Diaphorina citri psyllid: psy6664


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620----
MAPTIQTTSAGTPSEKRTPSTHSTPVPPRPAERRSELVCRVKYNNTLPDIPFDCKFIAYPFESTRFIEYKSTSLERNYKYEVLTEHDLGVTIDLINKDTYAPNYNIQLDPADEKLLEEDILTPQDSKRSRHHARSVSWLRRTEYISTEQTRFQPQVMDKVEAKVGFSIKKNFKEDNLYMDRDSQVKAIEKTFADSKLPIEKHYSKPNVTPVEIMPVYPDFKYWKYPCAQVIFDSDPAPVGRPIPAQIEEMSQAMIRGVMDESGEQFVAYFLPTAETLDKRKLDQLSNLEYTDEQEYEYKMAREYNWNVKSKSCKGYEENYFLIVRDDAVYYNELETRVRLSKRRQKVGAAPNNTRLVVTHRPLNATEFRIQRLRERFLEPPNEEEEEEDEEEEEEEAEETQQGETTEAERQEGEGGEREGGGEGENDNEKRTSDAEHSSKNSSRASSRSRSRSKSKSPAKRSRSGSASSRGSNKSDRSAKSDRSAKSDRSARSDRSDKSAASNRSRSGSAASNKSRSDRSRSGSAGSDRSAASNKSVRSDKSAASNRSARSDGSDKSASNRSRSRSASSQASNNSAASNRSSNKSGSRSRSRSVSRARSNRSRSASKSGSSAASSRSGSPAGSD
ccccccccccccccccccccccccccccccccccccEEEEEEECcccccccccccEEcccccccccccccccHHHccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccEEccccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHcHHHHccccccccccccccEEEECccccccccccccCEEEEEcccccccccccHHHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHccccccccccccccEEEEcccccccccccccccCEEEEEcccEEEEEcccccEEEHHcccccccccccccEEEEEccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
************************************LVCRVKYNNTLPDIPFDCKFIAYPFESTRFIEYKSTSLERNYKYEVLTEHDLGVTIDLINKDTYAPNYNIQLDPADEKLL********************SWLRRTEYISTEQTRF*****DKVEAKVGFSIKKNFKEDNLYMDR**QVKAIEKTFADSKLPIEKHYSKPNVTPVEIMPVYPDFKYWKYPCAQVIFDSD******************MIRGVMDESGEQFVAYFLPTAETLDKRKLDQLSNLEYTDEQEYEYKMAREYNWNVKSKSCKGYEENYFLIVRDDAVYYNELETRVRLS***********NTRLVVTHRPLNATEFRIQ*************************************************************************************************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPTIQTTSAGTPSEKRTPSTHSTPVPPRPAERRSELVCRVKYNNTLPDIPFDCKFIAYPFESTRFIEYKSTSLERNYKYEVLTEHDLGVTIDLINKDTYAPNYNIQLDPADEKLLEEDILTPQDSKRSRHHARSVSWLRRTEYISTEQTRFQPQVMDKVEAKVGFSIKKNFKEDNLYMDRDSQVKAIEKTFADSKLPIEKHYSKPNVTPVEIMPVYPDFKYWKYPCAQVIFDSDPAPVGRPIPAQIEEMSQAMIRGVMDESGEQFVAYFLPTAETLDKRKLDQLSNLEYTDEQEYEYKMAREYNWNVKSKSCKGYEENYFLIVRDDAVYYNELETRVRLSKRRQKVGAAPNNTRLVVTHRPLNATEFRIQRLRERFLEPPxxxxxxxxxxxxxxxxxxxxxxxTTEAERQEGEGGEREGGGEGENDNEKRTSDAEHSSKNSSRASSRSRSRSKSKSPAKRSRSGSASSRGSNKSDRSAKSDRSAKSDRSARSDRSDKSAASNRSRSGSAASNKSRSDRSRSGSAGSDRSAASNKSVRSDKSAASNRSARSDGSDKSASNRSRSRSASSQASNNSAASNRSSNKSGSRSRSRSVSRARSNRSRSASKSGSSAASSRSGSPAGSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA polymerase II-associated factor 1 homolog Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1; it promotes leukemogenesis though association with MLL-rearranged oncoproteins, such as MLL-MLLT3/AF9 and MLL-MLLT1/ENL. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. In case of infection by influenza A strain H3N2, PAF1C associates with viral NS1 protein, thereby regulating gene transcription. Connects PAF1C with the RNF20/40 E3 ubiquitin-protein ligase complex. Involved in polyadenylation of mRNA precursors. Has oncogenic activity in vivo and in vitro.confidentQ8N7H5
RNA polymerase II-associated factor 1 homolog Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. Connects PAF1C with the RNF20/40 E3 ubiquitin-protein ligase complex. Involved in polyadenylation of mRNA precursors.confidentQ5RAX0
RNA polymerase II-associated factor 1 homolog Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II. PAF1C associates with RNA polymerase II, is involved in transcriptional elongation and in histone modifications including methylation on histone H3 'Lys-4' (H3K4me3).confidentQ6P2Y1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016593 [CC]Cdc73/Paf1 complexprobableGO:0008023, GO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0019894 [MF]kinesin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0032968 [BP]positive regulation of transcription elongation from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0034243, GO:0060255, GO:0032784, GO:0009889, GO:0032786, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0010390 [BP]histone monoubiquitinationprobableGO:0044699, GO:0044267, GO:0044260, GO:0032446, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006513, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0016574, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0033523 [BP]histone H2B ubiquitinationprobableGO:0044699, GO:0044267, GO:0044260, GO:0032446, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0016574, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0000993 [MF]RNA polymerase II core bindingprobableGO:0019899, GO:0070063, GO:0043175, GO:0001098, GO:0001099, GO:0003674, GO:0005488, GO:0005515, GO:0032403
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035327 [CC]transcriptionally active chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0071222 [BP]cellular response to lipopolysaccharideprobableGO:0070887, GO:0032496, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0071219, GO:0071216, GO:0009987, GO:0071396, GO:0008150, GO:0042221, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0044763
GO:0045638 [BP]negative regulation of myeloid cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0050789, GO:0045596, GO:0045595, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0002682, GO:0045637, GO:0048523
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2zjr, chain Sprobable Alignment | Template Structure