Query         psy6674
Match_columns 258
No_of_seqs    245 out of 1725
Neff          6.5 
Searched_HMMs 46136
Date          Sat Aug 17 00:12:45 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6674.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6674hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.5 3.4E-14 7.3E-19  127.1   6.6   49  210-258   187-235 (279)
  2 KOG2462|consensus               99.4 4.1E-14   9E-19  126.5   2.2   71  188-258   190-263 (279)
  3 KOG3623|consensus               99.3 4.9E-13 1.1E-17  131.9   0.6   75  184-258   893-970 (1007)
  4 KOG3623|consensus               99.1 3.2E-11 6.9E-16  119.3   1.7   51  208-258   279-329 (1007)
  5 PHA02768 hypothetical protein;  99.0 2.2E-10 4.8E-15   79.5   1.8   44  210-255     5-48  (55)
  6 KOG3576|consensus               99.0 1.1E-10 2.4E-15  100.8   0.3   73  185-257   117-192 (267)
  7 KOG1074|consensus               98.8 9.6E-10 2.1E-14  110.4   1.1   49  209-257   352-400 (958)
  8 KOG1074|consensus               98.8 1.3E-09 2.7E-14  109.5   1.5   50  209-258   604-653 (958)
  9 PF13465 zf-H2C2_2:  Zinc-finge  98.6   1E-08 2.2E-13   60.8   1.2   26  225-250     1-26  (26)
 10 PHA00733 hypothetical protein   98.5 5.3E-08 1.1E-12   79.2   3.2   51  206-258    69-119 (128)
 11 KOG3576|consensus               98.3 1.1E-06 2.3E-11   76.4   5.4   52  207-258   114-165 (267)
 12 PHA00616 hypothetical protein   98.2 3.3E-07 7.2E-12   60.9   0.4   39  210-248     1-39  (44)
 13 PHA00732 hypothetical protein   98.1 1.8E-06 3.9E-11   64.6   2.5   42  210-257     1-43  (79)
 14 COG5189 SFP1 Putative transcri  97.9 3.6E-06 7.8E-11   77.3   1.8   51  208-258   347-418 (423)
 15 KOG3993|consensus               97.8 4.7E-06   1E-10   78.9   0.7   48  211-258   296-376 (500)
 16 PF00096 zf-C2H2:  Zinc finger,  97.4 4.6E-05 9.9E-10   43.2   0.7   23  211-233     1-23  (23)
 17 KOG3608|consensus               97.3 9.8E-05 2.1E-09   68.9   2.2   48  210-257   263-311 (467)
 18 PHA00733 hypothetical protein   97.3 6.4E-05 1.4E-09   61.2   0.7   51  208-258    38-93  (128)
 19 PLN03086 PRLI-interacting fact  97.2 0.00014 3.1E-09   72.1   2.1   39  209-249   477-515 (567)
 20 PLN03086 PRLI-interacting fact  97.2 0.00017 3.7E-09   71.6   1.9   56  200-257   494-559 (567)
 21 PF05605 zf-Di19:  Drought indu  97.1 0.00026 5.7E-09   48.8   2.0   46  210-258     2-49  (54)
 22 PRK04860 hypothetical protein;  97.1 0.00022 4.7E-09   60.3   1.7   40  209-252   118-157 (160)
 23 KOG3608|consensus               97.0 0.00022 4.8E-09   66.6   1.2   49  209-257   176-226 (467)
 24 PF13894 zf-C2H2_4:  C2H2-type   96.8 0.00049 1.1E-08   38.5   1.1   23  211-233     1-23  (24)
 25 PF13912 zf-C2H2_6:  C2H2-type   96.6 0.00089 1.9E-08   39.2   1.2   26  210-235     1-26  (27)
 26 PF09237 GAGA:  GAGA factor;  I  96.5  0.0022 4.8E-08   43.9   2.5   35  204-238    18-52  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  96.5 0.00058 1.3E-08   38.5  -0.4   20  239-258     1-20  (23)
 28 PF12756 zf-C2H2_2:  C2H2 type   96.4 0.00096 2.1E-08   50.1   0.2   47  212-258     1-70  (100)
 29 smart00355 ZnF_C2H2 zinc finge  96.3  0.0023   5E-08   36.0   1.6   24  211-234     1-24  (26)
 30 PF13465 zf-H2C2_2:  Zinc-finge  96.1 0.00087 1.9E-08   39.4  -0.9   22  201-222     5-26  (26)
 31 PHA02768 hypothetical protein;  96.0  0.0021 4.5E-08   44.8   0.3   21  238-258     5-25  (55)
 32 PF13894 zf-C2H2_4:  C2H2-type   95.5  0.0034 7.4E-08   34.9  -0.1   20  239-258     1-20  (24)
 33 PHA00616 hypothetical protein   95.5  0.0027   6E-08   42.2  -0.7   21  238-258     1-21  (44)
 34 PF13912 zf-C2H2_6:  C2H2-type   95.3  0.0042 9.1E-08   36.3  -0.3   21  238-258     1-21  (27)
 35 COG5048 FOG: Zn-finger [Genera  95.0   0.013 2.9E-07   53.8   2.0   50  209-258   288-343 (467)
 36 PF12874 zf-met:  Zinc-finger o  94.5   0.014 3.1E-07   33.3   0.7   23  211-233     1-23  (25)
 37 COG5189 SFP1 Putative transcri  94.2   0.051 1.1E-06   50.5   3.9   25  207-231   395-419 (423)
 38 smart00355 ZnF_C2H2 zinc finge  94.0   0.019 4.2E-07   32.1   0.5   20  239-258     1-20  (26)
 39 PF12171 zf-C2H2_jaz:  Zinc-fin  94.0   0.025 5.5E-07   33.2   1.0   22  211-232     2-23  (27)
 40 KOG3993|consensus               94.0   0.011 2.4E-07   56.6  -1.0   48  211-258   268-315 (500)
 41 PF09237 GAGA:  GAGA factor;  I  92.5   0.038 8.2E-07   37.9   0.1   26  233-258    19-44  (54)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  92.4   0.084 1.8E-06   30.9   1.5   20  239-258     2-21  (27)
 43 PF13909 zf-H2C2_5:  C2H2-type   91.5   0.071 1.5E-06   30.2   0.5   23  211-234     1-23  (24)
 44 cd00350 rubredoxin_like Rubred  90.5    0.17 3.7E-06   31.3   1.5   24  211-246     2-25  (33)
 45 PF12874 zf-met:  Zinc-finger o  89.9   0.074 1.6E-06   30.2  -0.4   20  239-258     1-20  (25)
 46 PHA00732 hypothetical protein   88.4    0.18   4E-06   37.6   0.6   23  210-235    27-49  (79)
 47 smart00451 ZnF_U1 U1-like zinc  88.2    0.29 6.2E-06   29.9   1.4   24  209-232     2-25  (35)
 48 PF13913 zf-C2HC_2:  zinc-finge  87.7    0.32 6.8E-06   28.3   1.2   20  211-231     3-22  (25)
 49 PF09538 FYDLN_acid:  Protein o  86.4    0.48   1E-05   37.5   2.0   30  211-251    10-39  (108)
 50 KOG4124|consensus               86.0    0.28   6E-06   46.2   0.5   52  207-258   346-418 (442)
 51 COG1592 Rubrerythrin [Energy p  85.6    0.49 1.1E-05   40.3   1.7   24  210-246   134-157 (166)
 52 KOG1146|consensus               85.4    0.31 6.8E-06   52.7   0.6   51  208-258   463-538 (1406)
 53 COG5048 FOG: Zn-finger [Genera  85.4       1 2.2E-05   41.3   4.0   65  184-248   291-363 (467)
 54 PF12756 zf-C2H2_2:  C2H2 type   85.2    0.58 1.3E-05   34.7   1.9   24  210-233    50-73  (100)
 55 smart00451 ZnF_U1 U1-like zinc  84.8     0.4 8.6E-06   29.3   0.7   21  238-258     3-23  (35)
 56 smart00531 TFIIE Transcription  83.7    0.58 1.2E-05   38.7   1.4   39  207-249    96-134 (147)
 57 cd00729 rubredoxin_SM Rubredox  82.9    0.77 1.7E-05   28.7   1.4   25  210-246     2-26  (34)
 58 TIGR02300 FYDLN_acid conserved  82.0     1.1 2.5E-05   36.3   2.4   30  211-251    10-39  (129)
 59 COG4049 Uncharacterized protei  79.1    0.54 1.2E-05   32.9  -0.3   27  207-233    14-40  (65)
 60 TIGR02098 MJ0042_CXXC MJ0042 f  78.8     1.3 2.8E-05   27.8   1.4   34  211-249     3-36  (38)
 61 KOG2071|consensus               78.8     1.5 3.3E-05   43.9   2.6   27  207-233   415-441 (579)
 62 smart00834 CxxC_CXXC_SSSS Puta  77.5     1.1 2.4E-05   28.3   0.8   32  210-248     5-36  (41)
 63 PRK06266 transcription initiat  77.4     1.1 2.4E-05   38.3   1.1   34  208-250   115-148 (178)
 64 TIGR00373 conserved hypothetic  77.1       1 2.3E-05   37.7   0.8   34  207-249   106-139 (158)
 65 PRK09678 DNA-binding transcrip  76.4       1 2.3E-05   33.0   0.5   15  236-250    25-41  (72)
 66 PRK00398 rpoP DNA-directed RNA  76.1     1.1 2.4E-05   29.6   0.5   31  210-250     3-33  (46)
 67 PF14353 CpXC:  CpXC protein     75.6    0.45 9.8E-06   38.1  -1.7   12  239-250    39-50  (128)
 68 TIGR02605 CxxC_CxxC_SSSS putat  74.7     1.4   3E-05   29.6   0.8   29  211-246     6-34  (52)
 69 PF05443 ROS_MUCR:  ROS/MUCR tr  74.1     1.5 3.1E-05   36.0   0.9   27  209-238    71-97  (132)
 70 PF13719 zinc_ribbon_5:  zinc-r  74.0     2.4 5.3E-05   26.8   1.7   34  211-249     3-36  (37)
 71 KOG4167|consensus               73.3     3.1 6.7E-05   42.9   3.1   27  208-234   790-816 (907)
 72 smart00659 RPOLCX RNA polymera  72.5     2.6 5.7E-05   27.9   1.7   26  211-247     3-28  (44)
 73 COG3364 Zn-ribbon containing p  72.4       2 4.3E-05   33.7   1.2   31  210-250     2-33  (112)
 74 PF13717 zinc_ribbon_4:  zinc-r  71.5     3.3 7.2E-05   26.1   1.9   34  211-249     3-36  (36)
 75 PF05605 zf-Di19:  Drought indu  71.4     2.9 6.3E-05   28.4   1.8   26  207-234    28-53  (54)
 76 PF09723 Zn-ribbon_8:  Zinc rib  69.6     2.2 4.8E-05   27.7   0.8   29  211-246     6-34  (42)
 77 COG1997 RPL43A Ribosomal prote  69.4     2.5 5.4E-05   32.2   1.2   32  209-250    34-65  (89)
 78 PF05191 ADK_lid:  Adenylate ki  68.2     2.4 5.2E-05   26.9   0.7   33  211-251     2-34  (36)
 79 PF02892 zf-BED:  BED zinc fing  65.3     3.8 8.2E-05   26.5   1.3   24  208-231    14-41  (45)
 80 COG2888 Predicted Zn-ribbon RN  65.0     3.8 8.2E-05   29.0   1.3   33  209-246    26-58  (61)
 81 COG4530 Uncharacterized protei  64.7     3.4 7.5E-05   32.8   1.1   27  212-249    11-37  (129)
 82 smart00614 ZnF_BED BED zinc fi  62.8     4.8  0.0001   26.9   1.4   25  210-234    18-48  (50)
 83 COG1996 RPC10 DNA-directed RNA  62.4     4.1 8.8E-05   27.7   1.0   29  209-247     5-33  (49)
 84 PRK03824 hypA hydrogenase nick  60.4     4.4 9.6E-05   33.1   1.1   39  209-247    69-116 (135)
 85 COG1198 PriA Primosomal protei  58.6     5.6 0.00012   41.3   1.7   24  224-247   461-484 (730)
 86 KOG2593|consensus               58.3     5.6 0.00012   38.6   1.6   39  206-247   124-162 (436)
 87 COG4049 Uncharacterized protei  57.7     3.3 7.1E-05   29.1  -0.1   27  231-257    10-36  (65)
 88 COG4957 Predicted transcriptio  57.2     4.8  0.0001   33.2   0.8   25  211-238    77-101 (148)
 89 PRK12496 hypothetical protein;  56.0     5.8 0.00013   33.5   1.2   31  209-251   126-156 (164)
 90 COG1655 Uncharacterized protei  55.2     4.2 9.2E-05   36.4   0.2   38  208-245    17-69  (267)
 91 KOG2785|consensus               54.3     6.8 0.00015   37.5   1.4   49  210-258   166-240 (390)
 92 PF02176 zf-TRAF:  TRAF-type zi  54.3     6.2 0.00013   26.9   0.9   47  209-257     8-60  (60)
 93 PF15269 zf-C2H2_7:  Zinc-finge  54.0      17 0.00036   24.5   2.8   24  209-232    19-42  (54)
 94 PF03604 DNA_RNApol_7kD:  DNA d  53.7      11 0.00025   23.2   1.9   26  211-247     1-26  (32)
 95 PF01363 FYVE:  FYVE zinc finge  52.8       7 0.00015   27.6   1.0   27  211-249    10-36  (69)
 96 PRK14890 putative Zn-ribbon RN  52.3      11 0.00023   26.7   1.8   33  209-246    24-56  (59)
 97 PF10263 SprT-like:  SprT-like   52.0     5.2 0.00011   32.7   0.2   34  209-250   122-155 (157)
 98 KOG0978|consensus               50.3     7.6 0.00017   40.0   1.1   23  235-257   675-697 (698)
 99 COG3357 Predicted transcriptio  50.2     9.2  0.0002   29.4   1.3   28  209-246    57-84  (97)
100 PF09538 FYDLN_acid:  Protein o  48.9      13 0.00029   29.3   2.1   31  186-224    10-40  (108)
101 COG1571 Predicted DNA-binding   48.7      11 0.00024   36.6   1.9   28  212-250   352-379 (421)
102 TIGR01206 lysW lysine biosynth  48.6     7.9 0.00017   26.8   0.7   31  211-249     3-33  (54)
103 cd00730 rubredoxin Rubredoxin;  48.1      11 0.00024   25.6   1.3   35  211-246     2-42  (50)
104 PRK00464 nrdR transcriptional   46.9      12 0.00025   31.5   1.5   16  210-225    28-43  (154)
105 PRK04860 hypothetical protein;  46.7     4.3 9.4E-05   34.2  -1.1   38  186-224   120-157 (160)
106 PRK12380 hydrogenase nickel in  46.3      11 0.00023   29.8   1.2   26  209-246    69-94  (113)
107 PF10571 UPF0547:  Uncharacteri  46.2      16 0.00035   21.4   1.6   10  240-249    16-25  (26)
108 KOG4124|consensus               45.8      42 0.00091   32.1   5.1   26  206-231   394-419 (442)
109 cd00065 FYVE FYVE domain; Zinc  45.6      15 0.00034   24.6   1.8   13  210-222    18-30  (57)
110 PHA00626 hypothetical protein   45.6      12 0.00026   26.2   1.2   15  209-223    22-36  (59)
111 PTZ00255 60S ribosomal protein  45.4      11 0.00023   29.0   1.0   32  209-250    35-66  (90)
112 TIGR00100 hypA hydrogenase nic  45.1      11 0.00024   29.8   1.1   27  209-247    69-95  (115)
113 COG4888 Uncharacterized Zn rib  43.8      12 0.00026   29.3   1.0   38  208-249    20-57  (104)
114 PF00301 Rubredoxin:  Rubredoxi  43.6      17 0.00037   24.4   1.6   36  211-247     2-43  (47)
115 PF01927 Mut7-C:  Mut7-C RNAse   43.4      14 0.00031   30.3   1.6   19  210-228   124-142 (147)
116 PF07282 OrfB_Zn_ribbon:  Putat  43.3      16 0.00034   25.8   1.6   12  237-248    45-56  (69)
117 PF10013 DUF2256:  Uncharacteri  43.2      14  0.0003   24.3   1.1   16  212-227    10-25  (42)
118 PF12760 Zn_Tnp_IS1595:  Transp  43.0      13 0.00029   24.4   1.1   27  211-246    19-45  (46)
119 COG3091 SprT Zn-dependent meta  42.4      13 0.00029   31.2   1.2   37  207-248   114-150 (156)
120 KOG2482|consensus               42.1      14 0.00029   35.1   1.4   23  210-232   195-217 (423)
121 smart00064 FYVE Protein presen  42.0      18 0.00039   25.3   1.7   10  211-220    27-36  (68)
122 TIGR00280 L37a ribosomal prote  41.8      12 0.00025   28.8   0.7   32  209-250    34-65  (91)
123 PRK00564 hypA hydrogenase nick  41.8      14  0.0003   29.4   1.2   28  209-247    70-97  (117)
124 smart00734 ZnF_Rad18 Rad18-lik  40.7      15 0.00031   21.5   0.9    9  240-248     3-11  (26)
125 cd00924 Cyt_c_Oxidase_Vb Cytoc  40.5      11 0.00023   29.3   0.4   21  228-249    70-90  (97)
126 PRK05978 hypothetical protein;  40.3      16 0.00035   30.5   1.4   32  211-251    34-65  (148)
127 PLN02294 cytochrome c oxidase   40.3      11 0.00024   32.2   0.4   13  209-221   140-152 (174)
128 PRK03681 hypA hydrogenase nick  40.0      14  0.0003   29.3   0.9   28  209-247    69-96  (114)
129 PF01927 Mut7-C:  Mut7-C RNAse   38.9      22 0.00048   29.2   2.0   20  237-256   123-142 (147)
130 PF14379 Myb_CC_LHEQLE:  MYB-CC  37.3      77  0.0017   21.7   4.1   29   34-63     13-42  (51)
131 smart00440 ZnF_C2C2 C2C2 Zinc   36.8      12 0.00027   24.0   0.2   12  238-249    28-39  (40)
132 PF13240 zinc_ribbon_2:  zinc-r  36.7      21 0.00045   20.2   1.1    6  241-246    16-21  (23)
133 PF04959 ARS2:  Arsenite-resist  35.9      13 0.00028   32.9   0.2   22  236-257    75-96  (214)
134 PF01780 Ribosomal_L37ae:  Ribo  35.6      12 0.00025   28.7  -0.1   31  209-249    34-64  (90)
135 PF14446 Prok-RING_1:  Prokaryo  35.5      18 0.00039   25.1   0.8   11  212-222     7-17  (54)
136 TIGR02300 FYDLN_acid conserved  35.3      31 0.00067   28.2   2.2   34  186-227    10-43  (129)
137 PRK03976 rpl37ae 50S ribosomal  35.0      16 0.00035   28.0   0.6   32  209-250    35-66  (90)
138 PF12013 DUF3505:  Protein of u  34.9      21 0.00046   27.6   1.2   25  211-235    81-109 (109)
139 PF14311 DUF4379:  Domain of un  34.0      27 0.00059   23.6   1.5   28  210-244    28-55  (55)
140 PF04959 ARS2:  Arsenite-resist  32.9     9.6 0.00021   33.7  -1.1   24  209-232    76-99  (214)
141 PF01155 HypA:  Hydrogenase exp  32.6      20 0.00043   28.3   0.7   27  209-247    69-95  (113)
142 PF01096 TFIIS_C:  Transcriptio  32.5     7.1 0.00015   25.0  -1.5   10  239-248    29-38  (39)
143 TIGR00244 transcriptional regu  32.4      29 0.00062   29.0   1.7   19  208-226    26-44  (147)
144 COG3677 Transposase and inacti  31.5      33 0.00071   27.8   1.9   16  208-223    51-66  (129)
145 PF11494 Ta0938:  Ta0938;  Inte  31.5      31 0.00068   26.8   1.6   38  207-250    11-49  (105)
146 PRK05452 anaerobic nitric oxid  31.0      39 0.00084   33.3   2.6   41  206-247   421-467 (479)
147 KOG3408|consensus               30.8      20 0.00043   29.0   0.5   26  207-232    54-79  (129)
148 smart00731 SprT SprT homologue  30.8      27 0.00059   28.5   1.3   34  209-249   111-144 (146)
149 KOG4173|consensus               30.7     8.8 0.00019   33.9  -1.7   48  211-258   107-166 (253)
150 PTZ00303 phosphatidylinositol   30.7      32  0.0007   36.2   2.0   11  212-222   462-472 (1374)
151 PF10083 DUF2321:  Uncharacteri  30.5      24 0.00052   29.7   0.9   16  236-251    66-81  (158)
152 COG1327 Predicted transcriptio  30.3      32  0.0007   28.9   1.6   18  208-225    26-43  (156)
153 COG1656 Uncharacterized conser  29.6      42  0.0009   28.6   2.2   22  210-231   130-151 (165)
154 COG1675 TFA1 Transcription ini  29.4      28  0.0006   29.9   1.1   33  207-248   110-142 (176)
155 COG2331 Uncharacterized protei  29.4      11 0.00023   28.1  -1.2   35  209-250    11-45  (82)
156 PF01286 XPA_N:  XPA protein N-  29.3      26 0.00057   22.0   0.7   14  212-225     5-18  (34)
157 PF13824 zf-Mss51:  Zinc-finger  29.3      40 0.00088   23.5   1.7   10  209-218    13-22  (55)
158 PRK14559 putative protein seri  29.3      47   0.001   34.2   2.9   10  240-249    43-52  (645)
159 PRK04351 hypothetical protein;  29.1      26 0.00056   29.2   0.9   35  209-251   111-145 (149)
160 PF13453 zf-TFIIB:  Transcripti  29.0      27 0.00058   22.3   0.8   21  235-255    16-36  (41)
161 COG4306 Uncharacterized protei  28.9      32  0.0007   28.1   1.4   16  236-251    66-81  (160)
162 PRK00762 hypA hydrogenase nick  28.1      29 0.00063   27.8   1.0   32  209-246    69-100 (124)
163 KOG1146|consensus               28.0      22 0.00047   39.2   0.3   46  213-258   439-485 (1406)
164 PF10276 zf-CHCC:  Zinc-finger   27.9      21 0.00046   23.1   0.2   10  211-220    30-39  (40)
165 KOG2231|consensus               27.7      26 0.00056   36.1   0.8   45  211-258   100-169 (669)
166 smart00661 RPOL9 RNA polymeras  27.3      39 0.00085   22.2   1.4   12  210-221    20-31  (52)
167 PRK05580 primosome assembly pr  27.3      39 0.00084   34.8   2.0   24  224-247   407-430 (679)
168 PF07975 C1_4:  TFIIH C1-like d  27.0      27 0.00058   23.9   0.5   31  208-244    19-49  (51)
169 PRK03564 formate dehydrogenase  26.7      54  0.0012   30.7   2.6   18   23-40     25-42  (309)
170 COG4391 Uncharacterized protei  26.6      50  0.0011   23.5   1.9   41  206-250    20-60  (62)
171 PRK14873 primosome assembly pr  26.4      35 0.00076   35.2   1.5   11  237-247   421-431 (665)
172 PF08274 PhnA_Zn_Ribbon:  PhnA   26.2      29 0.00063   21.1   0.5   25  212-247     4-28  (30)
173 PF08271 TF_Zn_Ribbon:  TFIIB z  26.2      33 0.00072   22.0   0.8   10  237-246    18-27  (43)
174 COG1439 Predicted nucleic acid  26.1      32  0.0007   29.6   1.0   25  209-247   138-162 (177)
175 PF11672 DUF3268:  Protein of u  25.9      45 0.00097   26.1   1.7    9  210-218     2-10  (102)
176 COG0675 Transposase and inacti  25.7      36 0.00078   30.5   1.3   15  209-223   321-335 (364)
177 PHA02998 RNA polymerase subuni  25.4      30 0.00066   29.9   0.7   39  210-250   143-183 (195)
178 PF13878 zf-C2H2_3:  zinc-finge  25.3      45 0.00098   21.5   1.4   24  211-234    14-39  (41)
179 KOG4173|consensus               25.3      20 0.00044   31.7  -0.4   46  209-257    78-125 (253)
180 PF05129 Elf1:  Transcription e  25.1      16 0.00035   27.2  -0.9   40  208-251    20-59  (81)
181 PRK00432 30S ribosomal protein  25.1      44 0.00095   22.6   1.3   27  212-249    22-48  (50)
182 PF04810 zf-Sec23_Sec24:  Sec23  25.0      35 0.00077   21.7   0.8   31  211-247     3-33  (40)
183 PF07295 DUF1451:  Protein of u  24.1      38 0.00083   28.1   1.0   33  208-250   110-143 (146)
184 COG5236 Uncharacterized conser  23.9      35 0.00076   32.6   0.8   31  212-246   222-252 (493)
185 COG1779 C4-type Zn-finger prot  23.9      27 0.00059   30.6   0.1   37  211-249    15-54  (201)
186 TIGR00622 ssl1 transcription f  23.7 1.4E+02   0.003   23.8   4.1   32  208-245    79-110 (112)
187 PF09845 DUF2072:  Zn-ribbon co  23.6      41 0.00088   27.6   1.1   15  210-224     1-15  (131)
188 TIGR00595 priA primosomal prot  23.5      46   0.001   33.0   1.7   21  226-246   241-261 (505)
189 PF08684 ocr:  DNA mimic ocr;    23.0      94   0.002   23.9   2.9   29   17-45     62-90  (101)
190 PF05502 Dynactin_p62:  Dynacti  22.9      56  0.0012   32.4   2.1   66  184-249    25-97  (483)
191 TIGR00627 tfb4 transcription f  22.7      59  0.0013   29.9   2.1   26  209-248   254-279 (279)
192 PF03811 Zn_Tnp_IS1:  InsA N-te  22.7      45 0.00097   21.0   0.9   29  212-244     7-35  (36)
193 PRK14873 primosome assembly pr  22.6      40 0.00087   34.7   1.1   35  212-247   385-419 (665)
194 PF06220 zf-U1:  U1 zinc finger  22.5      53  0.0011   20.9   1.2   23  209-231     2-26  (38)
195 PF11789 zf-Nse:  Zinc-finger o  22.5      39 0.00084   23.4   0.6   31  209-243    23-53  (57)
196 smart00154 ZnF_AN1 AN1-like Zi  22.0      45 0.00097   21.3   0.8   15  238-252    12-26  (39)
197 COG3464 Transposase and inacti  21.8      45 0.00098   32.1   1.2   14  236-249    75-88  (402)
198 PF04216 FdhE:  Protein involve  21.8      17 0.00037   33.2  -1.7   19   23-41      8-26  (290)
199 KOG1280|consensus               21.8      62  0.0013   30.8   2.0   37  209-245    78-116 (381)
200 KOG4602|consensus               21.6 2.1E+02  0.0045   26.3   5.2   15  209-223   267-281 (318)
201 PRK14714 DNA polymerase II lar  21.4 1.2E+02  0.0027   33.6   4.3    8  239-246   710-717 (1337)
202 PF07754 DUF1610:  Domain of un  21.3      45 0.00097   19.3   0.6    8  210-217    16-23  (24)
203 PF11931 DUF3449:  Domain of un  21.2      32 0.00069   30.1   0.0   21  209-229   100-121 (196)
204 PF08790 zf-LYAR:  LYAR-type C2  20.6      43 0.00094   20.1   0.5   20  211-231     1-20  (28)
205 TIGR01385 TFSII transcription   20.3      43 0.00093   31.1   0.7   38  210-249   258-297 (299)
206 COG0068 HypF Hydrogenase matur  20.0      31 0.00067   35.8  -0.4   44  213-257   126-170 (750)
207 PF01428 zf-AN1:  AN1-like Zinc  20.0      34 0.00074   22.1  -0.1   16  237-252    12-27  (43)

