Query         psy6676
Match_columns 144
No_of_seqs    116 out of 1793
Neff          10.3
Searched_HMMs 46136
Date          Sat Aug 17 00:15:12 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6676.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6676hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8 7.6E-21 1.7E-25  128.4   5.2   86   26-113   159-244 (279)
  2 KOG2462|consensus               99.8 1.3E-19 2.9E-24  122.4   5.4   87   24-110   183-269 (279)
  3 KOG3576|consensus               99.6 4.6E-16   1E-20  101.2   1.7   87   24-110   113-199 (267)
  4 KOG3623|consensus               99.5 5.4E-15 1.2E-19  111.4   2.4   80   26-105   892-971 (1007)
  5 KOG1074|consensus               99.4 1.5E-13 3.3E-18  104.9   4.8   60   57-116   880-939 (958)
  6 KOG3576|consensus               99.4 1.5E-13 3.2E-18   89.7   1.6   93   21-113   138-241 (267)
  7 KOG3623|consensus               99.3 6.6E-13 1.4E-17  100.4   2.8   81   26-106   238-331 (1007)
  8 KOG1074|consensus               99.2 3.1E-12 6.6E-17   98.0   1.7   88   25-112   602-696 (958)
  9 PHA00733 hypothetical protein   99.2 2.1E-11 4.6E-16   75.8   3.9   84   25-110    37-125 (128)
 10 KOG3608|consensus               99.0 1.2E-09 2.5E-14   77.0   6.2   90   21-111   285-379 (467)
 11 KOG3608|consensus               98.9 9.2E-10   2E-14   77.6   4.1   90   24-114   259-351 (467)
 12 PHA02768 hypothetical protein;  98.9 4.5E-10 9.9E-15   58.7   1.5   42   57-100     6-47  (55)
 13 KOG3993|consensus               98.9 2.8E-10 6.1E-15   81.6   0.4   86   29-114   268-386 (500)
 14 PF13465 zf-H2C2_2:  Zinc-finge  98.7 5.8E-09 1.2E-13   46.8   1.4   25   71-95      1-25  (26)
 15 PHA02768 hypothetical protein;  98.7 8.4E-09 1.8E-13   54.0   2.2   43   28-72      5-47  (55)
 16 PLN03086 PRLI-interacting fact  98.7 3.3E-08 7.1E-13   74.7   5.8   78   25-107   450-537 (567)
 17 PHA00733 hypothetical protein   98.6 1.2E-07 2.6E-12   59.1   4.7   57   23-81     68-124 (128)
 18 PLN03086 PRLI-interacting fact  98.4 2.4E-07 5.3E-12   70.2   4.3   78   27-108   477-564 (567)
 19 PHA00616 hypothetical protein   98.4 1.6E-07 3.5E-12   46.9   1.9   35   28-62      1-35  (44)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.3 4.4E-07 9.5E-12   40.6   2.3   25   43-67      1-25  (26)
 21 PHA00732 hypothetical protein   98.3 5.7E-07 1.2E-11   51.2   2.4   47   28-80      1-48  (79)
 22 PHA00616 hypothetical protein   98.1 1.9E-06 4.1E-11   43.0   2.3   28   84-111     1-28  (44)
 23 PHA00732 hypothetical protein   98.1 2.9E-06 6.3E-11   48.3   3.0   48   56-109     1-49  (79)
 24 PF00096 zf-C2H2:  Zinc finger,  98.1 1.5E-06 3.2E-11   37.6   1.2   23   85-107     1-23  (23)
 25 PF05605 zf-Di19:  Drought indu  98.0 1.3E-05 2.8E-10   42.3   4.2   35   29-64      3-39  (54)
 26 KOG3993|consensus               98.0 4.4E-06 9.4E-11   60.6   2.8   53   27-79    294-379 (500)
 27 PF13894 zf-C2H2_4:  C2H2-type   97.9 5.3E-06 1.2E-10   35.9   1.5   24   85-108     1-24  (24)
