Query         psy666
Match_columns 102
No_of_seqs    43 out of 45
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 23:50:53 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy666.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/666hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10189 DUF2356:  Conserved pr 100.0 9.9E-57 2.1E-61  351.5   4.3   92   10-101    56-147 (230)
  2 KOG4262|consensus               99.3 2.1E-13 4.6E-18  116.5   1.0   86   12-101   271-357 (496)
  3 COG4941 Predicted RNA polymera  41.7     8.4 0.00018   33.6  -0.1   20   25-46     99-120 (415)
  4 PF00524 PPV_E1_N:  E1 Protein,  39.6      16 0.00034   26.8   1.1   19   11-29     71-89  (130)
  5 PLN03075 nicotianamine synthas  30.9      16 0.00036   29.8  -0.0   19   39-57    255-273 (296)
  6 cd01902 Ntn_CGH Choloylglycine  28.0      40 0.00086   26.7   1.7   50   52-102    94-158 (291)
  7 COG5308 NUP170 Nuclear pore co  27.7      32  0.0007   33.7   1.3   19   81-99    934-952 (1263)
  8 PF07491 PPI_Ypi1:  Protein pho  24.9      35 0.00075   22.6   0.7   11   39-49     38-48  (60)
  9 PF03059 NAS:  Nicotianamine sy  24.3      22 0.00048   28.8  -0.3   21   37-57    249-270 (276)
 10 KOG3507|consensus               24.1      65  0.0014   21.6   1.9   30   27-56     10-39  (62)
 11 cd01935 Ntn_CGH_like Choloylgl  23.5      64  0.0014   23.4   2.0   49   52-101    94-156 (229)
 12 PF15051 FAM198:  FAM198 protei  23.1      47   0.001   28.4   1.3   19   67-86    163-181 (326)
 13 PF08307 Glyco_hydro_98C:  Glyc  22.6      37 0.00081   28.1   0.7   42   12-53    192-233 (268)
 14 COG1152 CdhA CO dehydrogenase/  20.3      40 0.00086   31.6   0.4   18   84-101   658-675 (772)
 15 PRK00941 acetyl-CoA decarbonyl  20.2      39 0.00085   31.5   0.4   18   84-101   663-680 (781)

No 1  
>PF10189 DUF2356:  Conserved protein (DUF2356);  InterPro: IPR019333 The Integrator complex is involved in small nuclear RNA (snRNA) U1 and U2 transcription, and in their 3'-box-dependent processing. This complex associates with the C-terminal domain of RNA polymerase II largest subunit and is recruited to the U1 and U2 snRNAs genes []. This entry represents subunit 3 of this complex. The function of this subunit is unknown.
Probab=100.00  E-value=9.9e-57  Score=351.47  Aligned_cols=92  Identities=61%  Similarity=0.980  Sum_probs=89.9

Q ss_pred             hhhhhhchhhhhhccCCCCcchhhheeeeeeccccCCCcccccCCchHHHHHHHHHhhcCchHHHHhhHHHhhhhhhhcc
Q psy666           10 SVLQELQVLPVWYLSTTESQALRYDVIRFIVGVIHPTNELLCSDIIPRWAVIGWLLTSCTSPVVLANCKLALFYDWLCYD   89 (102)
Q Consensus        10 ~~~~~~~Wf~~kyL~tpesesL~~DlIRfIcc~~hPtNevl~SdIipRWavIgWLL~~c~~~~~~anaKLALFyDWLffd   89 (102)
                      +-.||.+||++|||++||||+||+||||||||+|||+|||++|||+||||||||||++|++++++|||||||||||||||
T Consensus        56 ~~kryq~WF~~kyL~~pesesL~~DlIRfIc~~~hP~Nevl~S~i~pRwavIgwLl~~c~~~~~~~~~KLaLfyDWLffd  135 (230)
T PF10189_consen   56 NQKRYQDWFAKKYLSTPESESLRPDLIRFICCVYHPTNEVLQSDIIPRWAVIGWLLTTCKSNVEQQNAKLALFYDWLFFD  135 (230)
T ss_pred             chhHHHHHHHHHhcCCCCcchHHHHHHHHHHHhcCChhcccccchhHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhccC
Confidence            44599999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCeeeecCC
Q psy666           90 PEKDNIMNIDQI  101 (102)
Q Consensus        90 ~~~dnIMnIEPa  101 (102)
                      |++|||||||||
T Consensus       136 ~~~dniMnIEPa  147 (230)
T PF10189_consen  136 PRNDNIMNIEPA  147 (230)
T ss_pred             CCCCceeeecHH
Confidence            999999999997