No 1  
>KOG2462|consensus
Probab=99.49  E-value=3.4e-14  Score=127.08  Aligned_cols=49  Identities=41%  Similarity=0.821  Sum_probs=30.6

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      +++|.+|||.|.+.+-|+.|+|+|||||||.|+.|+|+|..+++|+.||
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHm  235 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHM  235 (279)
T ss_pred             CcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHH
Confidence            5566666666666666666666666666666666666666666666554


No 2  
>KOG2462|consensus
Probab=99.43  E-value=4.1e-14  Score=126.51  Aligned_cols=71  Identities=27%  Similarity=0.445  Sum_probs=63.8

Q ss_pred             cCCCCCCCC---CCCCCccCCCCCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         188 TDSISKPVQ---KSTPVASTARPKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       188 ~~~~~k~~~---~~~~~~~~~~~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      |..|+|.|.   -...|.+.|.|+|||.|..|+|+|..+++|+.||++|.+.|+|.|..|+|.|.+++.|.+|.
T Consensus       190 C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  190 CGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             cccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhh
Confidence            444555554   45889999999999999999999999999999999999999999999999999999999983


No 3  
>KOG3623|consensus
Probab=99.29  E-value=4.9e-13  Score=131.86  Aligned_cols=75  Identities=25%  Similarity=0.547  Sum_probs=65.2

Q ss_pred             cccccCCCCCCCCCCCCC---ccCCCCCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         184 KTIVTDSISKPVQKSTPV---ASTARPKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       184 ~~~~~~~~~k~~~~~~~~---~~~~~~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      -.+.|+.|.|.|.+....   +-.|.|++||+|.+|.|+|+++.+|..|+|.|.|+|||+|+-|+|+|+..+.+..||
T Consensus       893 gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  893 GMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             ccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            345677777777666544   445789999999999999999999999999999999999999999999999999887


No 4  
>KOG3623|consensus
Probab=99.08  E-value=3.2e-11  Score=119.30  Aligned_cols=51  Identities=29%  Similarity=0.654  Sum_probs=48.6

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      -+.|+|..|||+|+.+.+|+.|+|+|.|+|||.|+-|+|+|+..+.+..||
T Consensus       279 lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHm  329 (1007)
T KOG3623|consen  279 LRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHM  329 (1007)
T ss_pred             hccccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccc
Confidence            467999999999999999999999999999999999999999999998886


No 5  
>PHA02768 hypothetical protein; Provisional
Probab=98.97  E-value=2.2e-10  Score=79.52  Aligned_cols=44  Identities=18%  Similarity=0.431  Sum_probs=41.1

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhh
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLR  255 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~  255 (258)
                      .|.|+.||+.|....+|..|+++|+  ++|+|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4899999999999999999999998  8999999999999988764


No 6  
>KOG3576|consensus
Probab=98.97  E-value=1.1e-10  Score=100.81  Aligned_cols=73  Identities=30%  Similarity=0.625  Sum_probs=60.2

Q ss_pred             ccccCCCCCCCCCC---CCCccCCCCCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhc
Q psy6674         185 TIVTDSISKPVQKS---TPVASTARPKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       185 ~~~~~~~~k~~~~~---~~~~~~~~~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      .+.|..|.+.|.-.   ..+..-|..-|+|-|..|||.|.....|++|+|+|+|.|||+|..|+|+|.++..|..|
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            34566666665433   34444456678899999999999999999999999999999999999999999988776


No 7  
>KOG1074|consensus
Probab=98.82  E-value=9.6e-10  Score=110.37  Aligned_cols=49  Identities=41%  Similarity=0.889  Sum_probs=47.0

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      .+++|.+|+|.|...+.|+.|.|.|||+|||+|.+||.+|.++++|+.|
T Consensus       352 ~khkCr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTkGNLKvH  400 (958)
T KOG1074|consen  352 FKHKCRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTKGNLKVH  400 (958)
T ss_pred             ccchhhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccccceeee
Confidence            4578999999999999999999999999999999999999999999988


No 8  
>KOG1074|consensus
Probab=98.81  E-value=1.3e-09  Score=109.54  Aligned_cols=50  Identities=36%  Similarity=0.758  Sum_probs=48.2

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      .|.+|.+|-++...++.|+.|-|+|+|||||+|.+||++|.++++|+.||
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~  653 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHM  653 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcc
Confidence            46799999999999999999999999999999999999999999999997


No 9  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.64  E-value=1e-08  Score=60.79  Aligned_cols=26  Identities=54%  Similarity=0.997  Sum_probs=24.1

Q ss_pred             hhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         225 NLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       225 ~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      +|.+|+++|+|+|||.|+.|+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            48899999999999999999999974


No 10 
>PHA00733 hypothetical protein
Probab=98.54  E-value=5.3e-08  Score=79.21  Aligned_cols=51  Identities=33%  Similarity=0.638  Sum_probs=46.6

Q ss_pred             CCCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         206 RPKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       206 ~~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      .+.++|.|+.||+.|.....|..|++.|  .++|.|..|++.|.+...|.+|+
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~  119 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHV  119 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHH
Confidence            3578999999999999999999999987  46899999999999999999884


No 11 
>KOG3576|consensus
Probab=98.29  E-value=1.1e-06  Score=76.41  Aligned_cols=52  Identities=29%  Similarity=0.600  Sum_probs=48.6

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      ....|.|.+|+|.|....-|.+|++.|...|.|.|.+|||+|...-.|++|+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~  165 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHT  165 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhh
Confidence            3567999999999999999999999999999999999999999999999985


No 12 
>PHA00616 hypothetical protein
Probab=98.21  E-value=3.3e-07  Score=60.85  Aligned_cols=39  Identities=15%  Similarity=0.275  Sum_probs=34.7

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcc
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAF  248 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F  248 (258)
                      ||+|..||+.|..++.|..|++.|+|+++|.|+.--..|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~y~~f   39 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYFYIYF   39 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeEEEEEE
Confidence            689999999999999999999999999999998644434


No 13 
>PHA00732 hypothetical protein
Probab=98.10  E-value=1.8e-06  Score=64.59  Aligned_cols=42  Identities=40%  Similarity=0.785  Sum_probs=35.9

Q ss_pred             CcccCCCCcccCCchhhhhhhhh-cCCCCcccCCCCCCcccCchhhhhc
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERT-HTDERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~-HtgeKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      ||.|..||+.|.....|+.|++. |.   ++.|+.||+.|.+   +..|
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H   43 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQH   43 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhh
Confidence            58999999999999999999984 65   4689999999984   5555


No 14 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.94  E-value=3.6e-06  Score=77.29  Aligned_cols=51  Identities=29%  Similarity=0.802  Sum_probs=44.7

Q ss_pred             CCCcccCC--CCcccCCchhhhhhhhh-c------------------CCCCcccCCCCCCcccCchhhhhcC
Q psy6674         208 KKQFICRF--CSRHFTKSYNLLIHERT-H------------------TDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       208 ~kp~~C~~--Cgk~F~~~~~L~~H~r~-H------------------tgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      .|||+|++  |.|.|+....|+.|+.. |                  ...|||+|++|+|+|+....|+.|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            59999998  99999999999999873 3                  1239999999999999999999986


No 15 
>KOG3993|consensus
Probab=97.83  E-value=4.7e-06  Score=78.94  Aligned_cols=48  Identities=40%  Similarity=0.753  Sum_probs=42.6

