+.|..|+..|....            ..+.||.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC------------cCccCcCCCC
Confidence            357888886664421            3356888874


No 162
>KOG1280|consensus
Probab=46.44  E-value=26  Score=24.13  Aligned_cols=38  Identities=24%  Similarity=0.421  Sum_probs=25.8

Q ss_pred             cceeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccC
Q psy6628           8 HRVVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCE   47 (132)
Q Consensus         8 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~   47 (132)
                      -+.-|+|++|++.-.....+..|....+....  +...|+
T Consensus        76 ~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~--~~~icp  113 (381)
T KOG1280|consen   76 DPQSFTCPYCGIMGFTERQFGTHVLSQHPEAS--TSVICP  113 (381)
T ss_pred             ccccccCCcccccccchhHHHHHhhhcCcccC--cceeee
Confidence            34469999999886677888888876554322  225566


No 163
>PTZ00448 hypothetical protein; Provisional
Probab=45.78  E-value=16  Score=25.22  Aligned_cols=23  Identities=26%  Similarity=0.580  Sum_probs=19.8

Q ss_pred             eeeCCCCccccCChhHHHHHHHh
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRN   33 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~   33 (132)
                      .|+|..|+..|.+....+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            68899999999888888888765


No 164
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=45.68  E-value=10  Score=26.07  Aligned_cols=24  Identities=21%  Similarity=0.251  Sum_probs=20.8

Q ss_pred             CCccCCCchhccccchHHHHHHHh
Q psy6628         102 KPYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       102 ~~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      .-+.|++|++.|...+.+..|+..
T Consensus       237 ~~~YC~~C~r~f~~~~VFe~Hl~g  260 (470)
T COG5188         237 PKVYCVKCGREFSRSKVFEYHLEG  260 (470)
T ss_pred             cceeeHhhhhHhhhhHHHHHHHhh
Confidence            458899999999999999999864


No 165
>COG1773 Rubredoxin [Energy production and conversion]
Probab=45.12  E-value=11  Score=18.37  Aligned_cols=13  Identities=23%  Similarity=0.818  Sum_probs=9.9

Q ss_pred             eeeCCCCccccCC
Q psy6628          11 VFTCQVCSKIFSY   23 (132)
Q Consensus        11 ~~~C~~C~~~f~~   23 (132)
                      .|.|..||.+|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            4788888888754


No 166
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=45.11  E-value=9.7  Score=18.09  Aligned_cols=12  Identities=25%  Similarity=1.038  Sum_probs=8.0

Q ss_pred             eeCCCCccccCC
Q psy6628          12 FTCQVCSKIFSY   23 (132)
Q Consensus        12 ~~C~~C~~~f~~   23 (132)
                      |.|..||.++..
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            567777776654


No 167
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.86  E-value=12  Score=21.00  Aligned_cols=14  Identities=21%  Similarity=0.266  Sum_probs=8.5

Q ss_pred             CCccCCcccccccC
Q psy6628          74 KPYQCSQCSKSFFS   87 (132)
Q Consensus        74 ~~~~c~~C~~~~~~   87 (132)
                      .|..|+.||++|+.
T Consensus        25 dPiVsPytG~s~P~   38 (129)
T COG4530          25 DPIVSPYTGKSYPR   38 (129)
T ss_pred             CccccCcccccchH
Confidence            35666667766643


No 168
>KOG2071|consensus
Probab=44.38  E-value=18  Score=26.65  Aligned_cols=27  Identities=26%  Similarity=0.503  Sum_probs=20.6

Q ss_pred             CCCccCCCchhccccchHHHHHHHhhh
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRRSLH  127 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~~~~  127 (132)
                      ..|.+|..||..|........|+..|-
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            467888888888888877777776653


No 169
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=44.04  E-value=11  Score=17.62  Aligned_cols=12  Identities=25%  Similarity=0.977  Sum_probs=7.3

Q ss_pred             eeCCCCccccCC
Q psy6628          12 FTCQVCSKIFSY   23 (132)
Q Consensus        12 ~~C~~C~~~f~~   23 (132)
                      |.|..|+.++..
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            566667666543


No 170
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=43.33  E-value=13  Score=17.59  Aligned_cols=10  Identities=30%  Similarity=0.740  Sum_probs=5.2

Q ss_pred             CccCCCchhc
Q psy6628         103 PYACEFCPLT  112 (132)
Q Consensus       103 ~~~C~~C~~~  112 (132)
                      .+.|..|+..
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            4555555543


No 171
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=43.28  E-value=4.5  Score=22.87  Aligned_cols=13  Identities=31%  Similarity=0.833  Sum_probs=9.5

Q ss_pred             CCccCCCchhccc
Q psy6628         102 KPYACEFCPLTFR  114 (132)
Q Consensus       102 ~~~~C~~C~~~f~  114 (132)
                      ..|.|..||..|.
T Consensus        99 ~Fy~C~~Cg~~wr  111 (113)
T COG1594          99 RFYKCTRCGYRWR  111 (113)
T ss_pred             EEEEecccCCEee
Confidence            4588888887765


No 172
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=42.86  E-value=11  Score=18.28  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=7.9

Q ss_pred             eeeCCCCcccc
Q psy6628          11 VFTCQVCSKIF   21 (132)
Q Consensus        11 ~~~C~~C~~~f   21 (132)
                      .++|+.||..+
T Consensus         2 ~~~CP~CG~~i   12 (54)
T TIGR01206         2 QFECPDCGAEI   12 (54)
T ss_pred             ccCCCCCCCEE
Confidence            36788888755


No 173
>KOG4167|consensus
Probab=42.80  E-value=6.9  Score=29.52  Aligned_cols=26  Identities=15%  Similarity=0.275  Sum_probs=22.3

Q ss_pred             CCccCCCchhccccchHHHHHHHhhh
Q psy6628         102 KPYACEFCPLTFRHSSHLFRHRRSLH  127 (132)
Q Consensus       102 ~~~~C~~C~~~f~~~~~l~~H~~~~~  127 (132)
                      ..|.|.+|++.|--.-++..|++.|-
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            46999999999988888889998874


No 174
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.75  E-value=13  Score=18.48  Aligned_cols=44  Identities=14%  Similarity=0.193  Sum_probs=23.8

Q ss_pred             hccCCCCCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhcccc
Q psy6628          68 RDHQKEKPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFRH  115 (132)
Q Consensus        68 ~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~  115 (132)
                      .++.+..++.|+--+-.+....-+..   . ..+.-..|++|+..|..
T Consensus        17 ~I~~~~~~l~C~g~~~p~~HPrV~L~---m-g~~gev~CPYC~t~y~l   60 (62)
T COG4391          17 TIEIGDLPLMCPGPEPPNDHPRVFLD---M-GDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             EEEeCCeeEEcCCCCCCCCCCEEEEE---c-CCCCcEecCccccEEEe
Confidence            55666677777654433322211111   1 23455788899888764


No 175
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=41.87  E-value=11  Score=21.12  Aligned_cols=12  Identities=17%  Similarity=0.512  Sum_probs=8.0

Q ss_pred             ccCCcccccccC
Q psy6628          76 YQCSQCSKSFFS   87 (132)
Q Consensus        76 ~~c~~C~~~~~~   87 (132)
                      |.|+.|+..+..
T Consensus        20 ~iCpeC~~EW~~   31 (109)
T TIGR00686        20 LICPSCLYEWNE   31 (109)
T ss_pred             eECccccccccc
Confidence            677777766543


No 176
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=41.21  E-value=29  Score=24.98  Aligned_cols=25  Identities=32%  Similarity=0.644  Sum_probs=22.0