No 2  
>KOG4262|consensus
Probab=99.34  E-value=2.1e-13  Score=116.53  Aligned_cols=86  Identities=27%  Similarity=0.446  Sum_probs=79.5

Q ss_pred             hhhhchhhhhhccCCCCcchhhheeeeeeccccCCCcccccCCchHHHHHHHHHhhcCchHH-HHhhHHHhhhhhhhccC
Q psy666           12 LQELQVLPVWYLSTTESQALRYDVIRFIVGVIHPTNELLCSDIIPRWAVIGWLLTSCTSPVV-LANCKLALFYDWLCYDP   90 (102)
Q Consensus        12 ~~~~~Wf~~kyL~tpesesL~~DlIRfIcc~~hPtNevl~SdIipRWavIgWLL~~c~~~~~-~anaKLALFyDWLffd~   90 (102)
                      .+|=.||++++|..++-|+...|+|||+||.+||+|+..-+.+++|||+  |++-.|....+ .|-.=.+|||||+|  +
T Consensus       271 k~Hpeals~~LLllkre~ep~~eiVR~vlsr~~p~kdd~fttsalR~~i--~~~ewCqk~~eilaevIksLL~~n~~--~  346 (496)
T KOG4262|consen  271 KRHPEALSKKLLLLKREEEPLIEIVRFVLSRIHPTKDDIFTTSALRWAI--WLLEWCQKNHEILAEVIKSLLYDNLF--E  346 (496)
T ss_pred             ccCHHHHHHHHHhcccccccHHHHHHHHHcCCCCCCCchhhHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHhccCc--c
Confidence            3566799999999999999999999999999999999999999999999  99999998766 78888999999999  5


Q ss_pred             CCCCeeeecCC
Q psy666           91 EKDNIMNIDQI  101 (102)
Q Consensus        91 ~~dnIMnIEPa  101 (102)
                      ..+|+||.||+
T Consensus       347 s~pnkr~~~pk  357 (496)
T KOG4262|consen  347 SIPNKRNVEPK  357 (496)
T ss_pred             cCCccccCCcc
Confidence            67999999996


No 3  
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription]
Probab=41.72  E-value=8.4  Score=33.63  Aligned_cols=20  Identities=30%  Similarity=0.677  Sum_probs=15.4

Q ss_pred             CCCCcchhhheee--eeeccccCC
Q psy666           25 TTESQALRYDVIR--FIVGVIHPT   46 (102)
Q Consensus        25 tpesesL~~DlIR--fIcc~~hPt   46 (102)
                      .++++.+..|+.|  ||||  ||.
T Consensus        99 ~~~d~~i~Dd~LRLiFvcc--HPa  120 (415)
T COG4941          99 ALDDEHIRDDRLRLIFVCC--HPA  120 (415)
T ss_pred             cccccccchhhHHhhhhhc--CCC
Confidence            4568889999999  7777  664


No 4  
>PF00524 PPV_E1_N:  E1 Protein, N terminal domain;  InterPro: IPR014000 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species. The helicase E1 protein is an ATP-dependent DNA helicase required for initiation of viral DNA replication []. It forms a complex with the viral E2 protein, which is a site-specific DNA-binding transcriptional activator. The E1-E2 complex binds to the replication origin which contains binding sites for both proteins []. The E1 protein is a 70 kDa polypeptide with a centrally-located DNA-binding domain and a C-terminal ATPase/helicase domain. It binds specific 18 bp DNA sequences at the origin of replication, melts the DNA duplex and functions as a 3' to 5' helicase []. In addition to E2 it also interacts with DNA polymerase alpha and replication protein A to effect DNA replication. The DNA-binding domain forms a five-stranded antiparallel beta sheet bordered by four loosely packed alpha helices on one side and two tightly packed helices on the other []. Two structural modules within this domain, an extended loop and a helix, contain conserved residues and are critical for DNA binding. In solution E1 is a monomer, but binds DNA as a dimer. Recruitment of more E1 subunits to the complex leads to melting of the origin and ultimately to the formation of an E1 hexamer with helicase activity []. This entry represents the N-terminal region of E1, which contains the nuclear localisation signal.; GO: 0016817 hydrolase activity, acting on acid anhydrides
Probab=39.56  E-value=16  Score=26.76  Aligned_cols=19  Identities=26%  Similarity=0.300  Sum_probs=16.9