Q ss_pred             cccCCCCcccCCchhhhhhhhhcC--------CCC-------------------------cccCCCCCCcccCchhhhhc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHT--------DER-------------------------PYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~Ht--------geK-------------------------pf~C~~Cgk~F~~~~~L~~H  257 (258)
                      |.|+.|+|+|+...+|..|+|+|.        |..                         .|.|.+|+|.|++...|+.|
T Consensus       296 YrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKH  375 (500)
T KOG3993|consen  296 YRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKH  375 (500)
T ss_pred             ecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHh
Confidence            999999999999999999999993        222                         38899999999999999998


Q ss_pred             C
Q psy6674         258 R  258 (258)
Q Consensus       258 ~  258 (258)
                      +
T Consensus       376 q  376 (500)
T KOG3993|consen  376 Q  376 (500)
T ss_pred             H
Confidence            4


No 16 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.43  E-value=4.6e-05  Score=43.15  Aligned_cols=23  Identities=35%  Similarity=0.777  Sum_probs=20.1

Q ss_pred             cccCCCCcccCCchhhhhhhhhc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTH  233 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~H  233 (258)
                      |.|+.|++.|..+..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999998865


No 17 
>KOG3608|consensus
Probab=97.35  E-value=9.8e-05  Score=68.91  Aligned_cols=48  Identities=27%  Similarity=0.709  Sum_probs=41.5

Q ss_pred             CcccCCCCcccCCchhhhhhhh-hcCCCCcccCCCCCCcccCchhhhhc
Q psy6674         210 QFICRFCSRHFTKSYNLLIHER-THTDERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r-~HtgeKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      .|+|+.|..+...++.|..|+| .|...|||+|+.|++.|.+...|.+|
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH  311 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKH  311 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHH
Confidence            3788888888888888888888 57888999999999999999988887


No 18 
>PHA00733 hypothetical protein
Probab=97.33  E-value=6.4e-05  Score=61.16  Aligned_cols=51  Identities=22%  Similarity=0.295  Sum_probs=41.8

Q ss_pred             CCCcccCCCCcccCCchhhhhh--hh---hcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIH--ER---THTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H--~r---~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      .+++.|.+|.+.|.....|..|  ++   .+.+.+||.|+.||+.|.....|..|+
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~   93 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHI   93 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHH
Confidence            5789999999998887777665  22   334589999999999999999998884


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.23  E-value=0.00014  Score=72.11  Aligned_cols=39  Identities=15%  Similarity=0.477  Sum_probs=26.8

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      +++.|+ ||+.| .+..|..|+++|.+.|++.|.+|++.|.
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~  515 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQ  515 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccc
Confidence            566777 77544 4566777777777777777777777764


No 20 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.17  E-value=0.00017  Score=71.63  Aligned_cols=56  Identities=21%  Similarity=0.478  Sum_probs=45.2

Q ss_pred             CCccCCCCCCCcccCCCCcccCC----------chhhhhhhhhcCCCCcccCCCCCCcccCchhhhhc
Q psy6674         200 PVASTARPKKQFICRFCSRHFTK----------SYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       200 ~~~~~~~~~kp~~C~~Cgk~F~~----------~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      .|...+-+.+++.|.+|++.|..          ...|..|+.++ |.+++.|..||+.|..++ |..|
T Consensus       494 ~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlrd-m~~H  559 (567)
T PLN03086        494 QHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLKE-MDIH  559 (567)
T ss_pred             hhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeeehh-HHHH
Confidence            34455678899999999999952          34799999986 999999999999998775 4444


No 21 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.13  E-value=0.00026  Score=48.81  Aligned_cols=46  Identities=26%  Similarity=0.659  Sum_probs=34.9

Q ss_pred             CcccCCCCcccCCchhhhhhhh-hcCCC-CcccCCCCCCcccCchhhhhcC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHER-THTDE-RPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r-~Htge-Kpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      .|.|++|++.|. ...|..|.. .|.++ +.+.|++|...+..  +|.+|+
T Consensus         2 ~f~CP~C~~~~~-~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~--~l~~Hl   49 (54)
T PF05605_consen    2 SFTCPYCGKGFS-ESSLVEHCEDEHRSESKNVVCPICSSRVTD--NLIRHL   49 (54)
T ss_pred             CcCCCCCCCccC-HHHHHHHHHhHCcCCCCCccCCCchhhhhh--HHHHHH
Confidence            489999999655 567999966 46654 67999999987553  677663


No 22 
>PRK04860 hypothetical protein; Provisional
Probab=97.12  E-value=0.00022  Score=60.26  Aligned_cols=40  Identities=20%  Similarity=0.531  Sum_probs=35.7

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCch
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQD  252 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~  252 (258)
                      -+|.|. |++   ....+.+|.++|+|+++|.|..|++.|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            579998 998   6778999999999999999999999987654


No 23 
>KOG3608|consensus
Probab=97.04  E-value=0.00022  Score=66.58  Aligned_cols=49  Identities=35%  Similarity=0.778  Sum_probs=42.2

Q ss_pred             CCcccCC--CCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhc
Q psy6674         209 KQFICRF--CSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       209 kp~~C~~--Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      ..+.|.|  |.+.|..++.|.+|.|+|+++|-..|+.||.-|+++..|..|
T Consensus       176 pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH  226 (467)
T KOG3608|consen  176 PVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDH  226 (467)
T ss_pred             ceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHH
Confidence            3467776  889999999999999999999999999999999988887766


No 24 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=96.85  E-value=0.00049  Score=38.53  Aligned_cols=23  Identities=39%  Similarity=0.785  Sum_probs=18.5

Q ss_pred             cccCCCCcccCCchhhhhhhhhc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTH  233 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~H  233 (258)
                      |.|++|++.|.....|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999998876


No 25 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=96.63  E-value=0.00089  Score=39.24  Aligned_cols=26  Identities=31%  Similarity=0.622  Sum_probs=23.0

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTD  235 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~Htg  235 (258)
                      +|.|..|++.|.....|..|++.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            58999999999999999999988753


No 26 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.49  E-value=0.0022  Score=43.89  Aligned_cols=35  Identities=20%  Similarity=0.380  Sum_probs=25.2

Q ss_pred             CCCCCCCcccCCCCcccCCchhhhhhhhhcCCCCc
Q psy6674         204 TARPKKQFICRFCSRHFTKSYNLLIHERTHTDERP  238 (258)
Q Consensus       204 ~~~~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKp  238 (258)
                      ......|..|++|+..+....+|++|+.++++.||
T Consensus        18 ~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            34456889999999999999999999998888886


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=96.45  E-value=0.00058  Score=38.49  Aligned_cols=20  Identities=35%  Similarity=0.974  Sum_probs=18.7

Q ss_pred             ccCCCCCCcccCchhhhhcC
Q psy6674         239 YSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       239 f~C~~Cgk~F~~~~~L~~H~  258 (258)
                      |.|+.|++.|.+...|..|+
T Consensus         1 y~C~~C~~~f~~~~~l~~H~   20 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHM   20 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHH
Confidence            78999999999999999985


No 28 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.38  E-value=0.00096  Score=50.14  Aligned_cols=47  Identities=32%  Similarity=0.780  Sum_probs=18.3

Q ss_pred             ccCCCCcccCCchhhhhhhhhcCC-----------------------CCcccCCCCCCcccCchhhhhcC
Q psy6674         212 ICRFCSRHFTKSYNLLIHERTHTD-----------------------ERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~L~~H~r~Htg-----------------------eKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      +|..|+..|.....|..|+....+                       ...+.|..|++.|.....|..|+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm   70 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHM   70 (100)
T ss_dssp             ------------------------------------------------SSEEBSSSS-EESSHHHHHHHH
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHH
Confidence            477777777777777777753211                       13588999999999999999885


No 29 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.32  E-value=0.0023  Score=36.04  Aligned_cols=24  Identities=33%  Similarity=0.555  Sum_probs=21.5

Q ss_pred             cccCCCCcccCCchhhhhhhhhcC
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHT  234 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~Ht  234 (258)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998775


No 30 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=96.14  E-value=0.00087  Score=39.44  Aligned_cols=22  Identities=23%  Similarity=0.661  Sum_probs=17.9

Q ss_pred             CccCCCCCCCcccCCCCcccCC
Q psy6674         201 VASTARPKKQFICRFCSRHFTK  222 (258)
Q Consensus       201 ~~~~~~~~kp~~C~~Cgk~F~~  222 (258)
                      +.+.|.+++||.|++|++.|..
T Consensus         5 H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    5 HMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHSSSSSEEESSSSEEESS
T ss_pred             HhhhcCCCCCCCCCCCcCeeCc
Confidence            3445778999999999999963


No 31 
>PHA02768 hypothetical protein; Provisional
Probab=95.99  E-value=0.0021  Score=44.81  Aligned_cols=21  Identities=19%  Similarity=0.698  Sum_probs=19.6

Q ss_pred             cccCCCCCCcccCchhhhhcC
Q psy6674         238 PYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       238 pf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      -|.|+.||+.|.+.++|.+||
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~   25 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHL   25 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHH
Confidence            489999999999999999996


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=95.52  E-value=0.0034  Score=34.95  Aligned_cols=20  Identities=40%  Similarity=1.052  Sum_probs=16.5

Q ss_pred             ccCCCCCCcccCchhhhhcC
Q psy6674         239 YSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       239 f~C~~Cgk~F~~~~~L~~H~  258 (258)
                      |.|++|++.|.....|..|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~   20 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHM   20 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHH
Confidence            78999999999999999884


No 33 
>PHA00616 hypothetical protein
Probab=95.46  E-value=0.0027  Score=42.20  Aligned_cols=21  Identities=29%  Similarity=0.695  Sum_probs=19.5

Q ss_pred             cccCCCCCCcccCchhhhhcC
Q psy6674         238 PYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       238 pf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      ||+|..||+.|.....|.+|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~   21 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHL   21 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHH
Confidence            799999999999999999984


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=95.25  E-value=0.0042  Score=36.30  Aligned_cols=21  Identities=43%  Similarity=1.073  Sum_probs=19.4

Q ss_pred             cccCCCCCCcccCchhhhhcC
Q psy6674         238 PYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       238 pf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      ||.|..|++.|.....|..|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~   21 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHK   21 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCccCCccCChhHHHHHh
Confidence            689999999999999999885


No 35 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.98  E-value=0.013  Score=53.85  Aligned_cols=50  Identities=36%  Similarity=0.715  Sum_probs=46.3

Q ss_pred             CCcccCCCCcccCCchhhhhhhh--hcCCC--CcccCC--CCCCcccCchhhhhcC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHER--THTDE--RPYSCD--VCNKAFRRQDHLRDHR  258 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r--~Htge--Kpf~C~--~Cgk~F~~~~~L~~H~  258 (258)
                      .++.|..|...|.....|.+|.+  .|+++  +||.|+  .|++.|.+...+.+|.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~  343 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHI  343 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCc
Confidence            47899999999999999999999  89999  999999  7999999999888773


No 36 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=94.54  E-value=0.014  Score=33.32  Aligned_cols=23  Identities=30%  Similarity=0.748  Sum_probs=19.9

Q ss_pred             cccCCCCcccCCchhhhhhhhhc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTH  233 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~H  233 (258)
                      |.|..|++.|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999998754


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=94.24  E-value=0.051  Score=50.50  Aligned_cols=25  Identities=20%  Similarity=0.615  Sum_probs=22.6

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhh
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHER  231 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r  231 (258)
                      ..|||.|++|+|.|+....|+.|+.
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCCceeccccchhhccCccceeccc
Confidence            4589999999999999999999964


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=94.00  E-value=0.019  Score=32.07  Aligned_cols=20  Identities=35%  Similarity=0.934  Sum_probs=18.1

Q ss_pred             ccCCCCCCcccCchhhhhcC
Q psy6674         239 YSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       239 f~C~~Cgk~F~~~~~L~~H~  258 (258)
                      |.|..|++.|.....|..|+
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~   20 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHM   20 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHH
Confidence            68999999999999998884


No 39 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=93.98  E-value=0.025  Score=33.19  Aligned_cols=22  Identities=27%  Similarity=0.667  Sum_probs=19.0

Q ss_pred             cccCCCCcccCCchhhhhhhhh
Q psy6674         211 FICRFCSRHFTKSYNLLIHERT  232 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~  232 (258)
                      |.|..|++.|.....+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999888874


No 40 
>KOG3993|consensus
Probab=93.97  E-value=0.011  Score=56.60  Aligned_cols=48  Identities=27%  Similarity=0.706  Sum_probs=42.6

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      |.|..|.-.|.....|..|.....-..-|+|++|+|-|+-..+|..|+
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHR  315 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHR  315 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhh
Confidence            999999999999999999977554456799999999999999998885


No 41 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=92.51  E-value=0.038  Score=37.92  Aligned_cols=26  Identities=31%  Similarity=0.747  Sum_probs=18.4

Q ss_pred             cCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         233 HTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       233 HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      +..+.|..|++|+..+++..+|++|+
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHl   44 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHL   44 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHH
T ss_pred             hccCCCCCCCcchhhccchhhHHHHH
Confidence            44678999999999999999999995


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=92.42  E-value=0.084  Score=30.92  Aligned_cols=20  Identities=35%  Similarity=0.963  Sum_probs=18.6

Q ss_pred             ccCCCCCCcccCchhhhhcC
Q psy6674         239 YSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       239 f~C~~Cgk~F~~~~~L~~H~  258 (258)
                      |-|..|++.|.....|..|+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCT
T ss_pred             CCcccCCCCcCCHHHHHHHH
Confidence            78999999999999999985


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=91.48  E-value=0.071  Score=30.20  Aligned_cols=23  Identities=30%  Similarity=0.543  Sum_probs=17.5

Q ss_pred             cccCCCCcccCCchhhhhhhhhcC
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHT  234 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~Ht  234 (258)
                      |.|..|+.... +..|..|++.|.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            68999998887 888999998764


No 44 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.52  E-value=0.17  Score=31.32  Aligned_cols=24  Identities=25%  Similarity=0.890  Sum_probs=19.1

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      |+|..||..+....            .++.|+.||.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            78999997765432            7899999985


No 45 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=89.91  E-value=0.074  Score=30.24  Aligned_cols=20  Identities=45%  Similarity=1.095  Sum_probs=18.1

Q ss_pred             ccCCCCCCcccCchhhhhcC
Q psy6674         239 YSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       239 f~C~~Cgk~F~~~~~L~~H~  258 (258)
                      |.|.+|++.|.....|..|+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~   20 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHL   20 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCCCcCCHHHHHHHH
Confidence            68999999999999998884


No 46 
>PHA00732 hypothetical protein
Probab=88.40  E-value=0.18  Score=37.59  Aligned_cols=23  Identities=22%  Similarity=0.433  Sum_probs=18.6

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTD  235 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~Htg  235 (258)
                      ++.|+.||+.|.   .+..|.+++.+
T Consensus        27 ~~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732         27 LTKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CCccCCCCCEeC---ChhhhhcccCC
Confidence            468999999998   58899876643


No 47 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=88.21  E-value=0.29  Score=29.93  Aligned_cols=24  Identities=25%  Similarity=0.610  Sum_probs=20.1

Q ss_pred             CCcccCCCCcccCCchhhhhhhhh
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERT  232 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~  232 (258)
                      .+|.|.+|++.|.....+..|+..
T Consensus         2 ~~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        2 GGFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             cCeEccccCCccCCHHHHHHHHCh
Confidence            358899999999988888888763


No 48 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=87.67  E-value=0.32  Score=28.28  Aligned_cols=20  Identities=35%  Similarity=0.723  Sum_probs=15.4

Q ss_pred             cccCCCCcccCCchhhhhhhh
Q psy6674         211 FICRFCSRHFTKSYNLLIHER  231 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r  231 (258)
                      ..|+.||+.| ....|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3688899988 6667888865


No 49 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=86.40  E-value=0.48  Score=37.49  Aligned_cols=30  Identities=27%  Similarity=0.695  Sum_probs=20.3

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQ  251 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~  251 (258)
                      ..|+.||+.|--   |        +..|-.|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYD---L--------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD---L--------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc---C--------CCCCccCCCCCCccCcc
Confidence            478888887733   2        24677788888777543


No 50 
>KOG4124|consensus
Probab=86.01  E-value=0.28  Score=46.21  Aligned_cols=52  Identities=29%  Similarity=0.768  Sum_probs=40.7

Q ss_pred             CCCCcccCC--CCcccCCchhhhhhhhh-c--------------CC----CCcccCCCCCCcccCchhhhhcC
Q psy6674         207 PKKQFICRF--CSRHFTKSYNLLIHERT-H--------------TD----ERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       207 ~~kp~~C~~--Cgk~F~~~~~L~~H~r~-H--------------tg----eKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      ..++|.|++  |.+.++....|+.|... |              +|    .|+|+|++|.++++-...|+.|+
T Consensus       346 ~~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  346 VDKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             ecCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            357899987  99999988888877542 2              22    48999999999998887777663


No 51 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=85.55  E-value=0.49  Score=40.26  Aligned_cols=24  Identities=29%  Similarity=0.888  Sum_probs=20.3

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      .|.|++||..             |.|+-|-.|++||.
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            6999999854             56788999999993


No 52 
>KOG1146|consensus
Probab=85.44  E-value=0.31  Score=52.68  Aligned_cols=51  Identities=29%  Similarity=0.596  Sum_probs=44.6

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhh-c------------------------CCCCcccCCCCCCcccCchhhhhcC
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERT-H------------------------TDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~-H------------------------tgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      .+.|+|+.|+..|+....|-.|+|. |                        -+.+||.|..|...|....+|-.|+
T Consensus       463 ~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihl  538 (1406)
T KOG1146|consen  463 FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHL  538 (1406)
T ss_pred             cccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHH
Confidence            3779999999999999999999997 2                        2248899999999999999998884