Q ss_pred             eeeCCCCccccCChhHHHHHHHhhc
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVRNKH   35 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~~~~   35 (132)
                      -..|+.|.+.|.+...+..|+...+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhh
Confidence            4789999999999999999998554


No 177
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=40.65  E-value=4  Score=18.23  Aligned_cols=9  Identities=44%  Similarity=1.327  Sum_probs=3.7

Q ss_pred             CCccCCCch
Q psy6628         102 KPYACEFCP  110 (132)
Q Consensus       102 ~~~~C~~C~  110 (132)
                      +.|.|..|+
T Consensus        23 ~~w~C~~C~   31 (40)
T PF04810_consen   23 KTWICNFCG   31 (40)
T ss_dssp             TEEEETTT-
T ss_pred             CEEECcCCC
Confidence            344444444


No 178
>KOG2636|consensus
Probab=40.59  E-value=23  Score=25.27  Aligned_cols=29  Identities=24%  Similarity=0.568  Sum_probs=21.7

Q ss_pred             HHhcCCCCccCCCch-hccccchHHHHHHH
Q psy6628          96 RVHTGEKPYACEFCP-LTFRHSSHLFRHRR  124 (132)
Q Consensus        96 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  124 (132)
                      +.|.-...|.|.+|| +++.-+-.+.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            446666778999998 77777778888863


No 179
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=40.50  E-value=19  Score=17.10  Aligned_cols=21  Identities=33%  Similarity=0.515  Sum_probs=14.4

Q ss_pred             CCCccCCCchhccccchHHHHHHH
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRR  124 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~  124 (132)
                      .+|-.|..|...|.   +|..|+.
T Consensus         3 ~k~GYCE~Cr~kfd---~l~~Hi~   23 (49)
T smart00586        3 KKPGYCENCREKYD---DLETHLL   23 (49)
T ss_pred             CCCcccccHhHHHh---hHHHHhc
Confidence            46778888888775   5556654


No 180
>KOG0717|consensus
Probab=40.18  E-value=21  Score=25.61  Aligned_cols=22  Identities=41%  Similarity=0.729  Sum_probs=19.1

Q ss_pred             eeCCCCccccCChhHHHHHHHh
Q psy6628          12 FTCQVCSKIFSYENGLKAHVRN   33 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~~~   33 (132)
                      +.|.+|.+.|.+...+..|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7799999999999999887653


No 181
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=39.46  E-value=19  Score=15.38  Aligned_cols=13  Identities=23%  Similarity=0.498  Sum_probs=8.9

Q ss_pred             eeeeCCCCccccC
Q psy6628          10 VVFTCQVCSKIFS   22 (132)
Q Consensus        10 ~~~~C~~C~~~f~   22 (132)
                      ..+.|..|+.+|.
T Consensus        20 ~~~~C~~Cg~~~~   32 (33)
T PF08792_consen   20 DYEVCIFCGSSFP   32 (33)
T ss_pred             CeEEcccCCcEee
Confidence            3467888887764


No 182
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=39.04  E-value=14  Score=21.05  Aligned_cols=13  Identities=31%  Similarity=0.797  Sum_probs=8.6

Q ss_pred             CccCCcccccccC
Q psy6628          75 PYQCSQCSKSFFS   87 (132)
Q Consensus        75 ~~~c~~C~~~~~~   87 (132)
                      .+.|..|+..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            3578888866644


No 183
>KOG2071|consensus
Probab=38.45  E-value=23  Score=26.09  Aligned_cols=28  Identities=14%  Similarity=0.261  Sum_probs=23.0

Q ss_pred             cceeeeCCCCccccCChhHHHHHHHhhc
Q psy6628           8 HRVVFTCQVCSKIFSYENGLKAHVRNKH   35 (132)
Q Consensus         8 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~   35 (132)
                      .+.+..|..||..|.+......||..|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            4556889999999999988888887775


No 184
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=38.04  E-value=12  Score=16.20  Aligned_cols=7  Identities=29%  Similarity=0.857  Sum_probs=2.4

Q ss_pred             CCCCccc
Q psy6628          14 CQVCSKI   20 (132)
Q Consensus        14 C~~C~~~   20 (132)
                      |+.||..
T Consensus         3 C~~CG~~    9 (34)
T PF14803_consen    3 CPQCGGP    9 (34)
T ss_dssp             -TTT--B
T ss_pred             cccccCh
Confidence            5666654


No 185
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=37.92  E-value=19  Score=17.97  Aligned_cols=12  Identities=25%  Similarity=0.725  Sum_probs=5.3

Q ss_pred             ccCCcccccccC
Q psy6628          76 YQCSQCSKSFFS   87 (132)
Q Consensus        76 ~~c~~C~~~~~~   87 (132)
                      +.|..||..|..
T Consensus        26 hhCr~CG~~vC~   37 (69)
T PF01363_consen   26 HHCRNCGRVVCS   37 (69)
T ss_dssp             EE-TTT--EEEC
T ss_pred             EccCCCCCEECC
Confidence            456667766654


No 186
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=37.19  E-value=53  Score=16.31  Aligned_cols=12  Identities=25%  Similarity=0.396  Sum_probs=7.9

Q ss_pred             eeCCCCccccCC
Q psy6628          12 FTCQVCSKIFSY   23 (132)
Q Consensus        12 ~~C~~C~~~f~~   23 (132)
                      -.|+.||.....
T Consensus        29 q~C~~CG~~~~~   40 (69)
T PF07282_consen   29 QTCPRCGHRNKK   40 (69)
T ss_pred             cCccCccccccc
Confidence            457888876544


No 187
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=37.06  E-value=12  Score=21.12  Aligned_cols=25  Identities=20%  Similarity=0.578  Sum_probs=13.8

Q ss_pred             ccCCcccccccChhhHHHHHHHhcCCCCccCCCchhc
Q psy6628          76 YQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLT  112 (132)
Q Consensus        76 ~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~  112 (132)
                      +.|..|+..|.-....            +.||.|+..
T Consensus        71 ~~C~~Cg~~~~~~~~~------------~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEFD------------FSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECHHCC------------HH-SSSSSS
T ss_pred             EECCCCCCEEecCCCC------------CCCcCCcCC
Confidence            5678888777553221            447777753


No 188
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=36.56  E-value=10  Score=17.39  Aligned_cols=8  Identities=38%  Similarity=1.294  Sum_probs=3.7

Q ss_pred             CccCCccc
Q psy6628          75 PYQCSQCS   82 (132)
Q Consensus        75 ~~~c~~C~   82 (132)
                      .|.|..|+
T Consensus        37 ~~~C~~C~   44 (46)
T PF12760_consen   37 RYRCKACR   44 (46)
T ss_pred             eEECCCCC
Confidence            34454443


No 189
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=36.51  E-value=19  Score=20.93  Aligned_cols=14  Identities=36%  Similarity=0.842  Sum_probs=8.5

Q ss_pred             CCCccCCCchhccc
Q psy6628         101 EKPYACEFCPLTFR  114 (132)
Q Consensus       101 ~~~~~C~~C~~~f~  114 (132)
                      ..-|.|+.|++.|.
T Consensus        51 ~qRyrC~~C~~tf~   64 (129)
T COG3677          51 HQRYKCKSCGSTFT   64 (129)
T ss_pred             ccccccCCcCccee
Confidence            34566666666665


No 190
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=35.85  E-value=31  Score=16.32  Aligned_cols=21  Identities=33%  Similarity=0.653  Sum_probs=13.4

Q ss_pred             CCCccCCCchhccccchHHHHHHH
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRR  124 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~  124 (132)
                      .++-.|..|...|.   +|..|+.
T Consensus         3 ~k~GYCE~C~~ky~---~l~~Hi~   23 (49)
T PF07535_consen    3 KKPGYCENCRVKYD---DLEEHIQ   23 (49)
T ss_pred             CCCccCccccchhh---hHHHHhC
Confidence            35567777777765   4566654