Q ss_pred             hhhhhchhhhhhccCCCCc
Q psy666           11 VLQELQVLPVWYLSTTESQ   29 (102)
Q Consensus        11 ~~~~~~Wf~~kyL~tpese   29 (102)
                      -++.++.++|||+.+|++.
T Consensus        71 d~~~v~~LKRK~~~SP~~~   89 (130)
T PF00524_consen   71 DERAVQALKRKYLGSPKSK   89 (130)
T ss_pred             HHHHHHHHHHHHcCCcccc
Confidence            4688999999999999887


No 5  
>PLN03075 nicotianamine synthase; Provisional
Probab=30.86  E-value=16  Score=29.85  Aligned_cols=19  Identities=47%  Similarity=0.819  Sum_probs=16.5

Q ss_pred             eeccccCCCcccccCCchH
Q psy666           39 IVGVIHPTNELLCSDIIPR   57 (102)
Q Consensus        39 Icc~~hPtNevl~SdIipR   57 (102)
                      ++.++||+++|.+|-|+-|
T Consensus       255 ~~~~~~P~~~v~Nsvi~~r  273 (296)
T PLN03075        255 VLSVFHPTDEVINSVIIAR  273 (296)
T ss_pred             EEEEECCCCCceeeEEEEE
Confidence            5668999999999998876


No 6  
>cd01902 Ntn_CGH Choloylglycine hydrolase (CGH) is a bile salt-modifying enzyme that hydrolyzes non-peptide carbon-nitrogen bonds in choloylglycine and choloyltaurine, both of which are present in bile.  CGH is present in a number of probiotic microbial organisms that inhabit the gut.  CGH has an N-terminal nucleophilic cysteine, as do other members of the Ntn hydrolase family to which CGH belongs.
Probab=27.96  E-value=40  Score=26.74  Aligned_cols=50  Identities=14%  Similarity=0.059  Sum_probs=33.1

Q ss_pred             cCCchHHHHHHHHHhhcCchHH--HHhh--HHHh-----------hhhhhhccCCCCCeeeecCCC
Q psy666           52 SDIIPRWAVIGWLLTSCTSPVV--LANC--KLAL-----------FYDWLCYDPEKDNIMNIDQIN  102 (102)
Q Consensus        52 SdIipRWavIgWLL~~c~~~~~--~ana--KLAL-----------FyDWLffd~~~dnIMnIEPa~  102 (102)
                      ..-+.-+.++-|+|.+|++-.+  +.-.  ++..           -+-|.+-|. +|+.+-|||-+
T Consensus        94 ~~~l~~~~~~~~vL~~~~tV~Ea~~~l~~~~i~~~~~~~~~~~~~~lH~~i~D~-tG~s~VIE~~~  158 (291)
T cd01902          94 KPTLSAGAWGQYLLDNYATVEEAVKALAKEPFVIVASVPGDGREATLHLSISDA-TGDSAIIEYID  158 (291)
T ss_pred             CCccCHHHHHHHHHhcCCCHHHHHHHHhcCceEEeecCCCCCCcccEEEEEEcC-CCCEEEEEEEC
Confidence            3346789999999999996322  2222  2222           245778886 68888899853


No 7  
>COG5308 NUP170 Nuclear pore complex subunit [Intracellular trafficking and secretion]
Probab=27.73  E-value=32  Score=33.67  Aligned_cols=19  Identities=42%  Similarity=1.060  Sum_probs=16.8

Q ss_pred             hhhhhhhccCCCCCeeeec
Q psy666           81 LFYDWLCYDPEKDNIMNID   99 (102)
Q Consensus        81 LFyDWLffd~~~dnIMnIE   99 (102)
                      -|||||-|+.+.|-...|+
T Consensus       934 cfYDWlv~~~r~d~Li~Id  952 (1263)
T COG5308         934 CFYDWLVFKGRTDRLIKID  952 (1263)
T ss_pred             hhhhhHhhcCccceEEEec
Confidence            3899999999999998886


No 8  
>PF07491 PPI_Ypi1:  Protein phosphatase inhibitor  ;  InterPro: IPR011107 These proteins include Ypi1, a novel Saccharomyces cerevisiae type 1 protein phosphatase inhibitor [] and ppp1r11/hcgv (O60927 from SWISSPROT), annotated as having protein phosphatase inhibitor activity [].
Probab=24.86  E-value=35  Score=22.56  Aligned_cols=11  Identities=9%  Similarity=0.217  Sum_probs=8.9

Q ss_pred             eeccccCCCcc
Q psy666           39 IVGVIHPTNEL   49 (102)
Q Consensus        39 Icc~~hPtNev   49 (102)
                      +||.||++.+.
T Consensus        38 ~CCIyhk~~~~   48 (60)
T PF07491_consen   38 CCCIYHKPRAF   48 (60)
T ss_pred             eeeeecCCCCC
Confidence            79999998543