No 53 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=85.39  E-value=1  Score=41.27  Aligned_cols=65  Identities=20%  Similarity=0.257  Sum_probs=48.7

Q ss_pred             cccccCCCCCCCCCCCCCcc--CCCCC--CCcccC--CCCcccCCchhhhhhhhhcCCCCcccCCC--CCCcc
Q psy6674         184 KTIVTDSISKPVQKSTPVAS--TARPK--KQFICR--FCSRHFTKSYNLLIHERTHTDERPYSCDV--CNKAF  248 (258)
Q Consensus       184 ~~~~~~~~~k~~~~~~~~~~--~~~~~--kp~~C~--~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~--Cgk~F  248 (258)
                      .+..|............+..  .+..+  +++.|+  .|++.|.+...+..|...|++.+++.|..  |.+.+
T Consensus       291 ~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  363 (467)
T COG5048         291 KSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKF  363 (467)
T ss_pred             CCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccc
Confidence            34444444444444555555  67777  999999  79999999999999999999999998876  44443


No 54 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=85.22  E-value=0.58  Score=34.70  Aligned_cols=24  Identities=29%  Similarity=0.688  Sum_probs=21.5

Q ss_pred             CcccCCCCcccCCchhhhhhhhhc
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTH  233 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~H  233 (258)
                      .+.|.+|++.|.....|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            699999999999999999999965


No 55 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=84.78  E-value=0.4  Score=29.27  Aligned_cols=21  Identities=24%  Similarity=0.627  Sum_probs=18.3

Q ss_pred             cccCCCCCCcccCchhhhhcC
Q psy6674         238 PYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       238 pf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      +|.|++|++.|.....+..|+
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~   23 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHL   23 (35)
T ss_pred             CeEccccCCccCCHHHHHHHH
Confidence            588999999999888888773


No 56 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=83.66  E-value=0.58  Score=38.68  Aligned_cols=39  Identities=13%  Similarity=0.420  Sum_probs=26.6

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      ...-|.|+.|++.|.....+..   .+. ...|.|+.||....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEELE  134 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCEEE
Confidence            3456999999999986544432   111 33499999997653


No 57 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=82.93  E-value=0.77  Score=28.66  Aligned_cols=25  Identities=24%  Similarity=0.748  Sum_probs=18.6

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      .|.|..||..+...            +.|..|++||.
T Consensus         2 ~~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCCCcCcCCCC
Confidence            48999999765432            25789999995


No 58 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.04  E-value=1.1  Score=36.35  Aligned_cols=30  Identities=23%  Similarity=0.401  Sum_probs=17.6

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQ  251 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~  251 (258)
                      ..|+.||+.|--   |        +..|..|+.||..|...
T Consensus        10 r~Cp~cg~kFYD---L--------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD---L--------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc---c--------CCCCccCCCcCCccCcc
Confidence            467777766632   2        23566777777666433


No 59 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=79.10  E-value=0.54  Score=32.93  Aligned_cols=27  Identities=15%  Similarity=0.333  Sum_probs=22.1

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhhc
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERTH  233 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~H  233 (258)
                      ++--+.|+.||+.|.......+|...-
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKa   40 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKA   40 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHH
Confidence            556678999999999998888888743


No 60 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=78.78  E-value=1.3  Score=27.82  Aligned_cols=34  Identities=18%  Similarity=0.436  Sum_probs=23.8

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      +.|+.|+..|.-.....     ......+.|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCCCCEEECCCCCCEEE
Confidence            57999999887765432     12223588999998875


No 61 
>KOG2071|consensus
Probab=78.77  E-value=1.5  Score=43.87  Aligned_cols=27  Identities=22%  Similarity=0.336  Sum_probs=22.7

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhhc
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERTH  233 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~H  233 (258)
                      ...+..|..||.+|........||..|
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhh
Confidence            456789999999999998888777777


No 62 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=77.47  E-value=1.1  Score=28.35  Aligned_cols=32  Identities=16%  Similarity=0.491  Sum_probs=21.8

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcc
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAF  248 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F  248 (258)
                      .|.|..||+.|......      .. ...-.|+.||...
T Consensus         5 ~y~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~~~   36 (41)
T smart00834        5 EYRCEDCGHTFEVLQKI------SD-DPLATCPECGGDV   36 (41)
T ss_pred             EEEcCCCCCEEEEEEec------CC-CCCCCCCCCCCcc
Confidence            37899999988654322      11 4556899999743


No 63 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=77.40  E-value=1.1  Score=38.35  Aligned_cols=34  Identities=21%  Similarity=0.506  Sum_probs=26.4

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      ..-|.|+.|++.|+....+.         --|.|+.||.....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            35689999999998877653         36999999976543


No 64 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.12  E-value=1  Score=37.74  Aligned_cols=34  Identities=21%  Similarity=0.404  Sum_probs=26.9

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      ...-|.|+.|+..|+....+.         --|.|+.||....
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLD  139 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEee
Confidence            345689999999998887775         2699999997654


No 65 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=76.37  E-value=1  Score=33.04  Aligned_cols=15  Identities=33%  Similarity=0.676  Sum_probs=7.7

Q ss_pred             CCcccCC--CCCCcccC
Q psy6674         236 ERPYSCD--VCNKAFRR  250 (258)
Q Consensus       236 eKpf~C~--~Cgk~F~~  250 (258)
                      ++-+.|.  .||.+|..
T Consensus        25 ~~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         25 ERYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeeecCCCCCCCEEEE
Confidence            3445555  55555543


No 66 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=76.08  E-value=1.1  Score=29.59  Aligned_cols=31  Identities=16%  Similarity=0.370  Sum_probs=21.3

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      .|.|..||..|.....          ...+.|+.||..+..
T Consensus         3 ~y~C~~CG~~~~~~~~----------~~~~~Cp~CG~~~~~   33 (46)
T PRK00398          3 EYKCARCGREVELDEY----------GTGVRCPYCGYRILF   33 (46)
T ss_pred             EEECCCCCCEEEECCC----------CCceECCCCCCeEEE
Confidence            5889999987755321          126899999976543


No 67 
>PF14353 CpXC:  CpXC protein
Probab=75.59  E-value=0.45  Score=38.12  Aligned_cols=12  Identities=33%  Similarity=1.054  Sum_probs=7.3

Q ss_pred             ccCCCCCCcccC
Q psy6674         239 YSCDVCNKAFRR  250 (258)
Q Consensus       239 f~C~~Cgk~F~~  250 (258)
                      |.|+.||+.|.-
T Consensus        39 ~~CP~Cg~~~~~   50 (128)
T PF14353_consen   39 FTCPSCGHKFRL   50 (128)
T ss_pred             EECCCCCCceec
Confidence            566666666543


No 68 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=74.65  E-value=1.4  Score=29.57  Aligned_cols=29  Identities=17%  Similarity=0.553  Sum_probs=19.6

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      |.|..||..|......      +. ..+-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKM------SD-DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEec------CC-CCCCCCCCCCC
Confidence            7899999888754222      11 34567999985


No 69 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=74.06  E-value=1.5  Score=36.02  Aligned_cols=27  Identities=37%  Similarity=0.641  Sum_probs=17.5

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERP  238 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKp  238 (258)
                      ....|-+|||.|+.   |++|++.|.|.-|
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             CeeEEccCCcccch---HHHHHHHccCCCH
Confidence            34689999999976   6999999988644


No 70 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=74.02  E-value=2.4  Score=26.80  Aligned_cols=34  Identities=24%  Similarity=0.555  Sum_probs=24.2

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      ..|+.|+..|.-...-     +..+.+..+|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~-----l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK-----LPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHH-----cccCCcEEECCCCCcEee
Confidence            3689999888776532     223456789999998875


No 71 
>KOG4167|consensus
Probab=73.35  E-value=3.1  Score=42.86  Aligned_cols=27  Identities=33%  Similarity=0.500  Sum_probs=24.0

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhhcC
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERTHT  234 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~Ht  234 (258)
                      ..-|.|..|+|+|..-..+..||++|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            355999999999999999999999984


No 72 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=72.45  E-value=2.6  Score=27.88  Aligned_cols=26  Identities=23%  Similarity=0.569  Sum_probs=19.4

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      |.|..||..|...           ..-+.+|+.||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------SKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------CCCceECCCCCce
Confidence            7899999887644           2356789999854


No 73 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=72.45  E-value=2  Score=33.72  Aligned_cols=31  Identities=19%  Similarity=0.471  Sum_probs=20.6

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCC-CcccC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCN-KAFRR  250 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cg-k~F~~  250 (258)
                      ||.|..||+.|...+...          --.|+.|| ..|.+
T Consensus         2 pH~CtrCG~vf~~g~~~i----------l~GCp~CG~nkF~y   33 (112)
T COG3364           2 PHQCTRCGEVFDDGSEEI----------LSGCPKCGCNKFLY   33 (112)
T ss_pred             CceecccccccccccHHH----------HccCccccchheEe
Confidence            578999999998854322          12688887 44543


No 74 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=71.46  E-value=3.3  Score=26.08  Aligned_cols=34  Identities=18%  Similarity=0.458  Sum_probs=23.9

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      ..|+.|+..|.-....     +-.+.+..+|..|+..|.
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f~   36 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVFF   36 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEeC
Confidence            4688898888776543     223445688999998773


No 75 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=71.42  E-value=2.9  Score=28.42  Aligned_cols=26  Identities=31%  Similarity=0.594  Sum_probs=20.2

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhhcC
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERTHT  234 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~Ht  234 (258)
                      ..+.+.|++|...+.  .+|..|+..+.
T Consensus        28 ~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen   28 ESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            346799999998755  38999988654


No 76 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=69.57  E-value=2.2  Score=27.72  Aligned_cols=29  Identities=21%  Similarity=0.674  Sum_probs=21.3

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      |.|..||..|......      .. ..+-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSI------SE-DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEc------CC-CCCCcCCCCCC
Confidence            7899999988664322      22 46678999997


No 77 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=69.37  E-value=2.5  Score=32.18  Aligned_cols=32  Identities=25%  Similarity=0.697  Sum_probs=22.7

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      ..|.|+.|++.        .+.|+  +..-+.|.-||..|.-
T Consensus        34 ~~~~Cp~C~~~--------~VkR~--a~GIW~C~kCg~~fAG   65 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRI--ATGIWKCRKCGAKFAG   65 (89)
T ss_pred             cCCcCCCCCCc--------ceeee--ccCeEEcCCCCCeecc
Confidence            56899999875        22233  3456899999998864


No 78 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=68.21  E-value=2.4  Score=26.85  Aligned_cols=33  Identities=21%  Similarity=0.532  Sum_probs=21.6

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQ  251 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~  251 (258)
                      +.|+.||+.|....        .....+-.|+.||-.+.++
T Consensus         2 r~C~~Cg~~Yh~~~--------~pP~~~~~Cd~cg~~L~qR   34 (36)
T PF05191_consen    2 RICPKCGRIYHIEF--------NPPKVEGVCDNCGGELVQR   34 (36)
T ss_dssp             EEETTTTEEEETTT--------B--SSTTBCTTTTEBEBEE
T ss_pred             cCcCCCCCcccccc--------CCCCCCCccCCCCCeeEeC
Confidence            57899998875432        2245567899998766554


No 79 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=65.25  E-value=3.8  Score=26.46  Aligned_cols=24  Identities=33%  Similarity=0.610  Sum_probs=15.3

Q ss_pred             CCCcccCCCCcccCCc----hhhhhhhh
Q psy6674         208 KKQFICRFCSRHFTKS----YNLLIHER  231 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~----~~L~~H~r  231 (258)
                      .....|.+|++.+...    ++|.+|++
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            3557899999988775    67888883


No 80 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=64.95  E-value=3.8  Score=29.03  Aligned_cols=33  Identities=21%  Similarity=0.466  Sum_probs=22.2

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      -.|.|+.||..--.+.     .+-..-..+|.|+.||-
T Consensus        26 v~F~CPnCGe~~I~Rc-----~~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYRC-----AKCRKLGNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeehh-----hhHHHcCCceECCCcCc
Confidence            4589999997654432     22223357899999983


No 81 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.73  E-value=3.4  Score=32.85  Aligned_cols=27  Identities=19%  Similarity=0.294  Sum_probs=15.8

Q ss_pred             ccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         212 ICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      .|+.||+.|-.   |        ...|..|+.||+.|.
T Consensus        11 idPetg~KFYD---L--------NrdPiVsPytG~s~P   37 (129)
T COG4530          11 IDPETGKKFYD---L--------NRDPIVSPYTGKSYP   37 (129)
T ss_pred             cCccccchhhc---c--------CCCccccCcccccch
Confidence            56666666532   1        245666677776664


No 82 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=62.83  E-value=4.8  Score=26.93  Aligned_cols=25  Identities=32%  Similarity=0.739  Sum_probs=19.1

Q ss_pred             CcccCCCCcccCCc-----hhhhhhhh-hcC
Q psy6674         210 QFICRFCSRHFTKS-----YNLLIHER-THT  234 (258)
Q Consensus       210 p~~C~~Cgk~F~~~-----~~L~~H~r-~Ht  234 (258)
                      .-.|.+|++.+...     ++|.+|++ .|.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            34899999988766     57888887 453


No 83 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=62.44  E-value=4.1  Score=27.75  Aligned_cols=29  Identities=21%  Similarity=0.600  Sum_probs=19.8

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      ..|.|..||+.|..          -.......|+.||.+
T Consensus         5 ~~Y~C~~Cg~~~~~----------~~~~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVEL----------DQETRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeeh----------hhccCceeCCCCCcE
Confidence            45889999998821          113456789999853


No 84 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=60.38  E-value=4.4  Score=33.10  Aligned_cols=39  Identities=21%  Similarity=0.392  Sum_probs=22.7

Q ss_pred             CCcccCCCCcccCCch---hh------hhhhhhcCCCCcccCCCCCCc
Q psy6674         209 KQFICRFCSRHFTKSY---NL------LIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~---~L------~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      ..|.|..||..|....   .|      ..|..--+...-+.|+.||..
T Consensus        69 ~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~  116 (135)
T PRK03824         69 AVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGSR  116 (135)
T ss_pred             eEEECCCCCCEEecccccccccccccccccccccccccCcCCcCCCCC
Confidence            5689999998886641   11      111111112345789999954


No 85 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=58.61  E-value=5.6  Score=41.33  Aligned_cols=24  Identities=25%  Similarity=0.335  Sum_probs=17.3

Q ss_pred             hhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         224 YNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       224 ~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      ..|..|..-|....|+.|+.||..
T Consensus       461 ~~L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         461 GQLRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             CeeEeCCCCCCCCCCCCCCCCCCC
Confidence            345556555667789999999964


No 86 
>KOG2593|consensus
Probab=58.33  E-value=5.6  Score=38.61  Aligned_cols=39  Identities=15%  Similarity=0.494  Sum_probs=27.6

Q ss_pred             CCCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         206 RPKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       206 ~~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      .....|.|+.|.+.|+....+.   ..-...--|.|..|+-.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHHH---hhcccCceEEEecCCCc
Confidence            4557799999999998766554   22223456999999853


No 87 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=57.68  E-value=3.3  Score=29.08  Aligned_cols=27  Identities=30%  Similarity=0.580  Sum_probs=23.5

Q ss_pred             hhcCCCCcccCCCCCCcccCchhhhhc
Q psy6674         231 RTHTDERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       231 r~HtgeKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      +...|+.-+.|+-||.-|++...+.+|
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RH   36 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRH   36 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHH
Confidence            456789999999999999998888877


No 88 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=57.22  E-value=4.8  Score=33.17  Aligned_cols=25  Identities=32%  Similarity=0.426  Sum_probs=21.4

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERP  238 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKp  238 (258)
                      ..|-+|||.|+.   |++|+.+|.|.-|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            479999999964   9999999988755


No 89 
>PRK12496 hypothetical protein; Provisional
Probab=55.97  E-value=5.8  Score=33.47  Aligned_cols=31  Identities=19%  Similarity=0.748  Sum_probs=20.7

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQ  251 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~  251 (258)
                      +.|.|.-|++.|....            ..-.|+.||..-.++
T Consensus       126 w~~~C~gC~~~~~~~~------------~~~~C~~CG~~~~r~  156 (164)
T PRK12496        126 WRKVCKGCKKKYPEDY------------PDDVCEICGSPVKRK  156 (164)
T ss_pred             eeEECCCCCccccCCC------------CCCcCCCCCChhhhc
Confidence            5688999999886421            112699999654443


No 90 
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.22  E-value=4.2  Score=36.43  Aligned_cols=38  Identities=24%  Similarity=0.416  Sum_probs=28.6

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhhcCCCCc---------------ccCCCCC
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERTHTDERP---------------YSCDVCN  245 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKp---------------f~C~~Cg  245 (258)
                      ++.+.|++|+..|..+..+..-.|+-.|.-.               ..|+.|+
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~   69 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICY   69 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhh
Confidence            4678999999999988777777776555422               2699998


No 91 
>KOG2785|consensus
Probab=54.33  E-value=6.8  Score=37.45  Aligned_cols=49  Identities=22%  Similarity=0.393  Sum_probs=38.2

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCC-----------------------CcccCCCCC---CcccCchhhhhcC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDE-----------------------RPYSCDVCN---KAFRRQDHLRDHR  258 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~Htge-----------------------Kpf~C~~Cg---k~F~~~~~L~~H~  258 (258)
                      |-.|-+|++.|..-.....||-.|+|-                       +-|.|-.|.   +.|......+.||
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM  240 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHM  240 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHH
Confidence            347888888888888888888877652                       446788888   8888888888886