No 191
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=35.28  E-value=20  Score=17.57  Aligned_cols=11  Identities=27%  Similarity=0.830  Sum_probs=5.0

Q ss_pred             eeCCCCccccC
Q psy6628          12 FTCQVCSKIFS   22 (132)
Q Consensus        12 ~~C~~C~~~f~   22 (132)
                      ..|++|++.+.
T Consensus         3 v~CP~C~k~~~   13 (57)
T PF03884_consen    3 VKCPICGKPVE   13 (57)
T ss_dssp             EE-TTT--EEE
T ss_pred             ccCCCCCCeec
Confidence            46777777653


No 192
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=35.19  E-value=7  Score=17.14  Aligned_cols=8  Identities=38%  Similarity=1.410  Sum_probs=3.7

Q ss_pred             CCccCCcc
Q psy6628          74 KPYQCSQC   81 (132)
Q Consensus        74 ~~~~c~~C   81 (132)
                      ..|.|..|
T Consensus        28 qryrC~~C   35 (36)
T PF03811_consen   28 QRYRCKDC   35 (36)
T ss_pred             EeEecCcC
Confidence            33555444


No 193
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=35.17  E-value=28  Score=20.82  Aligned_cols=48  Identities=17%  Similarity=0.252  Sum_probs=27.5

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChhhHHHHHH
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKYDHKIHSR   96 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~   96 (132)
                      +.|..-..-.-+|.+...+.... .    .+-..|++||..-..+..+.-++.
T Consensus         6 L~C~~gH~FEgWF~ss~~fd~Q~-~----~glv~CP~Cgs~~V~K~lmAP~v~   53 (148)
T PF06676_consen    6 LRCENGHEFEGWFRSSAAFDRQQ-A----RGLVSCPVCGSTEVSKALMAPAVA   53 (148)
T ss_pred             EecCCCCccceecCCHHHHHHHH-H----cCCccCCCCCCCeEeeecCCCeec
Confidence            45642223445567777666554 2    234689999877666555444443


No 194
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=35.11  E-value=13  Score=21.03  Aligned_cols=12  Identities=17%  Similarity=0.479  Sum_probs=7.8

Q ss_pred             CccCCccccccc
Q psy6628          75 PYQCSQCSKSFF   86 (132)
Q Consensus        75 ~~~c~~C~~~~~   86 (132)
                      .+.|..|+..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (114)
T PRK03681         70 ECWCETCQQYVT   81 (114)
T ss_pred             EEEcccCCCeee
Confidence            357888876553


No 195
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=35.02  E-value=23  Score=19.62  Aligned_cols=16  Identities=25%  Similarity=0.374  Sum_probs=11.6

Q ss_pred             cceeeeCCCCccccCC
Q psy6628           8 HRVVFTCQVCSKIFSY   23 (132)
Q Consensus         8 ~~~~~~C~~C~~~f~~   23 (132)
                      -++.|.|+.|+..-..
T Consensus        19 L~k~FtCp~Cghe~vs   34 (104)
T COG4888          19 LPKTFTCPRCGHEKVS   34 (104)
T ss_pred             CCceEecCccCCeeee
Confidence            4567999999975433


No 196
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=34.98  E-value=14  Score=21.94  Aligned_cols=28  Identities=21%  Similarity=0.454  Sum_probs=17.9

Q ss_pred             CCccCCcccccccChhhHHHHHHHhcCCCCccCCCchh
Q psy6628          74 KPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPL  111 (132)
Q Consensus        74 ~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  111 (132)
                      ..+.|..||......         + .+..-.|+.|+.
T Consensus       111 G~l~C~~Cg~~~~~~---------~-~~~l~~Cp~C~~  138 (146)
T PF07295_consen  111 GTLVCENCGHEVELT---------H-PERLPPCPKCGH  138 (146)
T ss_pred             ceEecccCCCEEEec---------C-CCcCCCCCCCCC
Confidence            457888888765332         2 235567888875


No 197
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=34.96  E-value=30  Score=21.38  Aligned_cols=7  Identities=29%  Similarity=1.108  Sum_probs=3.5

Q ss_pred             ccCCCch
Q psy6628         104 YACEFCP  110 (132)
Q Consensus       104 ~~C~~C~  110 (132)
                      |.|+.||
T Consensus       133 F~Cp~Cg  139 (176)
T COG1675         133 FTCPKCG  139 (176)
T ss_pred             CCCCCCC
Confidence            4555554


No 198
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=34.66  E-value=28  Score=23.21  Aligned_cols=24  Identities=25%  Similarity=0.660  Sum_probs=14.4

Q ss_pred             ccCCcccccccChhhHHHHHHHhcCCCCccCCCchhcc
Q psy6628          76 YQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTF  113 (132)
Q Consensus        76 ~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f  113 (132)
                      |.|+.|...|..              -|-.|+.|+..|
T Consensus       256 yvCs~Clsi~C~--------------~p~~C~~Cgt~f  279 (279)
T TIGR00627       256 FVCSVCLSVLCQ--------------YTPICKTCKTAF  279 (279)
T ss_pred             EECCCccCCcCC--------------CCCCCCCCCCCC
Confidence            667777665543              233777777554


No 199
>PRK14873 primosome assembly protein PriA; Provisional
Probab=34.38  E-value=22  Score=26.86  Aligned_cols=11  Identities=18%  Similarity=0.540  Sum_probs=7.2

Q ss_pred             CCccCCCchhc
Q psy6628         102 KPYACEFCPLT  112 (132)
Q Consensus       102 ~~~~C~~C~~~  112 (132)
                      .|+.|+.|+..
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            35677777753


No 200
>KOG2857|consensus
Probab=33.88  E-value=21  Score=21.12  Aligned_cols=22  Identities=18%  Similarity=0.498  Sum_probs=16.5

Q ss_pred             CccCCCchhccccchHHHHHHH
Q psy6628         103 PYACEFCPLTFRHSSHLFRHRR  124 (132)
Q Consensus       103 ~~~C~~C~~~f~~~~~l~~H~~  124 (132)
                      -|+|+.|...|-+...++.|+.
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hccCCCCCCccccchhhhhccC
Confidence            3788888877777777777765


No 201
>PHA02998 RNA polymerase subunit; Provisional
Probab=33.35  E-value=6.2  Score=24.21  Aligned_cols=14  Identities=29%  Similarity=0.527  Sum_probs=10.3

Q ss_pred             CCccCCCchhcccc
Q psy6628         102 KPYACEFCPLTFRH  115 (132)
Q Consensus       102 ~~~~C~~C~~~f~~  115 (132)
                      ..|.|..|+..|.-
T Consensus       170 ~FYkC~~CG~~wkp  183 (195)
T PHA02998        170 VRHACRDCKKHFKP  183 (195)
T ss_pred             EEEEcCCCCCccCC
Confidence            34888889887753


No 202
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=33.34  E-value=18  Score=20.10  Aligned_cols=7  Identities=43%  Similarity=1.250  Sum_probs=3.3

Q ss_pred             ccCCCch
Q psy6628         104 YACEFCP  110 (132)
Q Consensus       104 ~~C~~C~  110 (132)
                      |.|.-|+
T Consensus        32 y~C~~C~   38 (102)
T PF11672_consen   32 YVCTPCD   38 (102)
T ss_pred             EECCCCC
Confidence            4454443


No 203
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=33.20  E-value=18  Score=15.66  Aligned_cols=12  Identities=33%  Similarity=0.714  Sum_probs=5.3

Q ss_pred             cCCCchhccccc
Q psy6628         105 ACEFCPLTFRHS  116 (132)
Q Consensus       105 ~C~~C~~~f~~~  116 (132)
                      .|..|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            567777777654