No 9  
>PF03059 NAS:  Nicotianamine synthase protein;  InterPro: IPR004298 Nicotianamine synthase 2.5.1.43 from EC catalyzes the trimerization of S-adenosylmethionine to yield one molecule of nicotianamine. Nicotianamine has an important role in plant iron uptake mechanisms. Plants adopt two strategies (termed I and II) of iron acquisition. Strategy I is adopted by all higher plants except graminaceous plants, which adopt strategy II [, ]. In strategy I plants, the role of nicotianamine is not fully determined: possible roles include the formation of more stable complexes with ferrous than with ferric ion, which might serve as a sensor of the physiological status of iron within a plant, or which might be involved in the transport of iron []. In strategy II (graminaceous) plants, nicotianamine is the key intermediate (and nicotianamine synthase the key enzyme) in the synthesis of the mugineic family (the only known family in plants) of phytosiderophores. Phytosiderophores are iron chelators whose secretion by the roots is greatly increased in instances of iron deficiency []. The 3D structures of five example NAS from Methanothermobacter thermautotrophicus reveal the monomer to consist of a five-helical bundle N-terminal domain on top of a classic Rossmann fold C-terminal domain. The N-terminal domain is unique to the NAS family, whereas the C-terminal domain is homologous to the class I family of SAM-dependent methyltransferases. An active site is created at the interface of the two domains, at the rim of a large cavity that corresponds to the nucleotide binding site such as is found in other proteins adopting a Rossmann fold [].; GO: 0030410 nicotianamine synthase activity, 0030418 nicotianamine biosynthetic process; PDB: 3O31_B 3FPH_A 3FPJ_A 3FPE_B 3FPF_B 3FPG_B.
Probab=24.31  E-value=22  Score=28.80  Aligned_cols=21  Identities=43%  Similarity=0.743  Sum_probs=10.9

Q ss_pred             eeee-ccccCCCcccccCCchH
Q psy666           37 RFIV-GVIHPTNELLCSDIIPR   57 (102)
Q Consensus        37 RfIc-c~~hPtNevl~SdIipR   57 (102)
                      .|-. ..+||+++|.+|-|+-|
T Consensus       249 gf~~~~~~hP~~~ViNSvv~~r  270 (276)
T PF03059_consen  249 GFEVLAVVHPTDEVINSVVFAR  270 (276)
T ss_dssp             TEEEEEEE---TT---EEEEE-
T ss_pred             CeEEEEEECCCCCceeEEEEEE
Confidence            6654 68999999999988876


No 10 
>KOG3507|consensus
Probab=24.14  E-value=65  Score=21.64  Aligned_cols=30  Identities=23%  Similarity=0.289  Sum_probs=24.8

Q ss_pred             CCcchhhheeeeeeccccCCCcccccCCch
Q psy666           27 ESQALRYDVIRFIVGVIHPTNELLCSDIIP   56 (102)
Q Consensus        27 esesL~~DlIRfIcc~~hPtNevl~SdIip   56 (102)
                      ..+..++..+=|||+--|--|++...|+|.
T Consensus        10 ~aa~~r~~~miYiCgdC~~en~lk~~D~ir   39 (62)
T KOG3507|consen   10 PAAGPRTATMIYICGDCGQENTLKRGDVIR   39 (62)
T ss_pred             ccCCCCcccEEEEeccccccccccCCCcEe
Confidence            333457888999999999999999999874


No 11 
>cd01935 Ntn_CGH_like Choloylglycine hydrolase (CGH)_like. This family of choloylglycine hydrolase-like proteins includes conjugated bile acid hydrolase (CBAH), penicillin V acylase (PVA), acid ceramidase (AC), and N-acylethanolamine-hydrolyzing acid amidase (NAAA) which cleave non-peptide carbon-nitrogen bonds in bile salt constituents.  These enzymes have an N-terminal nucleophilic cysteine, as do other members of the Ntn hydrolase family to which they belong.  This nucleophilic cysteine is exposed by post-translational prossessing of the precursor protein.
Probab=23.51  E-value=64  Score=23.45  Aligned_cols=49  Identities=22%  Similarity=0.408  Sum_probs=33.1

