Diaphorina citri psyllid: psy6673


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MQQEEKKSSSSQEEDIHSTEDVLALPDAGNIVKSLQTTLQEELLQRSLQNVALTLQTAMVSSLQQAALLPPNSPAAAALNLQALESYLTLHRLSSTVNSPQRVSNSNNNNNNNNNTTTKTALALADIDALGNIEDEVPDDLSTTKTALALADIDALGNIEDEVPDDLLETSSPETADLNLKTSLEFPAFPGETSYPSLLLYQPVSTASTPTKTIVTDSISKPVQKSTPVASTARPKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR
ccHHHcccccccHHHHccccccccccccccHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**********************LALPDAGNIVKSLQTTLQEELLQRSLQNVALT*QTAMVSSLQ****************LQALESYLTLHRLSSTVNSPQRVSNSNNNNNNNNNTTTKTALALADIDALGNIEDEVPDDLSTTKTALALADIDALGNIEDEVPDDLLETSSPETADLNLKTSLEFPAFP*ETSYPSLLLYQPVSTASTPTKTIVTDSISKPVQKSTPVASTARPKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHL**H*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQEEKKSSSSQEEDIHSTEDVLALPDAGNIVKSLQTTLQEELLQRSLQNVALTLQTAMVSSLQQAALLPPNSPAAAALNLQALESYLTLHRLSSTVNSPQRVSNSNNNNNNNNNTTTKTALALADIDALGNIEDEVPDDLSTTKTALALADIDALGNIEDEVPDDLLETSSPETADLNLKTSLEFPAFPGETSYPSLLLYQPVSTASTPTKTIVTDSISKPVQKSTPVASTARPKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048565 [BP]digestive tract developmentprobableGO:0032502, GO:0055123, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 212-286
View the alignment between query and template
View the model in PyMOL
Template: 2DLQ, chain A
Confidence level:very confident
Coverage over the Query: 191-286
View the alignment between query and template
View the model in PyMOL
Template: 1EJ6, chain B
Confidence level:probable
Coverage over the Query: 206-230
View the alignment between query and template
View the model in PyMOL