No 204
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=33.12  E-value=19  Score=23.13  Aligned_cols=17  Identities=24%  Similarity=0.696  Sum_probs=11.0

Q ss_pred             ccceeeeCCCCccccCC
Q psy6628           7 IHRVVFTCQVCSKIFSY   23 (132)
Q Consensus         7 ~~~~~~~C~~C~~~f~~   23 (132)
                      ...++..|++||..|.-
T Consensus       177 rEGkpqRCpECGqVFKL  193 (268)
T PTZ00043        177 REGFLYRCGECDQIFML  193 (268)
T ss_pred             cCCCCccCCCCCcEEEE
Confidence            34456777788777643


No 205
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=33.07  E-value=23  Score=17.46  Aligned_cols=29  Identities=24%  Similarity=0.541  Sum_probs=17.4

Q ss_pred             cccCCCCCCcccccChHHHHhhhhhccCCCCCccCCccc
Q psy6628          44 FKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCS   82 (132)
Q Consensus        44 ~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~   82 (132)
                      |.|+    ||..|.....      -...|++...|+.|.
T Consensus        23 yPCP----CGDRFeIsLe------Dl~~GE~VArCPSCS   51 (67)
T COG5216          23 YPCP----CGDRFEISLE------DLRNGEVVARCPSCS   51 (67)
T ss_pred             ecCC----CCCEeEEEHH------HhhCCceEEEcCCce
Confidence            6776    8877765421      223456666777764


No 206
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=32.94  E-value=24  Score=15.87  Aligned_cols=9  Identities=22%  Similarity=0.767  Sum_probs=4.9

Q ss_pred             eeCCCCccc
Q psy6628          12 FTCQVCSKI   20 (132)
Q Consensus        12 ~~C~~C~~~   20 (132)
                      |.|+.|+..
T Consensus         1 m~Cp~Cg~~    9 (43)
T PF08271_consen    1 MKCPNCGSK    9 (43)
T ss_dssp             ESBTTTSSS
T ss_pred             CCCcCCcCC
Confidence            356666653


No 207
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=32.85  E-value=44  Score=13.86  Aligned_cols=16  Identities=13%  Similarity=0.445  Sum_probs=8.4

Q ss_pred             ceeeeCCCCccccCCh
Q psy6628           9 RVVFTCQVCSKIFSYE   24 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~   24 (132)
                      ...|.|+.|+..+-+.
T Consensus        11 ~~kY~Cp~C~~~~CSl   26 (30)
T PF04438_consen   11 PAKYRCPRCGARYCSL   26 (30)
T ss_dssp             EESEE-TTT--EESSH
T ss_pred             CCEEECCCcCCceeCc
Confidence            3458888888776543


No 208
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=32.82  E-value=30  Score=23.15  Aligned_cols=22  Identities=27%  Similarity=0.324  Sum_probs=12.7

Q ss_pred             CccCCcccccccChhhHHHHHH
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSR   96 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~   96 (132)
                      -|.|..|-+-|.....+.+|+.
T Consensus        48 lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         48 LYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             EEEcCCCcchhCCHHHHHHHHH
Confidence            3556666555556656655554


No 209
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=32.45  E-value=25  Score=17.05  Aligned_cols=18  Identities=17%  Similarity=0.490  Sum_probs=8.2

Q ss_pred             CCccCCCchhccccchHH
Q psy6628         102 KPYACEFCPLTFRHSSHL  119 (132)
Q Consensus       102 ~~~~C~~C~~~f~~~~~l  119 (132)
                      +-+.|-.||..|.+...|
T Consensus        26 ~~~YC~~Cg~~Y~d~~dL   43 (55)
T PF13821_consen   26 EHNYCFWCGTKYDDEEDL   43 (55)
T ss_pred             hCceeeeeCCccCCHHHH
Confidence            334444455444444433


No 210
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=31.25  E-value=16  Score=22.93  Aligned_cols=9  Identities=44%  Similarity=1.154  Sum_probs=0.0

Q ss_pred             CCccCCCch
Q psy6628         102 KPYACEFCP  110 (132)
Q Consensus       102 ~~~~C~~C~  110 (132)
                      +-|.|.+||
T Consensus       100 ~ey~CEICG  108 (196)
T PF11931_consen  100 VEYKCEICG  108 (196)
T ss_dssp             ---------
T ss_pred             CeeeeEeCC
Confidence            344555554


No 211
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=31.25  E-value=22  Score=15.88  Aligned_cols=11  Identities=18%  Similarity=0.764  Sum_probs=8.4

Q ss_pred             eeCCCCccccC
Q psy6628          12 FTCQVCSKIFS   22 (132)
Q Consensus        12 ~~C~~C~~~f~   22 (132)
                      +.|+.||..+-
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            57999998753


No 212
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=30.68  E-value=38  Score=16.19  Aligned_cols=12  Identities=25%  Similarity=0.736  Sum_probs=8.2

Q ss_pred             ceeeeCCCCccc
Q psy6628           9 RVVFTCQVCSKI   20 (132)
Q Consensus         9 ~~~~~C~~C~~~   20 (132)
                      +....|+.||..
T Consensus        44 ~~i~~Cp~CgRi   55 (56)
T PF02591_consen   44 DEIVFCPNCGRI   55 (56)
T ss_pred             CCeEECcCCCcc
Confidence            456778888764


No 213
>COG2879 Uncharacterized small protein [Function unknown]
Probab=30.67  E-value=43  Score=16.81  Aligned_cols=16  Identities=19%  Similarity=0.158  Sum_probs=9.1

Q ss_pred             chHHHHHHHhhhhhcc
Q psy6628         116 SSHLFRHRRSLHQMYE  131 (132)
Q Consensus       116 ~~~l~~H~~~~~~~~~  131 (132)
                      .++...|++.+|+.+|
T Consensus        25 YdnYVehmr~~hPd~p   40 (65)
T COG2879          25 YDNYVEHMRKKHPDKP   40 (65)
T ss_pred             HHHHHHHHHHhCcCCC
Confidence            3455566666666554


No 214
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=30.65  E-value=69  Score=21.55  Aligned_cols=25  Identities=20%  Similarity=0.498  Sum_probs=22.6

Q ss_pred             cceeeeCCCCccccCChhHHHHHHH
Q psy6628           8 HRVVFTCQVCSKIFSYENGLKAHVR   32 (132)
Q Consensus         8 ~~~~~~C~~C~~~f~~~~~l~~h~~   32 (132)
                      .+..|.|..|-+-|.....|.+|+.
T Consensus        45 ~~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         45 CTKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CCeEEEcCCCcchhCCHHHHHHHHH
Confidence            3567999999999999999999987


No 215
>PRK01343 zinc-binding protein; Provisional
Probab=30.64  E-value=31  Score=16.94  Aligned_cols=12  Identities=25%  Similarity=0.487  Sum_probs=9.5

Q ss_pred             eeeCCCCccccC
Q psy6628          11 VFTCQVCSKIFS   22 (132)
Q Consensus        11 ~~~C~~C~~~f~   22 (132)
                      .-.|++|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            467999999864


No 216
>PF14369 zf-RING_3:  zinc-finger
Probab=30.36  E-value=24  Score=15.28  Aligned_cols=10  Identities=30%  Similarity=0.720  Sum_probs=8.0

Q ss_pred             eCCCCccccC
Q psy6628          13 TCQVCSKIFS   22 (132)
Q Consensus        13 ~C~~C~~~f~   22 (132)
                      .|+.|+..|-
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998774


No 217
>PLN02748 tRNA dimethylallyltransferase
Probab=29.60  E-value=40  Score=24.38  Aligned_cols=24  Identities=17%  Similarity=0.439  Sum_probs=18.0