Q ss_pred             cCCchHHHHHHHHHhhcCchHH--H--HhhHH----------HhhhhhhhccCCCCCeeeecCC
Q psy666           52 SDIIPRWAVIGWLLTSCTSPVV--L--ANCKL----------ALFYDWLCYDPEKDNIMNIDQI  101 (102)
Q Consensus        52 SdIipRWavIgWLL~~c~~~~~--~--anaKL----------ALFyDWLffd~~~dnIMnIEPa  101 (102)
                      .+-+|-..++-|+|..|++-.+  +  .+.++          +-=.=|++-|.. |+..-||+.
T Consensus        94 ~~~~~~~~~~r~vL~~~~tv~ea~~~l~~~~~~~~~~~~~~~~~~~h~~i~D~~-G~~~viE~~  156 (229)
T cd01935          94 KDGLPAFELIRWVLENCDSVEEVKEALKKIPIVDFPIPLGGPAAPLHYILSDKS-GDSAVIEPI  156 (229)
T ss_pred             CCccCHHHHHHHHHHHcCCHHHHHHHHHhCcccccccCCCCCCcCEEEEEEcCC-CCEEEEEEE
Confidence            3568889999999999986222  2  22233          334557788864 888888874


No 12 
>PF15051 FAM198:  FAM198 protein
Probab=23.11  E-value=47  Score=28.36  Aligned_cols=19  Identities=47%  Similarity=0.627  Sum_probs=16.1

Q ss_pred             hcCchHHHHhhHHHhhhhhh
Q psy666           67 SCTSPVVLANCKLALFYDWL   86 (102)
Q Consensus        67 ~c~~~~~~anaKLALFyDWL   86 (102)
                      .|+..+...++||||| |.|
T Consensus       163 ~C~~IhH~EW~klALF-DFL  181 (326)
T PF15051_consen  163 PCTGIHHHEWSKLALF-DFL  181 (326)
T ss_pred             CCCccchHHHHHHHHH-HHH
Confidence            5778888999999997 666


No 13 
>PF08307 Glyco_hydro_98C:  Glycosyl hydrolase family 98 C-terminal domain;  InterPro: IPR013190 This putative domain is found at the C terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.; PDB: 2WMH_A 2WMG_A 2WMF_A 2WMK_A 2WMJ_B 2WMI_B.
Probab=22.56  E-value=37  Score=28.10  Aligned_cols=42  Identities=21%  Similarity=0.201  Sum_probs=29.2

Q ss_pred             hhhhchhhhhhccCCCCcchhhheeeeeeccccCCCcccccC
Q psy666           12 LQELQVLPVWYLSTTESQALRYDVIRFIVGVIHPTNELLCSD   53 (102)
Q Consensus        12 ~~~~~Wf~~kyL~tpesesL~~DlIRfIcc~~hPtNevl~Sd   53 (102)
                      +.-+.|....|.-+|...+||-|.|+--++.-+|+=..+.+|
T Consensus       192 ~~~~~w~~~~y~~n~~d~elRTtti~L~G~~k~Ptit~~~gd  233 (268)
T PF08307_consen  192 LDAYNWVSSNYIVNTIDGELRTTTITLKGASKQPTITNVNGD  233 (268)
T ss_dssp             HHHHHHHHHCTTTS------EEEEEEEES-SSSSEEEEEEES
T ss_pred             HHHHHHHHhccccCCccccceeEEEEEEccCCCCcEEEeccC
Confidence            456889999999999999999999999999999986654443


No 14 
>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion]
Probab=20.26  E-value=40  Score=31.59  Aligned_cols=18  Identities=22%  Similarity=0.599  Sum_probs=16.6

Q ss_pred             hhhhccCCCCCeeeecCC
Q psy666           84 DWLCYDPEKDNIMNIDQI  101 (102)
Q Consensus        84 DWLffd~~~dnIMnIEPa  101 (102)
                      ||-.||-++++.|.|||+
T Consensus       658 kwkV~Dartge~~~iepa  675 (772)
T COG1152         658 KWKVYDARTGEEVKIEPA  675 (772)
T ss_pred             cceeeecccccccccCCC
Confidence            499999999999999997


No 15 
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated
Probab=20.15  E-value=39  Score=31.54  Aligned_cols=18  Identities=22%  Similarity=0.610  Sum_probs=14.4

Q ss_pred             hhhhccCCCCCeeeecCC
Q psy666           84 DWLCYDPEKDNIMNIDQI  101 (102)
Q Consensus        84 DWLffd~~~dnIMnIEPa  101 (102)
                      ||-.||.++|..|.|||+
T Consensus       663 ~w~~~d~~~g~~~~~~p~  680 (781)
T PRK00941        663 KWKVYDARTGEKVKIEPA  680 (781)
T ss_pred             CCeEEecCCCCcccCCCC
Confidence            788888877888888876


Done!