Diaphorina citri psyllid: psy6667

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-

PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILFEDCIHKVEPITDYIGMVYSGMGPDYRLLVKKARKIAQQYKLVYQENIPTQQLVQRVAAIMQEYTQSGS

cccccHHHHHHHHHHHccccEEEEEcccCEEEEEEccccccccccccccCEEccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccc

PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILFEDCIHKVEPITDYIGMVYSGMGPDYRLLVKKARKIAQQYKLVYQENIPTQQLVQRVAAIMQEYTQS**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

PSGKLVQIEYALAAVEAGAPSVGIKASNGIVLATEKKQKTILFEDCIHKVEPITDYIGMVYSGMGPDYRLLVKKARKIAQQYKLVYQENIPTQQLVQRVAAIMQEYTQSGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Proteasome subunit alpha type-2	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMA2 may have a potential regulatory effect on another component(s) of the proteasome complex through tyrosine phosphorylation.	confident	Q3T0Y5
Proteasome subunit alpha type-2	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMA2 may have a potential regulatory effect on another component(s) of the proteasome complex through tyrosine phosphorylation.	confident	P25787
Proteasome subunit alpha type-2	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMA2 may have a potential regulatory effect on another component(s) of the proteasome complex through tyrosine phosphorylation.	confident	P49722

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0019773 [CC]	proteasome core complex, alpha-subunit complex	probable	GO:0043234, GO:0032991, GO:0005839, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0044281 [BP]	small molecule metabolic process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0022626 [CC]	cytosolic ribosome	probable	GO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0034515 [CC]	proteasome storage granule	probable	GO:0043234, GO:0005737, GO:0032991, GO:0044445, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0031597, GO:0044424, GO:0000502
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0016071 [BP]	mRNA metabolic process	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0006977 [BP]	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	probable	GO:0051726, GO:0044699, GO:0010948, GO:0044773, GO:0044774, GO:0007165, GO:0035556, GO:0072331, GO:0050789, GO:0072401, GO:0090068, GO:0051716, GO:2000134, GO:0031570, GO:0031571, GO:0072395, GO:0010564, GO:0071158, GO:0065007, GO:1901988, GO:0048518, GO:0048519, GO:0071156, GO:1901990, GO:0030330, GO:0008150, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0044763, GO:0023052, GO:0007154, GO:0072413, GO:0042770, GO:0044700, GO:0007049, GO:0000077, GO:2000045, GO:0000075, GO:0072431, GO:0022402, GO:0072422, GO:0033554, GO:1901991, GO:0044783, GO:0007093, GO:0050896, GO:0048523, GO:0048522
GO:0006521 [BP]	regulation of cellular amino acid metabolic process	probable	GO:0080090, GO:0019222, GO:0031323, GO:0010565, GO:0050794, GO:0033238, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0000932 [CC]	cytoplasmic mRNA processing body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0000084 [BP]	S phase of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0000082 [BP]	G1/S transition of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0010499 [BP]	proteasomal ubiquitin-independent protein catabolic process	probable	GO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0010498, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0044238, GO:0009057
GO:0000209 [BP]	protein polyubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0004298 [MF]	threonine-type endopeptidase activity	probable	GO:0016787, GO:0004175, GO:0003824, GO:0070003, GO:0070011, GO:0003674, GO:0008233
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0042981 [BP]	regulation of apoptotic process	probable	GO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000022 [BP]	mitotic spindle elongation	probable	GO:0006996, GO:0044699, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0000226, GO:0008150, GO:0007051, GO:0007052, GO:0022402, GO:0007049, GO:0044763, GO:0051231, GO:0016043
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000216 [BP]	M/G1 transition of mitotic cell cycle	probable
GO:0051437 [BP]	positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	probable	GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051439, GO:0051438, GO:0050789, GO:0007049, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044699, GO:0031398, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0043085, GO:0009987, GO:0000278, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0044763, GO:0032268, GO:0051443, GO:0022402, GO:0031401, GO:0051351, GO:0008150, GO:0044093, GO:0048522
GO:0051436 [BP]	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	probable	GO:0009892, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0022402, GO:0051438, GO:0043086, GO:0044699, GO:0051248, GO:0051340, GO:0010605, GO:0051246, GO:0050789, GO:0065007, GO:0007049, GO:0044092, GO:0031396, GO:0031397, GO:0065009, GO:0009987, GO:0000278, GO:0060255, GO:0051439, GO:0050790, GO:0050794, GO:0044763, GO:0048519, GO:0051444, GO:0032269, GO:0032268, GO:0031400, GO:0051352, GO:0008150, GO:0048523
GO:0002479 [BP]	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	probable	GO:0002474, GO:0019882, GO:0019884, GO:0002478, GO:0002376, GO:0042590, GO:0008150, GO:0048002
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0009615 [BP]	response to virus	probable	GO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0031145 [BP]	anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0010467 [BP]	gene expression	probable	GO:0071704, GO:0008150, GO:0008152, GO:0043170
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0016032 [BP]	viral reproduction	probable	GO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.4.-.-	Acting on peptide bonds (peptide hydrolases).	probable
3.4.25.-	Threonine endopeptidases.	probable
3.4.25.1	Transferred entry: 3.4.25.1.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IRU, chain B
Confidence level:very confident
Coverage over the Query: 1-110
View the alignment between query and template
View the model in PyMOL