Q ss_pred             CCccCCcccc-cccChhhHHHHHHH
Q psy6628          74 KPYQCSQCSK-SFFSKYDHKIHSRV   97 (132)
Q Consensus        74 ~~~~c~~C~~-~~~~~~~l~~h~~~   97 (132)
                      +.|.|.+|+. .+.....|..|.+.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            4467888886 78888888888764


No 218
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=29.40  E-value=9.6  Score=19.49  Aligned_cols=9  Identities=44%  Similarity=1.135  Sum_probs=4.8

Q ss_pred             CccCCCchh
Q psy6628         103 PYACEFCPL  111 (132)
Q Consensus       103 ~~~C~~C~~  111 (132)
                      .+.|+.|+.
T Consensus        61 ~~~C~~C~~   69 (71)
T PF05495_consen   61 DYFCPICGL   69 (71)
T ss_dssp             SEEETTTTE
T ss_pred             CccCcCcCC
Confidence            455555553


No 219
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=29.26  E-value=45  Score=15.70  Aligned_cols=12  Identities=33%  Similarity=0.894  Sum_probs=7.8

Q ss_pred             ccCCcccccccC
Q psy6628          76 YQCSQCSKSFFS   87 (132)
Q Consensus        76 ~~c~~C~~~~~~   87 (132)
                      ..|..||..|..
T Consensus        19 ~~Cr~Cg~~~C~   30 (57)
T cd00065          19 HHCRNCGRIFCS   30 (57)
T ss_pred             cccCcCcCCcCh
Confidence            457777777654


No 220
>PRK10220 hypothetical protein; Provisional
Probab=29.20  E-value=40  Score=19.00  Aligned_cols=11  Identities=27%  Similarity=1.014  Sum_probs=6.9

Q ss_pred             eCCCCccccCC
Q psy6628          13 TCQVCSKIFSY   23 (132)
Q Consensus        13 ~C~~C~~~f~~   23 (132)
                      .||.|+..|.+
T Consensus         5 ~CP~C~seytY   15 (111)
T PRK10220          5 HCPKCNSEYTY   15 (111)
T ss_pred             cCCCCCCcceE
Confidence            47777766544


No 221
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=29.14  E-value=28  Score=19.46  Aligned_cols=24  Identities=21%  Similarity=0.397  Sum_probs=17.3

Q ss_pred             CCccCCCchhccccchHHHHHHHh
Q psy6628         102 KPYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       102 ~~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      ..+.|-.|.+-|.+...|..|.+.
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhcc
Confidence            346777788888877777777653


No 222
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=29.09  E-value=19  Score=25.91  Aligned_cols=39  Identities=18%  Similarity=0.272  Sum_probs=20.7

Q ss_pred             CCCccCCcccccccChhh-HHHHHH----HhcCCCCccCCCchh
Q psy6628          73 EKPYQCSQCSKSFFSKYD-HKIHSR----VHTGEKPYACEFCPL  111 (132)
Q Consensus        73 ~~~~~c~~C~~~~~~~~~-l~~h~~----~h~~~~~~~C~~C~~  111 (132)
                      .+.|+|..|+..+.-... -..-+.    ...-...|.||+|+.
T Consensus       423 ~~~~~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~~~cp~c~~  466 (479)
T PRK05452        423 GPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSL  466 (479)
T ss_pred             CCeEEECCCCeEECCCCCCcccCCCCCCChhhCCCCCcCcCCCC
Confidence            345889999988754211 110010    001123589999984


No 223
>PRK00420 hypothetical protein; Validated
Probab=29.08  E-value=31  Score=19.58  Aligned_cols=12  Identities=17%  Similarity=0.410  Sum_probs=7.2

Q ss_pred             CccCCccccccc
Q psy6628          75 PYQCSQCSKSFF   86 (132)
Q Consensus        75 ~~~c~~C~~~~~   86 (132)
                      ...|+.||....
T Consensus        40 ~~~Cp~Cg~~~~   51 (112)
T PRK00420         40 EVVCPVHGKVYI   51 (112)
T ss_pred             ceECCCCCCeee
Confidence            356777776543


No 224
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=28.87  E-value=23  Score=18.70  Aligned_cols=9  Identities=44%  Similarity=1.202  Sum_probs=3.0

Q ss_pred             eeeeCCCCc
Q psy6628          10 VVFTCQVCS   18 (132)
Q Consensus        10 ~~~~C~~C~   18 (132)
                      +.|.|+.|+
T Consensus        21 ~~F~CPfC~   29 (81)
T PF05129_consen   21 KVFDCPFCN   29 (81)
T ss_dssp             S----TTT-
T ss_pred             ceEcCCcCC
Confidence            458888888


No 225
>KOG1994|consensus
Probab=28.86  E-value=20  Score=23.01  Aligned_cols=24  Identities=25%  Similarity=0.758  Sum_probs=19.8

Q ss_pred             CCCCccCCCchhccccchHHHHHH
Q psy6628         100 GEKPYACEFCPLTFRHSSHLFRHR  123 (132)
Q Consensus       100 ~~~~~~C~~C~~~f~~~~~l~~H~  123 (132)
                      ....|.|-.||..|.+...|..|=
T Consensus       236 R~eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  236 RSEHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             hccceEEEEeccccCCHHHHHHhC
Confidence            345799999999999998887773


No 226
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=28.45  E-value=23  Score=20.93  Aligned_cols=39  Identities=15%  Similarity=0.310  Sum_probs=22.5

Q ss_pred             ccCCcccccccChhhH--HHHH---HHhcCCCCccCCCchhccc
Q psy6628          76 YQCSQCSKSFFSKYDH--KIHS---RVHTGEKPYACEFCPLTFR  114 (132)
Q Consensus        76 ~~c~~C~~~~~~~~~l--~~h~---~~h~~~~~~~C~~C~~~f~  114 (132)
                      -.|..|+..+.....-  ..-.   .....+..|.|+.|++.|=
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW  135 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYW  135 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEec
Confidence            4789998765432211  0000   1122356899999999884


No 227
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=28.44  E-value=14  Score=28.19  Aligned_cols=8  Identities=38%  Similarity=0.899  Sum_probs=4.3

Q ss_pred             CCCCcccc
Q psy6628          14 CQVCSKIF   21 (132)
Q Consensus        14 C~~C~~~f   21 (132)
                      |..||.++
T Consensus       438 C~~Cg~v~  445 (730)
T COG1198         438 CRDCGYIA  445 (730)
T ss_pred             cccCCCcc
Confidence            55555544


No 228
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=27.85  E-value=27  Score=16.66  Aligned_cols=17  Identities=18%  Similarity=0.403  Sum_probs=11.7

Q ss_pred             CCccCCCchhccccchH
Q psy6628         102 KPYACEFCPLTFRHSSH  118 (132)
Q Consensus       102 ~~~~C~~C~~~f~~~~~  118 (132)
                      .-++|+.|+..|...-.
T Consensus        27 v~W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   27 VWWKCPKCGHEWKASVN   43 (55)
T ss_pred             EEEECCCCCCeeEccHh
Confidence            34888888877765433


No 229
>KOG0320|consensus
Probab=27.61  E-value=30  Score=21.41  Aligned_cols=15  Identities=20%  Similarity=0.521  Sum_probs=9.8

Q ss_pred             CCccCCCchhccccc
Q psy6628         102 KPYACEFCPLTFRHS  116 (132)
Q Consensus       102 ~~~~C~~C~~~f~~~  116 (132)
                      .-.+|+.|++....+
T Consensus       166 ~~~~CP~C~kkIt~k  180 (187)
T KOG0320|consen  166 NTNKCPTCRKKITHK  180 (187)
T ss_pred             hCCCCCCcccccchh
Confidence            446888888755443


