Diaphorina citri psyllid: psy6661

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MSSKRTKPNILITGTPGTGKSTLCEEVVKQCDSLEWIDVNKIARENQFYLKYDEQYECPELDEDKLLDELEPRVQGGGKIIDYHSAEMFPERWIDQVYVLSADNTTLYDRLVEKGQSGKKLQDNLQCEIFQTILEEARDSYKEDIVVSLPSNTHDDMSSNVTSIIQFVKQWK
cccccccccEEEEccccccHHHHHHHHHHHccccEEEEHHHHHHHcccccccccccccccccHHHHHHHHccccccccEEEccccccccccccccEEEEEEccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHcc
*****TK**ILITGTPGTGKSTLCEEVVKQCDSLEWIDVNKIARENQFYLKYDEQYECPELDEDKLLDELEPRVQGGGKIIDYHSAEMFPERWIDQVYVLSADNTTLYDRLVEKGQSGKKLQDNLQCEIFQTILEEARDSYKEDIVVSLPSNTHDDMSSNVTSIIQFVKQWK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKRTKPNILITGTPGTGKSTLCEEVVKQCDSLEWIDVNKIARENQFYLKYDEQYECPELDEDKLLDELEPRVQGGGKIIDYHSAEMFPERWIDQVYVLSADNTTLYDRLVEKGQSGKKLQDNLQCEIFQTILEEARDSYKEDIVVSLPSNTHDDMSSNVTSIIQFVKQWK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenylate kinase isoenzyme 6 Broad activity as an NMP kinase. AMP and dAMP are the preferred substrates of all tested NMPs, but CMP and dCMP are also good substrates. IMP can be phosphorylated, but to a much lesser extent. Adenylate and cytidylate can serve as phosphate acceptors.very confidentQ9Y3D8
Adenylate kinase isoenzyme 6 Broad activity as an NMP kinase. AMP and dAMP are the preferred substrates of all tested NMPs, but CMP and dCMP are also good substrates. IMP can be phosphorylated, but to a much lesser extent. Adenylate and cytidylate can serve as phosphate acceptors.very confidentA5PJA1
Adenylate kinase isoenzyme 6 Broad activity as an NMP kinase. AMP and dAMP are the preferred substrates of all tested NMPs, but CMP and dCMP are also good substrates. IMP can be phosphorylated, but to a much lesser extent. Adenylate and cytidylate can serve as phosphate acceptors.very confidentQ5EB68

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004017 [MF]adenylate kinase activityprobableGO:0019201, GO:0019205, GO:0016772, GO:0016301, GO:0016776, GO:0003824, GO:0016740, GO:0003674
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0015030 [CC]Cajal bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0030684 [CC]preribosomeprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0030490 [BP]maturation of SSU-rRNAprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:0071840, GO:0006139, GO:0044260, GO:0042274, GO:1901360, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000056 [BP]ribosomal small subunit export from nucleusprobableGO:0051169, GO:0051168, GO:0033750, GO:0033753, GO:0071166, GO:0051656, GO:0071840, GO:0042254, GO:0044699, GO:0022613, GO:0016482, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0071426, GO:0046907, GO:0071428, GO:0000054, GO:0044085, GO:0008150
GO:0017111 [MF]nucleoside-triphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674
GO:0040007 [BP]growthprobableGO:0008150
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0004765 [MF]shikimate kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0034599 [BP]cellular response to oxidative stressprobableGO:0051716, GO:0033554, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0070887, GO:0042221, GO:0006979, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.3Adenylate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IIJ, chain A
Confidence level:very confident
Coverage over the Query: 4-171
View the alignment between query and template
View the model in PyMOL