No 92 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=54.27  E-value=6.2  Score=26.86  Aligned_cols=47  Identities=23%  Similarity=0.516  Sum_probs=30.0

Q ss_pred             CCcccCC--CCcccCCchhhhhhhhhcCCCCcccCCC----CCCcccCchhhhhc
Q psy6674         209 KQFICRF--CSRHFTKSYNLLIHERTHTDERPYSCDV----CNKAFRRQDHLRDH  257 (258)
Q Consensus       209 kp~~C~~--Cgk~F~~~~~L~~H~r~HtgeKpf~C~~----Cgk~F~~~~~L~~H  257 (258)
                      .+..|+.  |...+. +..|..|....-..++..|.+    |+..|.+. .|..|
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~~-~l~~H   60 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVPRE-DLEEH   60 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEEHH-HHHHC
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccchh-HHhCC
Confidence            4567887  445454 557999999777788999999    99887764 34444


No 93 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=54.03  E-value=17  Score=24.47  Aligned_cols=24  Identities=17%  Similarity=0.329  Sum_probs=19.8

Q ss_pred             CCcccCCCCcccCCchhhhhhhhh
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERT  232 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~  232 (258)
                      -.|+|-.|.-+...+++|-.||+-
T Consensus        19 ~~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   19 FKYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ccceeecCCcccchHHHHHHHHHH
Confidence            347899999899999999999863


No 94 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=53.73  E-value=11  Score=23.19  Aligned_cols=26  Identities=23%  Similarity=0.655  Sum_probs=16.4

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      |.|..||..+...           ..-+.+|..||.+
T Consensus         1 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~R   26 (32)
T PF03604_consen    1 YICGECGAEVELK-----------PGDPIRCPECGHR   26 (32)
T ss_dssp             EBESSSSSSE-BS-----------TSSTSSBSSSS-S
T ss_pred             CCCCcCCCeeEcC-----------CCCcEECCcCCCe
Confidence            6788888877622           1245688888854


No 95 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=52.78  E-value=7  Score=27.56  Aligned_cols=27  Identities=22%  Similarity=0.565  Sum_probs=11.0

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      -.|..|++.|..            ..+.+.|..||..|-
T Consensus        10 ~~C~~C~~~F~~------------~~rrhhCr~CG~~vC   36 (69)
T PF01363_consen   10 SNCMICGKKFSL------------FRRRHHCRNCGRVVC   36 (69)
T ss_dssp             SB-TTT--B-BS------------SS-EEE-TTT--EEE
T ss_pred             CcCcCcCCcCCC------------ceeeEccCCCCCEEC
Confidence            367778777743            134566777776653


No 96 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=52.32  E-value=11  Score=26.73  Aligned_cols=33  Identities=24%  Similarity=0.674  Sum_probs=21.5

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      -.|.|+.||+.--.+     -.+-..-..+|.|+.||-
T Consensus        24 ~~F~CPnCG~~~I~R-----C~~CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYR-----CEKCRKQSNPYTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEee-----chhHHhcCCceECCCCCC
Confidence            458999999862222     222223357899999984


No 97 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=52.03  E-value=5.2  Score=32.67  Aligned_cols=34  Identities=24%  Similarity=0.754  Sum_probs=23.4

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      -.|.|..|+..+..      |.++  ..+.|.|..|+..|..
T Consensus       122 ~~~~C~~C~~~~~r------~~~~--~~~~~~C~~C~~~l~~  155 (157)
T PF10263_consen  122 YVYRCPSCGREYKR------HRRS--KRKRYRCGRCGGPLVQ  155 (157)
T ss_pred             eEEEcCCCCCEeee------eccc--chhhEECCCCCCEEEE
Confidence            46899999987633      3333  3344999999977653


No 98 
>KOG0978|consensus
Probab=50.29  E-value=7.6  Score=40.01  Aligned_cols=23  Identities=39%  Similarity=0.661  Sum_probs=18.0

Q ss_pred             CCCcccCCCCCCcccCchhhhhc
Q psy6674         235 DERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       235 geKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      +-|--+||.|+.+|.-.+.+.-|
T Consensus       675 etRqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  675 ETRQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             HHhcCCCCCCCCCCCcccccccC
Confidence            34555899999999988777665


No 99 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=50.19  E-value=9.2  Score=29.42  Aligned_cols=28  Identities=21%  Similarity=0.637  Sum_probs=20.3

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      +|-.|..||..|... -         -.+|-+|+.|..
T Consensus        57 ~Pa~CkkCGfef~~~-~---------ik~pSRCP~CKS   84 (97)
T COG3357          57 RPARCKKCGFEFRDD-K---------IKKPSRCPKCKS   84 (97)
T ss_pred             cChhhcccCcccccc-c---------cCCcccCCcchh
Confidence            567899999888762 1         136888999864


No 100
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=48.86  E-value=13  Score=29.30  Aligned_cols=31  Identities=16%  Similarity=0.253  Sum_probs=21.1

Q ss_pred             cccCCCCCCCCCCCCCccCCCCCCCcccCCCCcccCCch
Q psy6674         186 IVTDSISKPVQKSTPVASTARPKKQFICRFCSRHFTKSY  224 (258)
Q Consensus       186 ~~~~~~~k~~~~~~~~~~~~~~~kp~~C~~Cgk~F~~~~  224 (258)
                      .+|..|++.|--.        ++.|-.|++||..|.-..
T Consensus        10 R~Cp~CG~kFYDL--------nk~PivCP~CG~~~~~~~   40 (108)
T PF09538_consen   10 RTCPSCGAKFYDL--------NKDPIVCPKCGTEFPPEP   40 (108)
T ss_pred             ccCCCCcchhccC--------CCCCccCCCCCCccCccc
Confidence            3566666655332        236789999999998773


No 101
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=48.70  E-value=11  Score=36.60  Aligned_cols=28  Identities=18%  Similarity=0.637  Sum_probs=16.5

Q ss_pred             ccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         212 ICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      .|+.||......           |..-|+|+-||.++..
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~  379 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARE  379 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCc
Confidence            577777554332           3336777777766654


No 102
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=48.59  E-value=7.9  Score=26.82  Aligned_cols=31  Identities=23%  Similarity=0.446  Sum_probs=20.7

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      |.|+.||..+.-....       .|+ ...|+.||..|.
T Consensus         3 ~~CP~CG~~iev~~~~-------~Ge-iV~Cp~CGaele   33 (54)
T TIGR01206         3 FECPDCGAEIELENPE-------LGE-LVICDECGAELE   33 (54)
T ss_pred             cCCCCCCCEEecCCCc-------cCC-EEeCCCCCCEEE
Confidence            6899999876443222       133 468999997663


No 103
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=48.07  E-value=11  Score=25.62  Aligned_cols=35  Identities=17%  Similarity=0.438  Sum_probs=20.0

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCC------CCcccCCCCCC
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTD------ERPYSCDVCNK  246 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~Htg------eKpf~C~~Cgk  246 (258)
                      |+|..||..|.-...-..+ .+-.|      ...|.|+.|+.
T Consensus         2 y~C~~CgyiYd~~~Gd~~~-~i~pGt~f~~Lp~~w~CP~C~a   42 (50)
T cd00730           2 YECRICGYIYDPAEGDPDE-GIPPGTPFEDLPDDWVCPVCGA   42 (50)
T ss_pred             cCCCCCCeEECCCCCCccc-CcCCCCCHhHCCCCCCCCCCCC
Confidence            7899999888754221111 11111      23478999984


No 104
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=46.92  E-value=12  Score=31.51  Aligned_cols=16  Identities=25%  Similarity=0.463  Sum_probs=10.6

Q ss_pred             CcccCCCCcccCCchh
Q psy6674         210 QFICRFCSRHFTKSYN  225 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~  225 (258)
                      .++|+-||+.|..--.
T Consensus        28 ~~~c~~c~~~f~~~e~   43 (154)
T PRK00464         28 RRECLACGKRFTTFER   43 (154)
T ss_pred             eeeccccCCcceEeEe
Confidence            3777777777765543


No 105
>PRK04860 hypothetical protein; Provisional
Probab=46.67  E-value=4.3  Score=34.24  Aligned_cols=38  Identities=11%  Similarity=0.124  Sum_probs=27.4

Q ss_pred             cccCCCCCCCCCCCCCccCCCCCCCcccCCCCcccCCch
Q psy6674         186 IVTDSISKPVQKSTPVASTARPKKQFICRFCSRHFTKSY  224 (258)
Q Consensus       186 ~~~~~~~k~~~~~~~~~~~~~~~kp~~C~~Cgk~F~~~~  224 (258)
                      +.|. |.........+.+.+.++++|.|..|+..|....
T Consensus       120 Y~C~-C~~~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        120 YRCK-CQEHQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEcC-CCCeeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            4454 5554445566677788899999999999887543


No 106
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=46.26  E-value=11  Score=29.83  Aligned_cols=26  Identities=23%  Similarity=0.400  Sum_probs=18.1

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      ..+.|..||..|....            ..|.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             cEEEcccCCCEEecCC------------cCccCcCCCC
Confidence            4578999997775532            3456999984


No 107
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=46.24  E-value=16  Score=21.40  Aligned_cols=10  Identities=30%  Similarity=0.763  Sum_probs=6.1

Q ss_pred             cCCCCCCccc
Q psy6674         240 SCDVCNKAFR  249 (258)
Q Consensus       240 ~C~~Cgk~F~  249 (258)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5666666653


No 108
>KOG4124|consensus
Probab=45.82  E-value=42  Score=32.05  Aligned_cols=26  Identities=23%  Similarity=0.556  Sum_probs=21.8

Q ss_pred             CCCCCcccCCCCcccCCchhhhhhhh
Q psy6674         206 RPKKQFICRFCSRHFTKSYNLLIHER  231 (258)
Q Consensus       206 ~~~kp~~C~~Cgk~F~~~~~L~~H~r  231 (258)
                      ...|+|.|++|.+.++....|+.|..
T Consensus       394 ~~nk~~r~~i~~~~~k~~~~l~~~~~  419 (442)
T KOG4124|consen  394 VENKPYRCEVCSKRYKNLNGLKYHRT  419 (442)
T ss_pred             eccCcccChhhhhhhccCCCCCceee
Confidence            35689999999999999888887754


No 109
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=45.63  E-value=15  Score=24.59  Aligned_cols=13  Identities=38%  Similarity=0.854  Sum_probs=6.5

Q ss_pred             CcccCCCCcccCC
Q psy6674         210 QFICRFCSRHFTK  222 (258)
Q Consensus       210 p~~C~~Cgk~F~~  222 (258)
                      .+.|..||+.|-.
T Consensus        18 k~~Cr~Cg~~~C~   30 (57)
T cd00065          18 RHHCRNCGRIFCS   30 (57)
T ss_pred             ccccCcCcCCcCh
Confidence            3455555555433


No 110
>PHA00626 hypothetical protein
Probab=45.60  E-value=12  Score=26.23  Aligned_cols=15  Identities=20%  Similarity=0.587  Sum_probs=9.1

Q ss_pred             CCcccCCCCcccCCc
Q psy6674         209 KQFICRFCSRHFTKS  223 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~  223 (258)
                      ..|.|..||..|+..
T Consensus        22 nrYkCkdCGY~ft~~   36 (59)
T PHA00626         22 DDYVCCDCGYNDSKD   36 (59)
T ss_pred             cceEcCCCCCeechh
Confidence            456666666666543


No 111
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=45.43  E-value=11  Score=28.98  Aligned_cols=32  Identities=25%  Similarity=0.703  Sum_probs=21.6

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      ..|.|++||+.--.+          .+...+.|..|++.|.-
T Consensus        35 a~y~CpfCgk~~vkR----------~a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         35 AKYFCPFCGKHAVKR----------QAVGIWRCKGCKKTVAG   66 (90)
T ss_pred             CCccCCCCCCCceee----------eeeEEEEcCCCCCEEeC
Confidence            568999998642111          13356899999988754


No 112
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=45.12  E-value=11  Score=29.81  Aligned_cols=27  Identities=22%  Similarity=0.572  Sum_probs=18.9

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      ..+.|..||+.|.....            .|.|+.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (115)
T TIGR00100        69 VECECEDCSEEVSPEID------------LYRCPKCHGI   95 (115)
T ss_pred             cEEEcccCCCEEecCCc------------CccCcCCcCC
Confidence            45789999987765422            3679999853


No 113
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=43.77  E-value=12  Score=29.31  Aligned_cols=38  Identities=21%  Similarity=0.428  Sum_probs=23.8

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      ++.|.|+.||+.-.....++.-    .+.--..|..||.+|-
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~----~~~g~~~Cg~CGls~e   57 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKT----VNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CceEecCccCCeeeeEEEEEec----CceeEEEcccCcceEE
Confidence            4679999999765443333211    1223457999998874


No 114
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=43.61  E-value=17  Score=24.40  Aligned_cols=36  Identities=14%  Similarity=0.393  Sum_probs=19.7

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCC------CCcccCCCCCCc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTD------ERPYSCDVCNKA  247 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~Htg------eKpf~C~~Cgk~  247 (258)
                      |+|.+||..|.-...-..+ .+..|      ...|.|+.|+..
T Consensus         2 y~C~~CgyvYd~~~Gd~~~-~i~pGt~F~~Lp~~w~CP~C~a~   43 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPEN-GIPPGTPFEDLPDDWVCPVCGAP   43 (47)
T ss_dssp             EEETTTSBEEETTTBBGGG-TB-TT--GGGS-TT-B-TTTSSB
T ss_pred             cCCCCCCEEEcCCcCCccc-CcCCCCCHHHCCCCCcCcCCCCc
Confidence            7899999887665433222 11111      244889999853


No 115
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=43.44  E-value=14  Score=30.30  Aligned_cols=19  Identities=11%  Similarity=0.240  Sum_probs=11.6

Q ss_pred             CcccCCCCcccCCchhhhh
Q psy6674         210 QFICRFCSRHFTKSYNLLI  228 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~  228 (258)
                      -|.|+.|||.|-..++..+
T Consensus       124 f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             EEECCCCCCEecccccHHH
Confidence            4566666666666655544


No 116
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=43.28  E-value=16  Score=25.77  Aligned_cols=12  Identities=25%  Similarity=0.786  Sum_probs=6.2

Q ss_pred             CcccCCCCCCcc
Q psy6674         237 RPYSCDVCNKAF  248 (258)
Q Consensus       237 Kpf~C~~Cgk~F  248 (258)
                      +-|.|+.||..+
T Consensus        45 r~~~C~~Cg~~~   56 (69)
T PF07282_consen   45 RVFTCPNCGFEM   56 (69)
T ss_pred             ceEEcCCCCCEE
Confidence            445555555443


No 117
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=43.19  E-value=14  Score=24.32  Aligned_cols=16  Identities=38%  Similarity=0.684  Sum_probs=10.9

Q ss_pred             ccCCCCcccCCchhhh
Q psy6674         212 ICRFCSRHFTKSYNLL  227 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~L~  227 (258)
                      .|.+||+.|..+.-..
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            6777777777765444


No 118
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=42.99  E-value=13  Score=24.37  Aligned_cols=27  Identities=37%  Similarity=0.965  Sum_probs=17.3

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      +.|+.||..  ....+.       +...|+|..|++
T Consensus        19 ~~CP~Cg~~--~~~~~~-------~~~~~~C~~C~~   45 (46)
T PF12760_consen   19 FVCPHCGST--KHYRLK-------TRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCe--eeEEeC-------CCCeEECCCCCC
Confidence            679999864  222222       157789988875


No 119
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=42.44  E-value=13  Score=31.20  Aligned_cols=37  Identities=22%  Similarity=0.647  Sum_probs=27.5

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcc
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAF  248 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F  248 (258)
                      ...+|.|. |+..|-+.   .+|-.+-.|+ -|.|..|+...
T Consensus       114 ~~~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gkL  150 (156)
T COG3091         114 TTYPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGKL  150 (156)
T ss_pred             cceeEEee-cCCccchh---hhcccccccc-eEEeccCCceE
Confidence            34679999 99887653   4666666677 89999998654


No 120
>KOG2482|consensus
Probab=42.13  E-value=14  Score=35.13  Aligned_cols=23  Identities=26%  Similarity=0.612  Sum_probs=21.3

Q ss_pred             CcccCCCCcccCCchhhhhhhhh
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERT  232 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~  232 (258)
                      .+.|-+|.|.|+.+..|+.|||.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            48999999999999999999984


No 121
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=41.82  E-value=12  Score=28.84  Aligned_cols=32  Identities=22%  Similarity=0.731  Sum_probs=21.3

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      ..|.|++||+.--.+          .+-..+.|..|++.|.-
T Consensus        34 a~y~CpfCgk~~vkR----------~a~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        34 AKYVCPFCGKKTVKR----------GSTGIWTCRKCGAKFAG   65 (91)
T ss_pred             cCccCCCCCCCceEE----------EeeEEEEcCCCCCEEeC
Confidence            568999998642111          13356899999988753


No 123
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=41.81  E-value=14  Score=29.41  Aligned_cols=28  Identities=21%  Similarity=0.477  Sum_probs=18.1

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      ..+.|..||..|.....           .-+.|+.||..
T Consensus        70 ~~~~C~~Cg~~~~~~~~-----------~~~~CP~Cgs~   97 (117)
T PRK00564         70 VELECKDCSHVFKPNAL-----------DYGVCEKCHSK   97 (117)
T ss_pred             CEEEhhhCCCccccCCc-----------cCCcCcCCCCC
Confidence            45789999977765421           11359999853