No 230
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=27.35  E-value=44  Score=14.32  Aligned_cols=11  Identities=18%  Similarity=0.610  Sum_probs=5.2

Q ss_pred             eeeCCCCcccc
Q psy6628          11 VFTCQVCSKIF   21 (132)
Q Consensus        11 ~~~C~~C~~~f   21 (132)
                      .+.|+.|++..
T Consensus         4 ~~~C~nC~R~v   14 (33)
T PF08209_consen    4 YVECPNCGRPV   14 (33)
T ss_dssp             EEE-TTTSSEE
T ss_pred             eEECCCCcCCc
Confidence            35566666543


No 231
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=27.34  E-value=22  Score=20.46  Aligned_cols=31  Identities=19%  Similarity=0.365  Sum_probs=16.6

Q ss_pred             CccCCcccccccChhhHHHHHHHhcCCCCccCCCchh
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPL  111 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  111 (132)
                      .+.| .|+..|.....-..    +. .-.+.||.|+.
T Consensus        70 ~~~C-~Cg~~~~~~~~~~~----~~-~~~~~CP~Cgs  100 (124)
T PRK00762         70 EIEC-ECGYEGVVDEDEID----HY-AAVIECPVCGN  100 (124)
T ss_pred             eEEe-eCcCcccccccchh----cc-ccCCcCcCCCC
Confidence            3679 89877654321000    00 01257999984


No 232
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=27.28  E-value=30  Score=16.61  Aligned_cols=10  Identities=20%  Similarity=0.816  Sum_probs=6.6

Q ss_pred             cCCCchhccc
Q psy6628         105 ACEFCPLTFR  114 (132)
Q Consensus       105 ~C~~C~~~f~  114 (132)
                      .||+||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            5777876553


No 233
>KOG2272|consensus
Probab=27.03  E-value=67  Score=21.19  Aligned_cols=16  Identities=25%  Similarity=0.858  Sum_probs=11.2

Q ss_pred             CCCccCCcccccccCh
Q psy6628          73 EKPYQCSQCSKSFFSK   88 (132)
Q Consensus        73 ~~~~~c~~C~~~~~~~   88 (132)
                      .--|.|..|.+.|..-
T Consensus       219 veHFvCa~CekPFlGH  234 (332)
T KOG2272|consen  219 VEHFVCAKCEKPFLGH  234 (332)
T ss_pred             hhheeehhcCCcccch
Confidence            3457888888887653


No 234
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=26.99  E-value=70  Score=17.98  Aligned_cols=22  Identities=14%  Similarity=0.259  Sum_probs=15.7

Q ss_pred             eeeCCCCccccCChhHHHHHHH
Q psy6628          11 VFTCQVCSKIFSYENGLKAHVR   32 (132)
Q Consensus        11 ~~~C~~C~~~f~~~~~l~~h~~   32 (132)
                      .+.|+.||..+...........
T Consensus        31 ~~~C~~CGe~~~~~e~~~~~~~   52 (127)
T TIGR03830        31 GWYCPACGEELLDPEESKRNSA   52 (127)
T ss_pred             eeECCCCCCEEEcHHHHHHHHH
Confidence            4789999998877765554443


No 235
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=26.54  E-value=66  Score=19.68  Aligned_cols=10  Identities=10%  Similarity=0.674  Sum_probs=4.7

Q ss_pred             CCcccccChH
Q psy6628          51 ECDRVFTTRN   60 (132)
Q Consensus        51 ~c~~~~~~~~   60 (132)
                      .|++.|...+
T Consensus       135 ~CgkiYW~Gs  144 (165)
T COG1656         135 KCGKIYWKGS  144 (165)
T ss_pred             CCcccccCch
Confidence            4555544443


No 236
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=26.53  E-value=35  Score=16.31  Aligned_cols=16  Identities=19%  Similarity=0.677  Sum_probs=9.6

Q ss_pred             cceeeeCCCCccccCC
Q psy6628           8 HRVVFTCQVCSKIFSY   23 (132)
Q Consensus         8 ~~~~~~C~~C~~~f~~   23 (132)
                      ....|.|..|++.+..
T Consensus        32 ~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   32 EPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTCEEEETTT--EEEH
T ss_pred             CCCEEEeeCCCCEecc
Confidence            4456889999887643


No 237
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=26.29  E-value=24  Score=17.17  Aligned_cols=9  Identities=22%  Similarity=1.125  Sum_probs=2.5

Q ss_pred             eeCCCCccc
Q psy6628          12 FTCQVCSKI   20 (132)
Q Consensus        12 ~~C~~C~~~   20 (132)
                      |+|++||-+
T Consensus        34 y~Cp~CgAt   42 (55)
T PF05741_consen   34 YVCPICGAT   42 (55)
T ss_dssp             ---TTT---
T ss_pred             CcCCCCcCc
Confidence            778888764


No 238
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=26.19  E-value=29  Score=20.33  Aligned_cols=58  Identities=26%  Similarity=0.449  Sum_probs=31.5

Q ss_pred             eeeeCCCCccccCChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccChh
Q psy6628          10 VVFTCQVCSKIFSYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSKY   89 (132)
Q Consensus        10 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~~   89 (132)
                      ++|+|.+|..+.....-|.             | -.|=+-.+|+..   ...|..+- ..++     .|++|..+|.+..
T Consensus        79 ~lYeCnIC~etS~ee~FLK-------------P-neCCgY~iCn~C---ya~LWK~~-~~yp-----vCPvCkTSFKss~  135 (140)
T PF05290_consen   79 KLYECNICKETSAEERFLK-------------P-NECCGYSICNAC---YANLWKFC-NLYP-----VCPVCKTSFKSSS  135 (140)
T ss_pred             CceeccCcccccchhhcCC-------------c-ccccchHHHHHH---HHHHHHHc-ccCC-----CCCcccccccccc
Confidence            6799999999875543221             1 233111122222   23455554 3332     6888888887654


Q ss_pred             h
Q psy6628          90 D   90 (132)
Q Consensus        90 ~   90 (132)
                      .
T Consensus       136 ~  136 (140)
T PF05290_consen  136 S  136 (140)
T ss_pred             c
Confidence            3


No 239
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=26.03  E-value=48  Score=17.97  Aligned_cols=20  Identities=15%  Similarity=0.426  Sum_probs=14.9

Q ss_pred             eeCCCCccccCChhHHHHHH
Q psy6628          12 FTCQVCSKIFSYENGLKAHV   31 (132)
Q Consensus        12 ~~C~~C~~~f~~~~~l~~h~   31 (132)
                      ..|+.||..+-+..-+..--
T Consensus        36 ~~C~~CGe~y~~dev~~eIE   55 (89)
T TIGR03829        36 ISCSHCGMEYQDDTTVKEIE   55 (89)
T ss_pred             ccccCCCcEeecHHHHHHHH
Confidence            67999999987776554443


No 241
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=25.48  E-value=27  Score=20.58  Aligned_cols=32  Identities=25%  Similarity=0.629  Sum_probs=19.1

Q ss_pred             CccCCcccccccChhhHHHHHHHhcCCCCccCCCchhccc
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLTFR  114 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~  114 (132)
                      .|.|..|+..+....      ..  ..+-|.|+.|+..+.
T Consensus       123 ~~~C~~C~~~~~r~~------~~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRHR------RS--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeeec------cc--chhhEECCCCCCEEE
Confidence            367888886663322      22  123388888886654


No 242
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=24.86  E-value=50  Score=20.36  Aligned_cols=21  Identities=14%  Similarity=0.194  Sum_probs=15.9

