Diaphorina citri psyllid: psy666


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
SWVPCTHPASVLQELQVLPVWYLSTTESQALRYDVIRFIVGVIHPTNELLCSDIIPRWAVIGWLLTSCTSPVVLANCKLALFYDWLCYDPEKDNIMNIDQIN
ccccccccccccccEEEEEEEcccccccccHHHHHEEEEEEECcccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccc
*WVPCTHPASVLQELQVLPVWYLSTTESQALRYDVIRFIVGVIHPTNELLCSDIIPRWAVIGWLLTSCTSPVVLANCKLALFYDWLCYDPEKDNIMNIDQI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SWVPCTHPASVLQELQVLPVWYLSTTESQALRYDVIRFIVGVIHPTNELLCSDIIPRWAVIGWLLTSCTSPVVLANCKLALFYDWLCYDPEKDNIMNIDQIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Integrator complex subunit 3 Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs). In the SOSS complex, it is required for the assembly of the complex and for stabilization of the complex at DNA damage sites.confidentQ1LXC9
Integrator complex subunit 3 homolog confidentQ7PRB8
Integrator complex subunit 3 Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. The SOSS complex is required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. In the SOSS complex, it is required for the assembly of the complex and for stabilization of the complex at DNA damage sites.confidentQ68E01

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016180 [BP]snRNA processingprobableGO:0016070, GO:0006139, GO:0016073, GO:0034470, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0034660, GO:0006396, GO:0046483
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0070876 [CC]SOSS complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0010212 [BP]response to ionizing radiationprobableGO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0032039 [CC]integrator complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0000075 [BP]cell cycle checkpointprobableGO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901988, GO:0048519, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted