Diaphorina citri psyllid: psy6644


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MTCFDWVNRNFGGVDVLINNAGVTVKAPLSEAASEDWRRILDVNVIALSSCTREALKSMKNRGVDDGHIIHINSIAGHRLSILQGNEMYSASKHAVTILAEGLRRELASRKSQIKVTVSNFLVFL
ccHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEccEEEEc
MTCFDWVNRNFGGVDVLINNAGVTVKAPLSEAASEDWRRILDVNVIALSSCTREALKSMKNRGVDDGHIIHINSIAGHRLSILQGNEMYSASKHAVTILAEGLRRELASRKSQIKVTVSNFLVFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCFDWVNRNFGGVDVLINNAGVTVKAPLSEAASEDWRRILDVNVIALSSCTREALKSMKNRGVDDGHIIHINSIAGHRLSILQGNEMYSASKHAVTILAEGLRRELASRKSQIKVTVSNFLVFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0044255 [BP]cellular lipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0042180 [BP]cellular ketone metabolic processprobableGO:0044710, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0044281, GO:0008152
GO:0033764 [MF]steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptorprobableGO:0016229, GO:0016614, GO:0016616, GO:0003824, GO:0003674, GO:0016491
GO:0044249 [BP]cellular biosynthetic processprobableGO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0008202 [BP]steroid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360
GO:0050662 [MF]coenzyme bindingprobableGO:0003674, GO:0048037, GO:0005488
GO:0051262 [BP]protein tetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XG5, chain A
Confidence level:very confident
Coverage over the Query: 2-124
View the alignment between query and template
View the model in PyMOL