No 124
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=40.69  E-value=15  Score=21.47  Aligned_cols=9  Identities=33%  Similarity=0.947  Sum_probs=5.0

Q ss_pred             cCCCCCCcc
Q psy6674         240 SCDVCNKAF  248 (258)
Q Consensus       240 ~C~~Cgk~F  248 (258)
                      .|++|++.+
T Consensus         3 ~CPiC~~~v   11 (26)
T smart00734        3 QCPVCFREV   11 (26)
T ss_pred             cCCCCcCcc
Confidence            455555555


No 125
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=40.45  E-value=11  Score=29.27  Aligned_cols=21  Identities=24%  Similarity=0.605  Sum_probs=14.5

Q ss_pred             hhhhhcCCCCcccCCCCCCccc
Q psy6674         228 IHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       228 ~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      ..+..|.| +|++|..||.-|.
T Consensus        70 ~W~~l~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          70 IWMWLEKG-KPKRCPECGHVFK   90 (97)
T ss_pred             EEEEEeCC-CceeCCCCCcEEE
Confidence            34555666 6888888887765


No 126
>PRK05978 hypothetical protein; Provisional
Probab=40.31  E-value=16  Score=30.52  Aligned_cols=32  Identities=19%  Similarity=0.264  Sum_probs=21.2

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQ  251 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~  251 (258)
                      ..|+.||+.--.+..|+.+         -.|+.||..|...
T Consensus        34 grCP~CG~G~LF~g~Lkv~---------~~C~~CG~~~~~~   65 (148)
T PRK05978         34 GRCPACGEGKLFRAFLKPV---------DHCAACGEDFTHH   65 (148)
T ss_pred             CcCCCCCCCcccccccccC---------CCccccCCccccC
Confidence            5799998754444445433         3799999877653


No 127
>PLN02294 cytochrome c oxidase subunit Vb
Probab=40.28  E-value=11  Score=32.25  Aligned_cols=13  Identities=38%  Similarity=0.963  Sum_probs=6.6

Q ss_pred             CCcccCCCCcccC
Q psy6674         209 KQFICRFCSRHFT  221 (258)
Q Consensus       209 kp~~C~~Cgk~F~  221 (258)
                      +++.|+.||..|.
T Consensus       140 kp~RCpeCG~~fk  152 (174)
T PLN02294        140 KSFECPVCTQYFE  152 (174)
T ss_pred             CceeCCCCCCEEE
Confidence            4455555555553


No 128
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=40.00  E-value=14  Score=29.29  Aligned_cols=28  Identities=21%  Similarity=0.454  Sum_probs=18.0

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      ..+.|..||..|.....           ..+.|+.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~~-----------~~~~CP~Cgs~   96 (114)
T PRK03681         69 AECWCETCQQYVTLLTQ-----------RVRRCPQCHGD   96 (114)
T ss_pred             cEEEcccCCCeeecCCc-----------cCCcCcCcCCC
Confidence            45789999976654311           12579999843


No 129
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=38.92  E-value=22  Score=29.15  Aligned_cols=20  Identities=25%  Similarity=0.591  Sum_probs=16.4

Q ss_pred             CcccCCCCCCcccCchhhhh
Q psy6674         237 RPYSCDVCNKAFRRQDHLRD  256 (258)
Q Consensus       237 Kpf~C~~Cgk~F~~~~~L~~  256 (258)
                      +-+.|+.|||.|-..+++.+
T Consensus       123 ~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen  123 EFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             eEEECCCCCCEecccccHHH
Confidence            45799999999988887654


No 130
>PF14379 Myb_CC_LHEQLE:  MYB-CC type transfactor, LHEQLE motif
Probab=37.30  E-value=77  Score=21.73  Aligned_cols=29  Identities=34%  Similarity=0.520  Sum_probs=21.2

Q ss_pred             HHHHHHHHHH-HHHHHHHHHHHHHHHHHHHH
Q psy6674          34 SLQTTLQEEL-LQRSLQNVALTLQTAMVSSL   63 (258)
Q Consensus        34 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~   63 (258)
                      .+|.+|||+| .||.|| +.+.-|.-.+.+|
T Consensus        13 EvQrrLhEQLEvQr~Lq-lrieaqgkyl~~i   42 (51)
T PF14379_consen   13 EVQRRLHEQLEVQRHLQ-LRIEAQGKYLQSI   42 (51)
T ss_pred             HHHHHHHHHHHHHHHHH-HHHHHhhHHHHHH
Confidence            5789999998 589888 6676666555443


No 131
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=36.84  E-value=12  Score=23.97  Aligned_cols=12  Identities=33%  Similarity=0.916  Sum_probs=8.3

Q ss_pred             cccCCCCCCccc
Q psy6674         238 PYSCDVCNKAFR  249 (258)
Q Consensus       238 pf~C~~Cgk~F~  249 (258)
                      -|.|..|+..|+
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            477877877654


No 132
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=36.67  E-value=21  Score=20.19  Aligned_cols=6  Identities=33%  Similarity=1.143  Sum_probs=2.8

Q ss_pred             CCCCCC
Q psy6674         241 CDVCNK  246 (258)
Q Consensus       241 C~~Cgk  246 (258)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444543


No 133
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=35.87  E-value=13  Score=32.91  Aligned_cols=22  Identities=32%  Similarity=0.866  Sum_probs=11.7

Q ss_pred             CCcccCCCCCCcccCchhhhhc
Q psy6674         236 ERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       236 eKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      +-.|.|.+|+|.|+-......|
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KH   96 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKH   96 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHH
T ss_pred             CCEECCCCCCcccCChHHHHHH
Confidence            3446777777766655555544


No 134
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=35.63  E-value=12  Score=28.74  Aligned_cols=31  Identities=32%  Similarity=0.820  Sum_probs=20.0

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      ..|.|++||+.--.        |.-+  --+.|.-|++.|.
T Consensus        34 ~ky~Cp~Cgk~~vk--------R~a~--GIW~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK--------RVAT--GIWKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSEEE--------EEET--TEEEETTTTEEEE
T ss_pred             CCCcCCCCCCceeE--------Eeee--EEeecCCCCCEEe
Confidence            45899999975311        2222  3489999998775


No 135
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=35.49  E-value=18  Score=25.12  Aligned_cols=11  Identities=27%  Similarity=0.951  Sum_probs=6.2

Q ss_pred             ccCCCCcccCC
Q psy6674         212 ICRFCSRHFTK  222 (258)
Q Consensus       212 ~C~~Cgk~F~~  222 (258)
                      .|..||+.|..
T Consensus         7 ~C~~Cg~~~~~   17 (54)
T PF14446_consen    7 KCPVCGKKFKD   17 (54)
T ss_pred             cChhhCCcccC
Confidence            56666665543


No 136
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=35.27  E-value=31  Score=28.16  Aligned_cols=34  Identities=6%  Similarity=0.130  Sum_probs=22.7

Q ss_pred             cccCCCCCCCCCCCCCccCCCCCCCcccCCCCcccCCchhhh
Q psy6674         186 IVTDSISKPVQKSTPVASTARPKKQFICRFCSRHFTKSYNLL  227 (258)
Q Consensus       186 ~~~~~~~k~~~~~~~~~~~~~~~kp~~C~~Cgk~F~~~~~L~  227 (258)
                      ..|..|++.|--.        ++.|-.|++||..|.....++
T Consensus        10 r~Cp~cg~kFYDL--------nk~p~vcP~cg~~~~~~~~~~   43 (129)
T TIGR02300        10 RICPNTGSKFYDL--------NRRPAVSPYTGEQFPPEEALK   43 (129)
T ss_pred             ccCCCcCcccccc--------CCCCccCCCcCCccCcchhhc
Confidence            3466666655332        336789999999997775554


No 137
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=34.96  E-value=16  Score=27.96  Aligned_cols=32  Identities=22%  Similarity=0.591  Sum_probs=21.0

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      ..|.|++|++.--.+          .+-..+.|.-|++.|.-
T Consensus        35 a~y~CpfCgk~~vkR----------~a~GIW~C~~C~~~~AG   66 (90)
T PRK03976         35 AKHVCPVCGRPKVKR----------VGTGIWECRKCGAKFAG   66 (90)
T ss_pred             cCccCCCCCCCceEE----------EEEEEEEcCCCCCEEeC
Confidence            568999997642211          13356889999987753


No 138
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=34.88  E-value=21  Score=27.57  Aligned_cols=25  Identities=16%  Similarity=0.302  Sum_probs=22.2

Q ss_pred             ccc----CCCCcccCCchhhhhhhhhcCC
Q psy6674         211 FIC----RFCSRHFTKSYNLLIHERTHTD  235 (258)
Q Consensus       211 ~~C----~~Cgk~F~~~~~L~~H~r~Htg  235 (258)
                      |.|    ..|+..+.....+..|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            788    8899999999999999987654


No 139
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=33.99  E-value=27  Score=23.64  Aligned_cols=28  Identities=32%  Similarity=0.636  Sum_probs=17.5

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcCCCCcccCCCC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVC  244 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~C  244 (258)
                      -++|..||..|...-.-    |+   .+...|+.|
T Consensus        28 ~W~C~~Cgh~w~~~v~~----R~---~~~~~CP~C   55 (55)
T PF14311_consen   28 WWKCPKCGHEWKASVND----RT---RRGKGCPYC   55 (55)
T ss_pred             EEECCCCCCeeEccHhh----hc---cCCCCCCCC
Confidence            37899998877665322    22   344577776


No 140
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=32.91  E-value=9.6  Score=33.73  Aligned_cols=24  Identities=17%  Similarity=0.379  Sum_probs=19.6

Q ss_pred             CCcccCCCCcccCCchhhhhhhhh
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERT  232 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~  232 (258)
                      ..|.|..|+|.|.-......|+..
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             CEECCCCCCcccCChHHHHHHHhh
Confidence            559999999999999999999875


No 141
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=32.60  E-value=20  Score=28.26  Aligned_cols=27  Identities=26%  Similarity=0.614  Sum_probs=17.2

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      ..+.|..||+.|.-...            .|.|+.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (113)
T PF01155_consen   69 ARARCRDCGHEFEPDEF------------DFSCPRCGSP   95 (113)
T ss_dssp             -EEEETTTS-EEECHHC------------CHH-SSSSSS
T ss_pred             CcEECCCCCCEEecCCC------------CCCCcCCcCC
Confidence            44789999998865432            1569999965


No 142
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=32.53  E-value=7.1  Score=24.96  Aligned_cols=10  Identities=30%  Similarity=0.946  Sum_probs=7.0

Q ss_pred             ccCCCCCCcc
Q psy6674         239 YSCDVCNKAF  248 (258)
Q Consensus       239 f~C~~Cgk~F  248 (258)
                      |.|..||+.|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6777777665


No 143
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=32.36  E-value=29  Score=29.01  Aligned_cols=19  Identities=21%  Similarity=0.385  Sum_probs=13.6

Q ss_pred             CCCcccCCCCcccCCchhh
Q psy6674         208 KKQFICRFCSRHFTKSYNL  226 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L  226 (258)
                      ++.-.|..||+.|+.-...
T Consensus        26 RRRReC~~C~~RFTTyErv   44 (147)
T TIGR00244        26 RRRRECLECHERFTTFERA   44 (147)
T ss_pred             eecccCCccCCccceeeec
Confidence            3556899999988876443


No 144
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=31.54  E-value=33  Score=27.85  Aligned_cols=16  Identities=25%  Similarity=0.779  Sum_probs=11.1

Q ss_pred             CCCcccCCCCcccCCc
Q psy6674         208 KKQFICRFCSRHFTKS  223 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~  223 (258)
                      .-.|.|..|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            4567777777777654


No 145
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=31.50  E-value=31  Score=26.84  Aligned_cols=38  Identities=29%  Similarity=0.673  Sum_probs=15.0

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhhcCCCCc-ccCCCCCCcccC
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERTHTDERP-YSCDVCNKAFRR  250 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKp-f~C~~Cgk~F~~  250 (258)
                      +.|--.|..||+.+...     +..+- |+|. |.|+.|.+.|..
T Consensus        11 g~ke~~CalCG~tWg~~-----y~Ev~-G~rLfFCCd~ca~EF~n   49 (105)
T PF11494_consen   11 GTKEMGCALCGATWGDY-----YEEVD-GERLFFCCDDCAKEFKN   49 (105)
T ss_dssp             -SGGGS-SS---S---S-----S-B-T-T--BSSS--SSSS-TTS
T ss_pred             ccccccccccCCcHHHH-----HHhhc-CCEEEEEcHHHHHHHHH
Confidence            34556899999888743     22233 5554 678889988865


No 146
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=30.98  E-value=39  Score=33.30  Aligned_cols=41  Identities=10%  Similarity=0.317  Sum_probs=25.0

Q ss_pred             CCCCCcccCCCCcccCCchhhhhhhhhcCC------CCcccCCCCCCc
Q psy6674         206 RPKKQFICRFCSRHFTKSYNLLIHERTHTD------ERPYSCDVCNKA  247 (258)
Q Consensus       206 ~~~kp~~C~~Cgk~F~~~~~L~~H~r~Htg------eKpf~C~~Cgk~  247 (258)
                      ...+.|+|..||..|.-...-..+ .+-.|      .-.|.|+.||..
T Consensus       421 ~~~~~~~c~~c~~~yd~~~g~~~~-~~~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        421 DLGPRMQCSVCQWIYDPAKGEPMQ-DVAPGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             CCCCeEEECCCCeEECCCCCCccc-CCCCCCChhhCCCCCcCcCCCCc
Confidence            355779999999888764222111 11212      134799999953


No 147
>KOG3408|consensus
Probab=30.78  E-value=20  Score=29.02  Aligned_cols=26  Identities=35%  Similarity=0.510  Sum_probs=22.8

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhh
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERT  232 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~  232 (258)
                      |-..|.|-.|.+.|.....|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            33668999999999999999999885


No 148
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=30.77  E-value=27  Score=28.47  Aligned_cols=34  Identities=18%  Similarity=0.511  Sum_probs=23.0

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      -.|.|..|+..+.      +|.+ |.....|.|..|+..|.
T Consensus       111 ~~y~C~~C~~~~~------~~rr-~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      111 YPYRCTGCGQRYL------RVRR-SNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEEECCCCCCCCc------eEcc-ccCcceEEcCCCCCEEE
Confidence            5789999998764      2222 22226699999997664


No 149
>KOG4173|consensus
Probab=30.74  E-value=8.8  Score=33.93  Aligned_cols=48  Identities=29%  Similarity=0.537  Sum_probs=36.8

Q ss_pred             cccCCCCcccCCchhhhhhhh-hc---------CCCCcccCC--CCCCcccCchhhhhcC
Q psy6674         211 FICRFCSRHFTKSYNLLIHER-TH---------TDERPYSCD--VCNKAFRRQDHLRDHR  258 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r-~H---------tgeKpf~C~--~Cgk~F~~~~~L~~H~  258 (258)
                      ..|.+|.+.|....-|-.|+. .|         .|.--|.|-  .|+..|.+....++|+
T Consensus       107 ~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  107 NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHH
Confidence            389999999999999988865 34         344458884  5999998877777764


No 150
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=30.73  E-value=32  Score=36.25  Aligned_cols=11  Identities=36%  Similarity=0.857  Sum_probs=6.2

Q ss_pred             ccCCCCcccCC
Q psy6674         212 ICRFCSRHFTK  222 (258)
Q Consensus       212 ~C~~Cgk~F~~  222 (258)
                      .|..|++.|..
T Consensus       462 tC~~C~kkFfS  472 (1374)
T PTZ00303        462 SCPSCGRAFIS  472 (1374)
T ss_pred             cccCcCCcccc
Confidence            46666666643


No 151
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=30.46  E-value=24  Score=29.73  Aligned_cols=16  Identities=31%  Similarity=0.719  Sum_probs=9.8

Q ss_pred             CCcccCCCCCCcccCc
Q psy6674         236 ERPYSCDVCNKAFRRQ  251 (258)
Q Consensus       236 eKpf~C~~Cgk~F~~~  251 (258)
                      +.|.-|..||+.|.|-
T Consensus        66 ~~PsYC~~CGkpyPWt   81 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWT   81 (158)
T ss_pred             CCChhHHhCCCCCchH
Confidence            4566666666666653


No 152
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=30.29  E-value=32  Score=28.90  Aligned_cols=18  Identities=22%  Similarity=0.440  Sum_probs=13.2

Q ss_pred             CCCcccCCCCcccCCchh
Q psy6674         208 KKQFICRFCSRHFTKSYN  225 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~  225 (258)
                      ++.-.|..||+.|+.-..
T Consensus        26 RRRReC~~C~~RFTTfE~   43 (156)
T COG1327          26 RRRRECLECGERFTTFER   43 (156)
T ss_pred             hhhhcccccccccchhhe
Confidence            455689999998877543


No 153
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=29.56  E-value=42  Score=28.57  Aligned_cols=22  Identities=14%  Similarity=0.247  Sum_probs=13.7

Q ss_pred             CcccCCCCcccCCchhhhhhhh
Q psy6674         210 QFICRFCSRHFTKSYNLLIHER  231 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r  231 (258)
                      -|.|+.||+.|-..+++..-.+
T Consensus       130 f~~C~~CgkiYW~GsHw~~m~~  151 (165)
T COG1656         130 FYRCPKCGKIYWKGSHWRRMVE  151 (165)
T ss_pred             eeECCCCcccccCchHHHHHHH
Confidence            3557777777766666654433


No 154
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=29.42  E-value=28  Score=29.94  Aligned_cols=33  Identities=12%  Similarity=0.531  Sum_probs=22.2