 28 COG5189 SFP1 Putative transcri  97.9 2.3E-06   5E-11   60.0   0.3   71   26-106   347-420 (423)
 29 PF05605 zf-Di19:  Drought indu  97.9 2.8E-05   6E-10   41.1   3.9   50   56-108     2-53  (54)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.8 8.2E-06 1.8E-10   36.6   1.2   26   84-109     1-26  (27)
 31 PF00096 zf-C2H2:  Zinc finger,  97.8 1.8E-05 3.9E-10   34.0   1.9   22   29-50      1-22  (23)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.6 4.9E-05 1.1E-09   45.0   2.5   74   30-108     1-74  (100)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.6 7.3E-05 1.6E-09   32.2   2.2   23   29-51      1-23  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.4  0.0001 2.2E-09   32.9   1.5   24   28-51      1-24  (27)
 35 smart00355 ZnF_C2H2 zinc finge  97.4 0.00018   4E-09   31.4   2.3   24   85-108     1-24  (26)
 36 PF09237 GAGA:  GAGA factor;  I  97.0 0.00081 1.7E-08   34.5   2.3   32   80-111    20-51  (54)
 37 PF12874 zf-met:  Zinc-finger o  96.8 0.00054 1.2E-08   29.9   0.9   22   85-106     1-22  (25)
 38 PF09237 GAGA:  GAGA factor;  I  96.8  0.0017 3.8E-08   33.3   2.8   30   26-55     22-51  (54)
 39 smart00355 ZnF_C2H2 zinc finge  96.8  0.0017 3.7E-08   28.1   2.4   23   29-51      1-23  (26)
 40 PRK04860 hypothetical protein;  96.7 0.00093   2E-08   43.3   1.7   38   56-97    119-156 (160)
 41 PF13909 zf-H2C2_5:  C2H2-type   96.7 0.00089 1.9E-08   28.9   1.2   23   85-108     1-23  (24)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5 0.00091   2E-08   29.9   0.5   22   85-106     2-23  (27)
 43 PF12874 zf-met:  Zinc-finger o  96.4  0.0021 4.5E-08   28.0   1.4   22   29-50      1-22  (25)
 44 PF13909 zf-H2C2_5:  C2H2-type   96.2  0.0041 8.8E-08   26.8   1.7   23   29-52      1-23  (24)
 45 PRK04860 hypothetical protein;  95.9  0.0055 1.2E-07   39.7   2.1   39   27-69    118-156 (160)
 46 KOG4173|consensus               95.8  0.0063 1.4E-07   40.6   2.0   80   25-107    76-169 (253)
 47 KOG1146|consensus               95.7  0.0056 1.2E-07   50.8   1.5   83   20-106   457-540 (1406)
 48 PF12171 zf-C2H2_jaz:  Zinc-fin  95.6  0.0031 6.6E-08   28.1  -0.0   20   29-48      2-21  (27)
 49 PF13913 zf-C2HC_2:  zinc-finge  95.5   0.013 2.7E-07   25.7   1.7   21   85-106     3-23  (25)
 50 COG4049 Uncharacterized protei  94.8   0.015 3.3E-07   30.3   1.0   33   21-53     10-42  (65)
 51 KOG1146|consensus               93.9   0.026 5.6E-07   47.2   1.1   80   29-113  1261-1358(1406)
 52 smart00451 ZnF_U1 U1-like zinc  93.9    0.04 8.7E-07   25.8   1.4   23   84-106     3-25  (35)
 53 smart00451 ZnF_U1 U1-like zinc  93.5   0.074 1.6E-06   24.9   2.0   22   28-49      3-24  (35)
 54 cd00350 rubredoxin_like Rubred  93.2   0.053 1.2E-06   25.3   1.1    9   83-91     16-24  (33)
 55 COG4049 Uncharacterized protei  93.1   0.059 1.3E-06   28.2   1.3   30   79-108    12-41  (65)
 56 COG5236 Uncharacterized conser  93.1   0.065 1.4E-06   38.7   1.9   79   28-108   151-244 (493)
 57 PF09538 FYDLN_acid:  Protein o  92.6   0.089 1.9E-06   31.8   1.8   15   83-97     25-39  (108)