Q ss_pred             CCCccCCCchhccccchHHHH
Q psy6628         101 EKPYACEFCPLTFRHSSHLFR  121 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~  121 (132)
                      .....|..||+.|.....+..
T Consensus       112 ~~~~~C~~Cg~~f~~~k~i~~  132 (181)
T PRK08222        112 FHLQRCSRCERPFAPQKTVAL  132 (181)
T ss_pred             cccCcCcccCCccCcHhHHHH
Confidence            357899999999986655543


No 243
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=24.78  E-value=28  Score=13.73  Aligned_cols=6  Identities=33%  Similarity=1.143  Sum_probs=3.5

Q ss_pred             CCCCcc
Q psy6628          14 CQVCSK   19 (132)
Q Consensus        14 C~~C~~   19 (132)
                      |+.||.
T Consensus        19 C~~CG~   24 (26)
T PF13248_consen   19 CPNCGA   24 (26)
T ss_pred             ChhhCC
Confidence            666654


No 244
>PF12773 DZR:  Double zinc ribbon
Probab=24.34  E-value=51  Score=15.13  Aligned_cols=8  Identities=25%  Similarity=0.933  Sum_probs=3.7

Q ss_pred             cCCccccc
Q psy6628          77 QCSQCSKS   84 (132)
Q Consensus        77 ~c~~C~~~   84 (132)
                      .|..|+..
T Consensus        31 ~C~~Cg~~   38 (50)
T PF12773_consen   31 ICPNCGAE   38 (50)
T ss_pred             CCcCCcCC
Confidence            45555443


No 245
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=24.26  E-value=22  Score=20.88  Aligned_cols=18  Identities=39%  Similarity=0.855  Sum_probs=13.6

Q ss_pred             HhcCCCCccCCCchhcccc
Q psy6628          97 VHTGEKPYACEFCPLTFRH  115 (132)
Q Consensus        97 ~h~~~~~~~C~~C~~~f~~  115 (132)
                      .+.+ +|..|+.||..|..
T Consensus       107 l~~g-~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  107 LHKG-KPQRCPECGQVFKL  124 (136)
T ss_dssp             EETT-SEEEETTTEEEEEE
T ss_pred             EeCC-CccCCCCCCeEEEE
Confidence            3444 68999999998864


No 246
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=24.01  E-value=36  Score=14.15  Aligned_cols=11  Identities=36%  Similarity=0.969  Sum_probs=8.0

Q ss_pred             eeCCCCccccC
Q psy6628          12 FTCQVCSKIFS   22 (132)
Q Consensus        12 ~~C~~C~~~f~   22 (132)
                      |.|..|++.+.
T Consensus        28 f~C~~C~~~L~   38 (39)
T smart00132       28 FKCSKCGKPLG   38 (39)
T ss_pred             CCCcccCCcCc
Confidence            77888887653


No 247
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=23.78  E-value=36  Score=16.46  Aligned_cols=8  Identities=25%  Similarity=0.841  Sum_probs=4.3

Q ss_pred             eeCCCCcc
Q psy6628          12 FTCQVCSK   19 (132)
Q Consensus        12 ~~C~~C~~   19 (132)
                      ..||.||.
T Consensus         4 kPCPFCG~   11 (61)
T PF14354_consen    4 KPCPFCGS   11 (61)
T ss_pred             cCCCCCCC
Confidence            44666654


No 248
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=23.75  E-value=26  Score=22.38  Aligned_cols=27  Identities=11%  Similarity=0.335  Sum_probs=0.0

Q ss_pred             ceeeeCCCCccccCChhHHHHHHHhhcC
Q psy6628           9 RVVFTCQVCSKIFSYENGLKAHVRNKHG   36 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~   36 (132)
                      .....||+||+..+. ..+..||++...
T Consensus       166 ~~~~~cPitGe~IP~-~e~~eHmRi~Ll  192 (229)
T PF12230_consen  166 EKMIICPITGEMIPA-DEMDEHMRIELL  192 (229)
T ss_dssp             ----------------------------
T ss_pred             ccccccccccccccc-cccccccccccc
Confidence            344678888886644 668888887653


No 249
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.63  E-value=64  Score=18.71  Aligned_cols=61  Identities=16%  Similarity=0.244  Sum_probs=27.8

Q ss_pred             CChhHHHHHHHhhcCCCCCCCccccCCCCCCcccccChHHHHhhhhhccCCCCCccCCcccccccCh
Q psy6628          22 SYENGLKAHVRNKHGSSEERPRFKCEGRGECDRVFTTRNMLNIHIKRDHQKEKPYQCSQCSKSFFSK   88 (132)
Q Consensus        22 ~~~~~l~~h~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~C~~~~~~~   88 (132)
                      .+..+|.+-...+.+..   .-..|+   .|+........+..-+..-+.=+.|-.|.-||..|++-
T Consensus        21 dq~pel~eafcskcgea---ti~qcp---~csasirgd~~vegvlglg~dye~psfchncgs~fpwt   81 (160)
T COG4306          21 DQSPELMEAFCSKCGEA---TITQCP---ICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPWT   81 (160)
T ss_pred             cCCHHHHHHHHhhhchH---HHhcCC---ccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCcH
Confidence            34455655555555532   224666   56544332221111110111123455677777777664


No 250
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=23.39  E-value=41  Score=24.16  Aligned_cols=25  Identities=36%  Similarity=0.709  Sum_probs=21.1

Q ss_pred             CCCccCCCchhccccchHHHHHHHh
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      ...|.|..|-+-|.....|..|+..
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhc
Confidence            4678999999999999999999863


No 251
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=23.22  E-value=30  Score=16.84  Aligned_cols=30  Identities=13%  Similarity=0.245  Sum_probs=11.8

Q ss_pred             CccCCcccccccChhhHHHHHHHhcCCCCccCCC
Q psy6628          75 PYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEF  108 (132)
Q Consensus        75 ~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~  108 (132)
                      |.....|+..|...+-+ ..+   ...+...|++
T Consensus        24 PV~s~~C~H~fek~aI~-~~i---~~~~~~~CPv   53 (57)
T PF11789_consen   24 PVKSKKCGHTFEKEAIL-QYI---QRNGSKRCPV   53 (57)
T ss_dssp             EEEESSS--EEEHHHHH-HHC---TTTS-EE-SC
T ss_pred             CcCcCCCCCeecHHHHH-HHH---HhcCCCCCCC
Confidence            44445566666544332 222   2234566665


No 252
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=23.12  E-value=45  Score=14.66  Aligned_cols=13  Identities=31%  Similarity=0.779  Sum_probs=7.7

Q ss_pred             eCCCCccccCChh
Q psy6628          13 TCQVCSKIFSYEN   25 (132)
Q Consensus        13 ~C~~C~~~f~~~~   25 (132)
                      .|+-|++.|...+
T Consensus         4 ~CprC~kg~Hwa~   16 (36)
T PF14787_consen    4 LCPRCGKGFHWAS   16 (36)
T ss_dssp             C-TTTSSSCS-TT
T ss_pred             cCcccCCCcchhh
Confidence            5788888775554


No 253
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=22.85  E-value=45  Score=15.00  Aligned_cols=9  Identities=33%  Similarity=0.836  Sum_probs=6.5

Q ss_pred             CccCCCchh
Q psy6628         103 PYACEFCPL  111 (132)
Q Consensus       103 ~~~C~~C~~  111 (132)
                      |..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            567888884


No 254
>PTZ00064 histone acetyltransferase; Provisional
Probab=22.63  E-value=48  Score=24.24  Aligned_cols=25  Identities=28%  Similarity=0.509  Sum_probs=21.7

Q ss_pred             CCCccCCCchhccccchHHHHHHHh
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRRS  125 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~~  125 (132)
                      +..|.|..|-+-|.....|.+|+..
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhc
Confidence            4679999999999999999999864