Q ss_pred             CCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcc
Q psy6674         207 PKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAF  248 (258)
Q Consensus       207 ~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F  248 (258)
                      +..-|.|+.|.-.|+......         .-|.|+.||...
T Consensus       110 ~~~~y~C~~~~~r~sfdeA~~---------~~F~Cp~Cg~~L  142 (176)
T COG1675         110 ENNYYVCPNCHVKYSFDEAME---------LGFTCPKCGEDL  142 (176)
T ss_pred             cCCceeCCCCCCcccHHHHHH---------hCCCCCCCCchh
Confidence            345589988887776554432         129999999643


No 155
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.42  E-value=11  Score=28.14  Aligned_cols=35  Identities=17%  Similarity=0.580  Sum_probs=20.8

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      -.|.|..||..|.    +..|++   ..---.|+.|+.+|++
T Consensus        11 Y~Y~c~~cg~~~d----vvq~~~---ddplt~ce~c~a~~kk   45 (82)
T COG2331          11 YSYECTECGNRFD----VVQAMT---DDPLTTCEECGARLKK   45 (82)
T ss_pred             eEEeecccchHHH----HHHhcc---cCccccChhhChHHHH
Confidence            3488999997764    333332   2222368888865543


No 156
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=29.32  E-value=26  Score=21.96  Aligned_cols=14  Identities=36%  Similarity=0.776  Sum_probs=7.3

Q ss_pred             ccCCCCcccCCchh
Q psy6674         212 ICRFCSRHFTKSYN  225 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~  225 (258)
                      .|..|++.|....-
T Consensus         5 ~C~eC~~~f~dSyL   18 (34)
T PF01286_consen    5 KCDECGKPFMDSYL   18 (34)
T ss_dssp             E-TTT--EES-SSC
T ss_pred             hHhHhCCHHHHHHH
Confidence            68889988877653


No 157
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=29.31  E-value=40  Score=23.45  Aligned_cols=10  Identities=30%  Similarity=0.630  Sum_probs=5.5

Q ss_pred             CCcccCCCCc
Q psy6674         209 KQFICRFCSR  218 (258)
Q Consensus       209 kp~~C~~Cgk  218 (258)
                      ..|.|+.||-
T Consensus        13 v~~~Cp~cGi   22 (55)
T PF13824_consen   13 VNFECPDCGI   22 (55)
T ss_pred             cCCcCCCCCC
Confidence            4456666654


No 158
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=29.30  E-value=47  Score=34.20  Aligned_cols=10  Identities=20%  Similarity=0.557  Sum_probs=6.2

Q ss_pred             cCCCCCCccc
Q psy6674         240 SCDVCNKAFR  249 (258)
Q Consensus       240 ~C~~Cgk~F~  249 (258)
                      -|+.||....
T Consensus        43 fC~~CG~~~~   52 (645)
T PRK14559         43 HCPNCGAETG   52 (645)
T ss_pred             cccccCCccc
Confidence            5777776543


No 159
>PRK04351 hypothetical protein; Provisional
Probab=29.14  E-value=26  Score=29.16  Aligned_cols=35  Identities=17%  Similarity=0.617  Sum_probs=24.6

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQ  251 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~  251 (258)
                      -.|.|.-||..+.+.       |.| ..+.|.|..|+..+...
T Consensus       111 y~Y~C~~Cg~~~~r~-------Rr~-n~~~yrCg~C~g~L~~~  145 (149)
T PRK04351        111 YLYECQSCGQQYLRK-------RRI-NTKRYRCGKCRGKLKLI  145 (149)
T ss_pred             EEEECCCCCCEeeee-------eec-CCCcEEeCCCCcEeeec
Confidence            568998899766432       223 34779999999877554


No 160
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=29.00  E-value=27  Score=22.28  Aligned_cols=21  Identities=19%  Similarity=0.341  Sum_probs=13.3

Q ss_pred             CCCcccCCCCCCcccCchhhh
Q psy6674         235 DERPYSCDVCNKAFRRQDHLR  255 (258)
Q Consensus       235 geKpf~C~~Cgk~F~~~~~L~  255 (258)
                      +..-+.|+.|+-.|.....|.
T Consensus        16 ~~~id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   16 DVEIDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             CEEEEECCCCCeEEccHHHHH
Confidence            345567888887766655543


No 161
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.89  E-value=32  Score=28.10  Aligned_cols=16  Identities=31%  Similarity=0.650  Sum_probs=9.0

Q ss_pred             CCcccCCCCCCcccCc
Q psy6674         236 ERPYSCDVCNKAFRRQ  251 (258)
Q Consensus       236 eKpf~C~~Cgk~F~~~  251 (258)
                      +.|--|.-||++|.|.
T Consensus        66 e~psfchncgs~fpwt   81 (160)
T COG4306          66 EPPSFCHNCGSRFPWT   81 (160)
T ss_pred             CCcchhhcCCCCCCcH
Confidence            4455566666666553


No 162
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=28.08  E-value=29  Score=27.82  Aligned_cols=32  Identities=19%  Similarity=0.353  Sum_probs=17.9

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      ..+.| .||..|.....-..|    . .-.+.|+.||.
T Consensus        69 ~~~~C-~Cg~~~~~~~~~~~~----~-~~~~~CP~Cgs  100 (124)
T PRK00762         69 VEIEC-ECGYEGVVDEDEIDH----Y-AAVIECPVCGN  100 (124)
T ss_pred             eeEEe-eCcCcccccccchhc----c-ccCCcCcCCCC
Confidence            45789 899887654211111    0 01257999984


No 163
>KOG1146|consensus
Probab=27.98  E-value=22  Score=39.22  Aligned_cols=46  Identities=15%  Similarity=0.155  Sum_probs=37.8

Q ss_pred             cCCCCcccCCchhhhhhhh-hcCCCCcccCCCCCCcccCchhhhhcC
Q psy6674         213 CRFCSRHFTKSYNLLIHER-THTDERPYSCDVCNKAFRRQDHLRDHR  258 (258)
Q Consensus       213 C~~Cgk~F~~~~~L~~H~r-~HtgeKpf~C~~Cgk~F~~~~~L~~H~  258 (258)
                      |.-|+..|.++..+..|+. .|...|.|.|+.|+..|+....|-.||
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhm  485 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHM  485 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcc
Confidence            4557777777777777776 466779999999999999999998886


No 164
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=27.87  E-value=21  Score=23.13  Aligned_cols=10  Identities=20%  Similarity=1.208  Sum_probs=4.8

Q ss_pred             cccCCCCccc
Q psy6674         211 FICRFCSRHF  220 (258)
Q Consensus       211 ~~C~~Cgk~F  220 (258)
                      -.|++||..|
T Consensus        30 ~~CpYCg~~y   39 (40)
T PF10276_consen   30 VVCPYCGTRY   39 (40)
T ss_dssp             EEETTTTEEE
T ss_pred             EECCCCCCEE
Confidence            4455555444


No 165
>KOG2231|consensus
Probab=27.75  E-value=26  Score=36.10  Aligned_cols=45  Identities=27%  Similarity=0.516  Sum_probs=0.0

Q ss_pred             cccCCCCcccC---------------Cchhhhhhh-hhcCCCCcccCCCCCC---------cccCchhhhhcC
Q psy6674         211 FICRFCSRHFT---------------KSYNLLIHE-RTHTDERPYSCDVCNK---------AFRRQDHLRDHR  258 (258)
Q Consensus       211 ~~C~~Cgk~F~---------------~~~~L~~H~-r~HtgeKpf~C~~Cgk---------~F~~~~~L~~H~  258 (258)
                      +.|.+|++.|.               ....|+.|+ ..|   +-+.|.+|-.         ...++..|..|+
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H---~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~  169 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQH---KLHLCSLCLQNLKIFINERKLYTRAELNLHL  169 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhh---hhhccccccccceeeeeeeehehHHHHHHHH


No 166
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=27.31  E-value=39  Score=22.15  Aligned_cols=12  Identities=33%  Similarity=0.866  Sum_probs=5.9

Q ss_pred             CcccCCCCcccC
Q psy6674         210 QFICRFCSRHFT  221 (258)
Q Consensus       210 p~~C~~Cgk~F~  221 (258)
                      .|.|+.||..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            455555554433


No 167
>PRK05580 primosome assembly protein PriA; Validated
Probab=27.27  E-value=39  Score=34.78  Aligned_cols=24  Identities=21%  Similarity=0.390  Sum_probs=15.9

Q ss_pred             hhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         224 YNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       224 ~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      ..|..|..-++...|..|+.||..
T Consensus       407 ~~l~Ch~Cg~~~~~~~~Cp~Cg~~  430 (679)
T PRK05580        407 RRLRCHHCGYQEPIPKACPECGST  430 (679)
T ss_pred             CeEECCCCcCCCCCCCCCCCCcCC
Confidence            345555555566678889999754


No 168
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=27.00  E-value=27  Score=23.90  Aligned_cols=31  Identities=32%  Similarity=0.838  Sum_probs=17.7

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCC
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVC  244 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~C  244 (258)
                      ...|.|+.|++.|=..-..-.|...|      .|+.|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH------~CPGC   49 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH------NCPGC   49 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-------SSSTT
T ss_pred             CCeEECCCCCCccccCcChhhhcccc------CCcCC
Confidence            36799999999998777777775554      56666


No 169
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=26.67  E-value=54  Score=30.67  Aligned_cols=18  Identities=17%  Similarity=0.259  Sum_probs=12.4

Q ss_pred             cccCCCchhHHHHHHHHH
Q psy6674          23 LALPDAGNIVKSLQTTLQ   40 (258)
Q Consensus        23 ~~~~~~~~~~~~~~~~~~   40 (258)
                      +-+||.+|+...=-.||.
T Consensus        25 ll~p~~~~lf~~RA~Rl~   42 (309)
T PRK03564         25 LLFANLKNLYNRRAERLR   42 (309)
T ss_pred             eecCCcccHHHHHHHHHH
Confidence            568888888765555554


No 170
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.64  E-value=50  Score=23.52  Aligned_cols=41  Identities=17%  Similarity=0.220  Sum_probs=22.0

Q ss_pred             CCCCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccC
Q psy6674         206 RPKKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRR  250 (258)
Q Consensus       206 ~~~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~  250 (258)
                      ...+++.|.--+..|.+...+..-    ..+.-..|+.|++.|+.
T Consensus        20 ~~~~~l~C~g~~~p~~HPrV~L~m----g~~gev~CPYC~t~y~l   60 (62)
T COG4391          20 IGDLPLMCPGPEPPNDHPRVFLDM----GDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             eCCeeEEcCCCCCCCCCCEEEEEc----CCCCcEecCccccEEEe
Confidence            345667777655555444322211    12333478888887753


No 171
>PRK14873 primosome assembly protein PriA; Provisional
Probab=26.38  E-value=35  Score=35.16  Aligned_cols=11  Identities=18%  Similarity=0.691  Sum_probs=8.1

Q ss_pred             CcccCCCCCCc
Q psy6674         237 RPYSCDVCNKA  247 (258)
Q Consensus       237 Kpf~C~~Cgk~  247 (258)
                      .|+.|+.||..
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            57788888854


No 172
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=26.16  E-value=29  Score=21.09  Aligned_cols=25  Identities=24%  Similarity=0.672  Sum_probs=10.8

Q ss_pred             ccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         212 ICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      +|+.|+..+..           ...--|.|+.|+..
T Consensus         4 ~Cp~C~se~~y-----------~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----E-----------E-SSSEEETTTTEE
T ss_pred             CCCCCCCccee-----------ccCCEEeCCccccc
Confidence            57777766544           23445788888753


No 173
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=26.16  E-value=33  Score=22.03  Aligned_cols=10  Identities=20%  Similarity=0.531  Sum_probs=5.6

Q ss_pred             CcccCCCCCC
Q psy6674         237 RPYSCDVCNK  246 (258)
Q Consensus       237 Kpf~C~~Cgk  246 (258)
                      .-+.|..||.
T Consensus        18 g~~vC~~CG~   27 (43)
T PF08271_consen   18 GELVCPNCGL   27 (43)
T ss_dssp             TEEEETTT-B
T ss_pred             CeEECCCCCC
Confidence            3457777764


No 174
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=26.06  E-value=32  Score=29.57  Aligned_cols=25  Identities=24%  Similarity=0.614  Sum_probs=17.9

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      +.+.|.-|++.|..              .--.|+.||..
T Consensus       138 w~~rC~GC~~~f~~--------------~~~~Cp~CG~~  162 (177)
T COG1439         138 WRLRCHGCKRIFPE--------------PKDFCPICGSP  162 (177)
T ss_pred             eeEEEecCceecCC--------------CCCcCCCCCCc
Confidence            56789999998871              11368999865


No 175
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=25.86  E-value=45  Score=26.12  Aligned_cols=9  Identities=33%  Similarity=1.161  Sum_probs=5.8

Q ss_pred             CcccCCCCc
Q psy6674         210 QFICRFCSR  218 (258)
Q Consensus       210 p~~C~~Cgk  218 (258)
                      |-.|++||.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            456777774


No 176
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=25.69  E-value=36  Score=30.48  Aligned_cols=15  Identities=20%  Similarity=0.516  Sum_probs=9.1

Q ss_pred             CCcccCCCCcccCCc
Q psy6674         209 KQFICRFCSRHFTKS  223 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~  223 (258)
                      +.|.|+.||..+.+.
T Consensus       321 r~~~C~~cg~~~~rD  335 (364)
T COG0675         321 RLFKCPRCGFVHDRD  335 (364)
T ss_pred             eeEECCCCCCeehhh
Confidence            456677776665544


No 177
>PHA02998 RNA polymerase subunit; Provisional
Probab=25.36  E-value=30  Score=29.88  Aligned_cols=39  Identities=21%  Similarity=0.466  Sum_probs=20.6

Q ss_pred             CcccCCCCcccCCchhhhhhhhhcC-C-CCcccCCCCCCcccC
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERTHT-D-ERPYSCDVCNKAFRR  250 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~Ht-g-eKpf~C~~Cgk~F~~  250 (258)
                      .-.|+.|+..  .........|.-. + -.-|.|..||+.|+-
T Consensus       143 ~v~CPkCg~~--~A~f~qlQTRSADEPmT~FYkC~~CG~~wkp  183 (195)
T PHA02998        143 NTPCPNCKSK--NTTPMMIQTRAADEPPLVRHACRDCKKHFKP  183 (195)
T ss_pred             CCCCCCCCCC--ceEEEEEeeccCCCCceEEEEcCCCCCccCC
Confidence            3578888743  2222233333211 1 133789999987753


No 178
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=25.34  E-value=45  Score=21.47  Aligned_cols=24  Identities=17%  Similarity=0.441  Sum_probs=17.3

Q ss_pred             cccCCCCcccCCc--hhhhhhhhhcC
Q psy6674         211 FICRFCSRHFTKS--YNLLIHERTHT  234 (258)
Q Consensus       211 ~~C~~Cgk~F~~~--~~L~~H~r~Ht  234 (258)
                      -.|..||..|...  ..-+.|.+-|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            4899999988665  44567776663


No 179
>KOG4173|consensus
Probab=25.34  E-value=20  Score=31.69  Aligned_cols=46  Identities=28%  Similarity=0.551  Sum_probs=34.7

Q ss_pred             CCcccCC--CCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCchhhhhc
Q psy6674         209 KQFICRF--CSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       209 kp~~C~~--Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~~~L~~H  257 (258)
                      +.|.|.+  |...|..-.....|-.+.+|   -.|.+|.+.|.+...|..|
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~H  125 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAH  125 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHH
Confidence            4588987  77888887777766543333   2799999999998887766


No 180
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=25.11  E-value=16  Score=27.24  Aligned_cols=40  Identities=28%  Similarity=0.595  Sum_probs=16.2

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcccCc
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFRRQ  251 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~~~  251 (258)
                      .+.|.|++|+..-.-.-.+    ..-.+.--..|..||..|...
T Consensus        20 ~~~F~CPfC~~~~sV~v~i----dkk~~~~~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   20 PKVFDCPFCNHEKSVSVKI----DKKEGIGILSCRVCGESFQTK   59 (81)
T ss_dssp             SS----TTT--SS-EEEEE----ETTTTEEEEEESSS--EEEEE
T ss_pred             CceEcCCcCCCCCeEEEEE----EccCCEEEEEecCCCCeEEEc
Confidence            3679999998332111111    111333446899999887654


No 181
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=25.09  E-value=44  Score=22.60  Aligned_cols=27  Identities=22%  Similarity=0.559  Sum_probs=16.4

Q ss_pred             ccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCccc
Q psy6674         212 ICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAFR  249 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F~  249 (258)
                      .|+.||..|     |..|    .  ..|.|.-||..+.
T Consensus        22 fCP~Cg~~~-----m~~~----~--~r~~C~~Cgyt~~   48 (50)
T PRK00432         22 FCPRCGSGF-----MAEH----L--DRWHCGKCGYTEF   48 (50)
T ss_pred             cCcCCCcch-----hecc----C--CcEECCCcCCEEe
Confidence            688887432     2222    1  4678998986543


No 182
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=25.00  E-value=35  Score=21.73  Aligned_cols=31  Identities=19%  Similarity=0.474  Sum_probs=13.9

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      ..|..|+-.      |.-+..+..+.+-+.|.+|+..
T Consensus         3 ~rC~~C~ay------lNp~~~~~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen    3 VRCRRCRAY------LNPFCQFDDGGKTWICNFCGTK   33 (40)
T ss_dssp             -B-TTT--B------S-TTSEEETTTTEEEETTT--E
T ss_pred             cccCCCCCE------ECCcceEcCCCCEEECcCCCCc
Confidence            355555433      3333444556667788888764


No 183
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=24.06  E-value=38  Score=28.12  Aligned_cols=33  Identities=27%  Similarity=0.678  Sum_probs=20.3

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC-cccC
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK-AFRR  250 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk-~F~~  250 (258)
                      ...|.|..||.....         .|.+ +--.|+.||. .|.|
T Consensus       110 ~G~l~C~~Cg~~~~~---------~~~~-~l~~Cp~C~~~~F~R  143 (146)
T PF07295_consen  110 PGTLVCENCGHEVEL---------THPE-RLPPCPKCGHTEFTR  143 (146)
T ss_pred             CceEecccCCCEEEe---------cCCC-cCCCCCCCCCCeeee
Confidence            366899999864311         2333 3348999984 4544


No 184
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=23.87  E-value=35  Score=32.57  Aligned_cols=31  Identities=32%  Similarity=0.701  Sum_probs=22.8

Q ss_pred             ccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCC
Q psy6674         212 ICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      .|.+|.+.|-....|..|+|-    +.-.|-+|++
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~----~HE~ChICD~  252 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRL----RHEACHICDM  252 (493)
T ss_pred             hhhhccceecChHHHHHHHHh----hhhhhhhhhc
Confidence            699999999999999888873    2235555654


No 185
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=23.86  E-value=27  Score=30.56  Aligned_cols=37  Identities=14%  Similarity=0.313  Sum_probs=19.0

Q ss_pred             cccCCCCcccCCchhhhhhhhhcCCCC---cccCCCCCCccc
Q psy6674         211 FICRFCSRHFTKSYNLLIHERTHTDER---PYSCDVCNKAFR  249 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r~HtgeK---pf~C~~Cgk~F~  249 (258)
                      -.|++||..|...  ...+..-|-|+.   -+.|..||.+|.
T Consensus        15 ~~CPvCg~~l~~~--~~~~~IPyFG~V~i~t~~C~~CgYR~~   54 (201)
T COG1779          15 IDCPVCGGTLKAH--MYLYDIPYFGEVLISTGVCERCGYRST   54 (201)
T ss_pred             ecCCcccceeeEE--EeeecCCccceEEEEEEEccccCCccc
Confidence            5789998732221  111111233432   247888887664


No 186
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.68  E-value=1.4e+02  Score=23.83  Aligned_cols=32  Identities=25%  Similarity=0.787  Sum_probs=25.4

Q ss_pred             CCCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCC
Q psy6674         208 KKQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCN  245 (258)
Q Consensus       208 ~kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cg  245 (258)
                      ..+|.|+.|.+.|-..-..-.|...|      .|+.|.
T Consensus        79 ~~~y~C~~C~~~FC~dCD~fiHe~Lh------~CPGC~  110 (112)
T TIGR00622        79 SHRYVCAVCKNVFCVDCDVFVHESLH------CCPGCI  110 (112)
T ss_pred             ccceeCCCCCCccccccchhhhhhcc------CCcCCC
Confidence            45799999999998888888887666      477775


No 187
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=23.61  E-value=41  Score=27.57  Aligned_cols=15  Identities=27%  Similarity=0.585  Sum_probs=11.7

Q ss_pred             CcccCCCCcccCCch
Q psy6674         210 QFICRFCSRHFTKSY  224 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~  224 (258)
                      ||+|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            578888888887664


No 188
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.54  E-value=46  Score=32.99  Aligned_cols=21  Identities=24%  Similarity=0.423  Sum_probs=12.6

Q ss_pred             hhhhhhhcCCCCcccCCCCCC
Q psy6674         226 LLIHERTHTDERPYSCDVCNK  246 (258)
Q Consensus       226 L~~H~r~HtgeKpf~C~~Cgk  246 (258)
                      |..|..-+....|..|+.||.
T Consensus       241 l~Ch~Cg~~~~~~~~Cp~C~s  261 (505)
T TIGR00595       241 LRCHYCGYQEPIPKTCPQCGS  261 (505)
T ss_pred             EEcCCCcCcCCCCCCCCCCCC
Confidence            444444444556778888875


No 189
>PF08684 ocr:  DNA mimic ocr;  InterPro: IPR014798 The structure of an Ocr protein from bacteriophage T7 has shown that this protein mimics the size and shape of a bent DNA molecule []. Ocr has also been shown to be an inhibitor of the complex type I DNA restriction enzymes []. ; PDB: 1S7Z_A 2Y7C_E.
Probab=23.01  E-value=94  Score=23.92  Aligned_cols=29  Identities=28%  Similarity=0.504  Sum_probs=19.8

Q ss_pred             cccccccccCCCchhHHHHHHHHHHHHHH
Q psy6674          17 HSTEDVLALPDAGNIVKSLQTTLQEELLQ   45 (258)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   45 (258)
                      |-.+|---+||...+.+-||.||.|+|.-
T Consensus        62 ~EfdDsgLipdtkDV~~IlqaRIyE~L~n   90 (101)
T PF08684_consen   62 HEFDDSGLIPDTKDVTRILQARIYEQLYN   90 (101)
T ss_dssp             SS-SSGGGS---S-HHHHHHHHHHHHHHH
T ss_pred             eeccccCCCCCcHHHHHHHHHHHHHHHHH
Confidence            34567777899999999999999999864


No 190
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=22.92  E-value=56  Score=32.36  Aligned_cols=66  Identities=18%  Similarity=0.322  Sum_probs=35.2

Q ss_pred             cccccCCCCCCCCCCCCCccCCC-CCCCcccCCCCcccCCchhhhh----hhhhcCCCCcc--cCCCCCCccc
Q psy6674         184 KTIVTDSISKPVQKSTPVASTAR-PKKQFICRFCSRHFTKSYNLLI----HERTHTDERPY--SCDVCNKAFR  249 (258)
Q Consensus       184 ~~~~~~~~~k~~~~~~~~~~~~~-~~kp~~C~~Cgk~F~~~~~L~~----H~r~HtgeKpf--~C~~Cgk~F~  249 (258)
                      .+..|..|...+..........+ .+..|.|+.|.........-..    .-..-.+.++|  .|.+|-....
T Consensus        25 ~~~yCp~CL~~~p~~e~~~~~nrC~r~Cf~CP~C~~~L~~~~~~~~~~~~~~~~~~~~~~~~l~C~~C~Wss~   97 (483)
T PF05502_consen   25 DSYYCPNCLFEVPSSEARSEKNRCSRNCFDCPICFSPLSVRASDTPPSPPDPSSDSGGKPYYLSCSYCRWSSR   97 (483)
T ss_pred             ceeECccccccCChhhheeccceeccccccCCCCCCcceeEecccccccccccccCCCCCEEEECCCceeecc
Confidence            34567777666554443333333 3477899999866544422210    00112344665  8999876543


No 191
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=22.75  E-value=59  Score=29.93  Aligned_cols=26  Identities=27%  Similarity=0.715  Sum_probs=19.6

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCcc
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKAF  248 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~F  248 (258)
                      .-|.|++|.-.|-.              .|-.|+.||-.|
T Consensus       254 ~GyvCs~Clsi~C~--------------~p~~C~~Cgt~f  279 (279)
T TIGR00627       254 IGFVCSVCLSVLCQ--------------YTPICKTCKTAF  279 (279)
T ss_pred             ceEECCCccCCcCC--------------CCCCCCCCCCCC
Confidence            34999999877754              234899999877


No 192
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=22.67  E-value=45  Score=21.05  Aligned_cols=29  Identities=17%  Similarity=0.516  Sum_probs=17.3

Q ss_pred             ccCCCCcccCCchhhhhhhhhcCCCCcccCCCC
Q psy6674         212 ICRFCSRHFTKSYNLLIHERTHTDERPYSCDVC  244 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~C  244 (258)
                      .|+.|+..-    .+.+|=+...|...|.|..|
T Consensus         7 ~CP~C~s~~----~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    7 HCPRCQSTE----GVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eCCCCCCCC----cceeCCCCCCCCEeEecCcC
Confidence            577776431    14455555666677777776


No 193
>PRK14873 primosome assembly protein PriA; Provisional
Probab=22.64  E-value=40  Score=34.73  Aligned_cols=35  Identities=14%  Similarity=0.158  Sum_probs=24.0

Q ss_pred             ccCCCCcccCCchhhhhhhhhcCCCCcccCCCCCCc
Q psy6674         212 ICRFCSRHFTKSYNLLIHERTHTDERPYSCDVCNKA  247 (258)
Q Consensus       212 ~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~Cgk~  247 (258)
                      .|..||..+.... ....+..|.......|..||..
T Consensus       385 ~C~~Cg~~~~C~~-C~~~L~~h~~~~~l~Ch~CG~~  419 (665)
T PRK14873        385 ACARCRTPARCRH-CTGPLGLPSAGGTPRCRWCGRA  419 (665)
T ss_pred             EhhhCcCeeECCC-CCCceeEecCCCeeECCCCcCC
Confidence            7888988766552 3334445556677899999964


No 194
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=22.52  E-value=53  Score=20.86  Aligned_cols=23  Identities=26%  Similarity=0.745  Sum_probs=8.6

Q ss_pred             CCcccCCCCcccCCch-hh-hhhhh
Q psy6674         209 KQFICRFCSRHFTKSY-NL-LIHER  231 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~-~L-~~H~r  231 (258)
                      +.|-|++|...|.... .- +.|.+
T Consensus         2 ~ryyCdyC~~~~~~d~~~~Rk~H~~   26 (38)
T PF06220_consen    2 PRYYCDYCKKYLTHDSPSIRKQHER   26 (38)
T ss_dssp             -S-B-TTT--B-S--SHHHHHHHT-
T ss_pred             cCeecccccceecCCChHHHHHhhc
Confidence            4589999999884443 22 45543


No 195
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=22.47  E-value=39  Score=23.42  Aligned_cols=31  Identities=19%  Similarity=0.267  Sum_probs=17.8

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCcccCCC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERPYSCDV  243 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKpf~C~~  243 (258)
                      .|+....||..|.+..-+. ++   ...+...|+.
T Consensus        23 ~PV~s~~C~H~fek~aI~~-~i---~~~~~~~CPv   53 (57)
T PF11789_consen   23 DPVKSKKCGHTFEKEAILQ-YI---QRNGSKRCPV   53 (57)
T ss_dssp             SEEEESSS--EEEHHHHHH-HC---TTTS-EE-SC
T ss_pred             CCcCcCCCCCeecHHHHHH-HH---HhcCCCCCCC
Confidence            5677778999997765443 33   3456788887


No 196
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=22.01  E-value=45  Score=21.27  Aligned_cols=15  Identities=20%  Similarity=0.671  Sum_probs=11.6

Q ss_pred             cccCCCCCCcccCch
Q psy6674         238 PYSCDVCNKAFRRQD  252 (258)
Q Consensus       238 pf~C~~Cgk~F~~~~  252 (258)
                      ||.|..|++.|-...
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            888999998886543


No 197
>COG3464 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=21.83  E-value=45  Score=32.12  Aligned_cols=14  Identities=43%  Similarity=0.954  Sum_probs=10.4

Q ss_pred             CCcccCCCCCCccc
Q psy6674         236 ERPYSCDVCNKAFR  249 (258)
Q Consensus       236 eKpf~C~~Cgk~F~  249 (258)
                      .+.|.|..|++.|.
T Consensus        75 ~rR~~c~~c~~~~~   88 (402)
T COG3464          75 KRRYKCCRCGKRFA   88 (402)
T ss_pred             cceeecccCCCCcc
Confidence            45578888888874


No 198
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=21.82  E-value=17  Score=33.19  Aligned_cols=19  Identities=21%  Similarity=0.417  Sum_probs=9.0

Q ss_pred             cccCCCchhHHHHHHHHHH
Q psy6674          23 LALPDAGNIVKSLQTTLQE   41 (258)
Q Consensus        23 ~~~~~~~~~~~~~~~~~~~   41 (258)
                      +-+||..++.+.-..||.+
T Consensus         8 ~~~~~~~~~~~~ra~rl~~   26 (290)
T PF04216_consen    8 VILPDPATLFARRAERLRA   26 (290)
T ss_dssp             -EE---TTHHHHHHHHHHH
T ss_pred             eecCCHhhHHHHHHHHHHH
Confidence            3467777777665555543


No 199
>KOG1280|consensus
Probab=21.79  E-value=62  Score=30.80  Aligned_cols=37  Identities=19%  Similarity=0.440  Sum_probs=24.7

Q ss_pred             CCcccCCCCcccCCchhhhhhhhhcCCCCc--ccCCCCC
Q psy6674         209 KQFICRFCSRHFTKSYNLLIHERTHTDERP--YSCDVCN  245 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~~~L~~H~r~HtgeKp--f~C~~Cg  245 (258)
                      ..|.|++|++.--....|..|...-+.+-+  ..|++|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            479999999876666778788664333332  3466665


No 200
>KOG4602|consensus
Probab=21.56  E-value=2.1e+02  Score=26.31  Aligned_cols=15  Identities=13%  Similarity=0.676  Sum_probs=9.9

Q ss_pred             CCcccCCCCcccCCc
Q psy6674         209 KQFICRFCSRHFTKS  223 (258)
Q Consensus       209 kp~~C~~Cgk~F~~~  223 (258)
                      +.|.|++||..-.+.
T Consensus       267 R~YVCPiCGATgDnA  281 (318)
T KOG4602|consen  267 RSYVCPICGATGDNA  281 (318)
T ss_pred             hhhcCccccccCCcc
Confidence            457888888665443


No 201
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=21.39  E-value=1.2e+02  Score=33.65  Aligned_cols=8  Identities=25%  Similarity=0.829  Sum_probs=5.6

Q ss_pred             ccCCCCCC
Q psy6674         239 YSCDVCNK  246 (258)
Q Consensus       239 f~C~~Cgk  246 (258)
                      ..|+.||.
T Consensus       710 ~~CP~CGt  717 (1337)
T PRK14714        710 VECPRCDV  717 (1337)
T ss_pred             ccCCCCCC
Confidence            36888874


No 202
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=21.27  E-value=45  Score=19.28  Aligned_cols=8  Identities=38%  Similarity=0.983  Sum_probs=3.9

Q ss_pred             CcccCCCC
Q psy6674         210 QFICRFCS  217 (258)
Q Consensus       210 p~~C~~Cg  217 (258)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            34555554


No 203
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=21.20  E-value=32  Score=30.09  Aligned_cols=21  Identities=14%  Similarity=0.517  Sum_probs=0.0

Q ss_pred             CCcccCCCCc-ccCCchhhhhh
Q psy6674         209 KQFICRFCSR-HFTKSYNLLIH  229 (258)
Q Consensus       209 kp~~C~~Cgk-~F~~~~~L~~H  229 (258)
                      +.|.|.+||. +|.-+..+.+|
T Consensus       100 ~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen  100 VEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             ----------------------
T ss_pred             CeeeeEeCCCcceecHHHHHHh
Confidence            5689999985 45555555444


No 204
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=20.56  E-value=43  Score=20.10  Aligned_cols=20  Identities=30%  Similarity=0.574  Sum_probs=10.5

Q ss_pred             cccCCCCcccCCchhhhhhhh
Q psy6674         211 FICRFCSRHFTKSYNLLIHER  231 (258)
Q Consensus       211 ~~C~~Cgk~F~~~~~L~~H~r  231 (258)
                      |.|-.|++.| .....+.|..
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT---
T ss_pred             CeeecCCCCc-CcCCcCCCCc
Confidence            4577788777 3344555543


No 205
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=20.34  E-value=43  Score=31.13  Aligned_cols=38  Identities=16%  Similarity=0.489  Sum_probs=21.4

Q ss_pred             CcccCCCCcccCCchhhhhhhhh-cCC-CCcccCCCCCCccc
Q psy6674         210 QFICRFCSRHFTKSYNLLIHERT-HTD-ERPYSCDVCNKAFR  249 (258)
Q Consensus       210 p~~C~~Cgk~F~~~~~L~~H~r~-Htg-eKpf~C~~Cgk~F~  249 (258)
                      -|.|+.||..=..  .+..+.|. -.+ -.-|.|..||..|.
T Consensus       258 ~~~C~~C~~~~~~--~~q~QtrsaDEpmT~f~~C~~Cg~~w~  297 (299)
T TIGR01385       258 LFTCGKCKQKKCT--YYQLQTRSADEPMTTFVTCEECGNRWK  297 (299)
T ss_pred             cccCCCCCCccce--EEEecccCCCCCCeEEEEcCCCCCeee
Confidence            4899999853222  22222332 112 13479999998765


No 206
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=20.04  E-value=31  Score=35.79  Aligned_cols=44  Identities=27%  Similarity=0.520  Sum_probs=0.0

Q ss_pred             cCCCCcccCCchhhhhhhhhcCCCCcc-cCCCCCCcccCchhhhhc
Q psy6674         213 CRFCSRHFTKSYNLLIHERTHTDERPY-SCDVCNKAFRRQDHLRDH  257 (258)
Q Consensus       213 C~~Cgk~F~~~~~L~~H~r~HtgeKpf-~C~~Cgk~F~~~~~L~~H  257 (258)
                      |..||.+|+.-..|-.- |-+|.-+.| .|+.|.+.|....+.+-|
T Consensus       126 CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRRfH  170 (750)
T COG0068         126 CTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRRFH  170 (750)
T ss_pred             cCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccccccc


No 207
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=20.02  E-value=34  Score=22.09  Aligned_cols=16  Identities=31%  Similarity=0.860  Sum_probs=9.8

Q ss_pred             CcccCCCCCCcccCch
Q psy6674         237 RPYSCDVCNKAFRRQD  252 (258)
Q Consensus       237 Kpf~C~~Cgk~F~~~~  252 (258)
                      .||.|..|++.|-...
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            5788999998886543


Done!