No 255
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.59  E-value=43  Score=22.35  Aligned_cols=11  Identities=18%  Similarity=0.697  Sum_probs=5.4

Q ss_pred             ccCCccccccc
Q psy6628          76 YQCSQCSKSFF   86 (132)
Q Consensus        76 ~~c~~C~~~~~   86 (132)
                      +.|+.||..+.
T Consensus       323 ~~C~~cg~~~~  333 (364)
T COG0675         323 FKCPRCGFVHD  333 (364)
T ss_pred             EECCCCCCeeh
Confidence            45555554443


No 256
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=22.56  E-value=43  Score=13.70  Aligned_cols=10  Identities=20%  Similarity=0.843  Sum_probs=5.5

Q ss_pred             ccCCCchhcc
Q psy6628         104 YACEFCPLTF  113 (132)
Q Consensus       104 ~~C~~C~~~f  113 (132)
                      |.|.+|++..
T Consensus         1 ~~C~~C~~~~   10 (30)
T PF03107_consen    1 FWCDVCRRKI   10 (30)
T ss_pred             CCCCCCCCCc
Confidence            4566666543


No 257
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=22.46  E-value=50  Score=15.46  Aligned_cols=11  Identities=27%  Similarity=0.730  Sum_probs=7.2

Q ss_pred             CCCCccccCCh
Q psy6628          14 CQVCSKIFSYE   24 (132)
Q Consensus        14 C~~C~~~f~~~   24 (132)
                      |+.||..|.-.
T Consensus         1 CP~Cg~~f~C~   11 (50)
T PF14375_consen    1 CPRCGAPFECG   11 (50)
T ss_pred             CCCCCCcCCCC
Confidence            66777776554


No 258
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=22.43  E-value=52  Score=15.17  Aligned_cols=13  Identities=23%  Similarity=0.460  Sum_probs=10.0

Q ss_pred             eeeeCCCCccccC
Q psy6628          10 VVFTCQVCSKIFS   22 (132)
Q Consensus        10 ~~~~C~~C~~~f~   22 (132)
                      ..+.|+.||..+.
T Consensus        19 ~~~vC~~Cg~~~~   31 (52)
T smart00661       19 RRFVCRKCGYEEP   31 (52)
T ss_pred             CEEECCcCCCeEE
Confidence            3788999997653


No 259
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=22.39  E-value=44  Score=16.29  Aligned_cols=11  Identities=27%  Similarity=0.721  Sum_probs=6.0

Q ss_pred             eeCCCCccccC
Q psy6628          12 FTCQVCSKIFS   22 (132)
Q Consensus        12 ~~C~~C~~~f~   22 (132)
                      -.|+.|+..|.
T Consensus        40 ngCPfC~~~~~   50 (55)
T PF14447_consen   40 NGCPFCGTPFE   50 (55)
T ss_pred             cCCCCCCCccc
Confidence            34666665553


No 260
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=22.26  E-value=57  Score=13.21  Aligned_cols=12  Identities=17%  Similarity=0.531  Sum_probs=5.2

Q ss_pred             eeeeCCCCcccc
Q psy6628          10 VVFTCQVCSKIF   21 (132)
Q Consensus        10 ~~~~C~~C~~~f   21 (132)
                      ..|.|.+|+..+
T Consensus        14 ~~Y~C~~Cdf~l   25 (30)
T PF07649_consen   14 WFYRCSECDFDL   25 (30)
T ss_dssp             -EEE-TTT----
T ss_pred             ceEECccCCCcc
Confidence            678898887654


No 261
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=22.14  E-value=31  Score=20.73  Aligned_cols=34  Identities=32%  Similarity=0.820  Sum_probs=20.8

Q ss_pred             CCccCCcccccccChhhHHHHHHHhcCCCCccCCCchhc
Q psy6628          74 KPYQCSQCSKSFFSKYDHKIHSRVHTGEKPYACEFCPLT  112 (132)
Q Consensus        74 ~~~~c~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~  112 (132)
                      -+|.|. |+..+...   .+|-..-.|+ .|.|..|+-.
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            357787 87765443   3344444555 7888888743


No 262
>PLN03239 histone acetyltransferase; Provisional
Probab=21.48  E-value=93  Score=21.63  Aligned_cols=25  Identities=16%  Similarity=0.374  Sum_probs=22.1

Q ss_pred             ceeeeCCCCccccCChhHHHHHHHh
Q psy6628           9 RVVFTCQVCSKIFSYENGLKAHVRN   33 (132)
Q Consensus         9 ~~~~~C~~C~~~f~~~~~l~~h~~~   33 (132)
                      +..|.|..|-+-|.+...|.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            5789999999999999999999764


No 263
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=21.04  E-value=50  Score=18.44  Aligned_cols=13  Identities=23%  Similarity=0.634  Sum_probs=9.7

Q ss_pred             eeCCCCccccCCh
Q psy6628          12 FTCQVCSKIFSYE   24 (132)
Q Consensus        12 ~~C~~C~~~f~~~   24 (132)
                      ..||.||..|...
T Consensus        50 t~CP~Cg~~~e~~   62 (115)
T COG1885          50 TSCPKCGEPFESA   62 (115)
T ss_pred             ccCCCCCCcccee
Confidence            5699999877543


No 264
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=20.89  E-value=45  Score=15.87  Aligned_cols=9  Identities=33%  Similarity=0.848  Sum_probs=4.9

Q ss_pred             CccCCCchh
Q psy6628         103 PYACEFCPL  111 (132)
Q Consensus       103 ~~~C~~C~~  111 (132)
                      .|.|..|+.
T Consensus        37 R~~CGkCgy   45 (51)
T COG1998          37 RWACGKCGY   45 (51)
T ss_pred             eeEeccccc
Confidence            455555553


No 265
>KOG0562|consensus
Probab=20.34  E-value=94  Score=19.13  Aligned_cols=29  Identities=21%  Similarity=0.171  Sum_probs=21.6

Q ss_pred             CCCccCCCchhccccchHHHHHHHhhhhh
Q psy6628         101 EKPYACEFCPLTFRHSSHLFRHRRSLHQM  129 (132)
Q Consensus       101 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  129 (132)
                      +.+..|..|+..-..-+.|+.|++.+...
T Consensus       151 k~dLrC~~Cq~~~~~~~kLK~Hl~~~~~q  179 (184)
T KOG0562|consen  151 KEDLRCWRCQTFGPHFPKLKAHLREEYDQ  179 (184)
T ss_pred             ccceeehhhhhcccccHHHHHHHHHHHhh
Confidence            45788999984445678899999877654


No 266
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=20.15  E-value=43  Score=14.29  Aligned_cols=11  Identities=18%  Similarity=0.667  Sum_probs=8.0

Q ss_pred             eeeeCCCCccc
Q psy6628          10 VVFTCQVCSKI   20 (132)
Q Consensus        10 ~~~~C~~C~~~   20 (132)
                      ..|.|..|++.
T Consensus         7 ~~Y~C~~C~~~   17 (32)
T PF13696_consen    7 PGYVCHRCGQK   17 (32)
T ss_pred             CCCEeecCCCC
Confidence            34888888874


No 267
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.08  E-value=59  Score=16.40  Aligned_cols=13  Identities=23%  Similarity=0.698  Sum_probs=9.4

Q ss_pred             eeeCCCCccccCC
Q psy6628          11 VFTCQVCSKIFSY   23 (132)
Q Consensus        11 ~~~C~~C~~~f~~   23 (132)
                      .-+|+.||+....
T Consensus         7 ~v~CP~Cgkpv~w   19 (65)
T COG3024           7 TVPCPTCGKPVVW   19 (65)
T ss_pred             cccCCCCCCcccc
Confidence            3579999987544


Done!