 58 PF09538 FYDLN_acid:  Protein o  91.7    0.14   3E-06   31.0   1.9   30   29-69     10-39  (108)
 59 KOG2482|consensus               91.1    0.26 5.5E-06   35.7   3.0   79   28-106   195-356 (423)
 60 COG1592 Rubrerythrin [Energy p  91.0    0.13 2.9E-06   33.5   1.4   24   56-92    134-157 (166)
 61 PF12756 zf-C2H2_2:  C2H2 type   90.5    0.33 7.2E-06   28.2   2.7   24   56-79     50-73  (100)
 62 KOG2231|consensus               90.3    0.42 9.2E-06   37.8   3.8   81   29-112   100-210 (669)
 63 KOG2893|consensus               89.8   0.095 2.1E-06   36.0  -0.0   28   33-64     15-42  (341)
 64 COG5048 FOG: Zn-finger [Genera  89.7   0.087 1.9E-06   38.8  -0.3   60   28-87    289-354 (467)
 65 PF12013 DUF3505:  Protein of u  88.9    0.75 1.6E-05   27.7   3.5   26   84-109    80-109 (109)
 66 COG1592 Rubrerythrin [Energy p  88.7    0.27 5.8E-06   32.1   1.4   24   28-64    134-157 (166)
 67 cd00729 rubredoxin_SM Rubredox  88.6    0.26 5.7E-06   23.2   1.0   10   57-66      3-12  (34)
 68 COG5048 FOG: Zn-finger [Genera  88.6    0.12 2.7E-06   38.0  -0.2   59   55-113   288-352 (467)
 69 KOG2893|consensus               88.2    0.16 3.6E-06   34.9   0.2   42   59-104    13-54  (341)
 70 COG5189 SFP1 Putative transcri  87.5    0.55 1.2E-05   33.8   2.4   28   82-109   347-376 (423)
 71 PF09986 DUF2225:  Uncharacteri  87.2   0.078 1.7E-06   36.1  -1.8   17   26-42      3-19  (214)
 72 KOG2482|consensus               85.9    0.85 1.8E-05   33.2   2.7   54   25-78    141-217 (423)
 73 PF02892 zf-BED:  BED zinc fing  85.8    0.65 1.4E-05   23.0   1.6   26   81-106    13-42  (45)
 74 TIGR00622 ssl1 transcription f  85.6     1.3 2.7E-05   27.0   3.0   82   27-110    14-107 (112)
 75 TIGR02300 FYDLN_acid conserved  84.9    0.56 1.2E-05   29.1   1.3   14   55-68     25-38  (129)
 76 KOG2186|consensus               84.6    0.63 1.4E-05   32.3   1.6   47   29-78      4-50  (276)
 77 PF05443 ROS_MUCR:  ROS/MUCR tr  83.0    0.63 1.4E-05   29.2   1.0   25   83-110    71-95  (132)
 78 KOG2231|consensus               82.9     1.7 3.8E-05   34.6   3.5   69   29-105   183-260 (669)
 79 KOG2186|consensus               82.9    0.94   2E-05   31.5   1.9   46   57-105     4-49  (276)
 80 COG5236 Uncharacterized conser  82.8     2.7 5.9E-05   30.7   4.2   79   30-113   222-310 (493)
 81 smart00614 ZnF_BED BED zinc fi  82.1    0.99 2.1E-05   23.1   1.4   22   84-105    18-44  (50)
 82 TIGR00373 conserved hypothetic  82.1     1.5 3.3E-05   28.4   2.6   34   53-95    106-139 (158)
 83 PRK06266 transcription initiat  81.9     0.7 1.5E-05   30.6   0.9   34   54-96    115-148 (178)
 84 KOG2785|consensus               81.8     1.5 3.3E-05   32.3   2.7   73   29-106   167-242 (390)
 85 KOG3408|consensus               80.9     1.2 2.6E-05   27.3   1.6   27   80-106    53-79  (129)
 86 TIGR00373 conserved hypothetic  80.8       1 2.2E-05   29.2   1.4   35   24-67    105-139 (158)
 87 COG1997 RPL43A Ribosomal prote  80.0    0.89 1.9E-05   26.2   0.8   33   55-97     34-66  (89)
 88 PRK06266 transcription initiat  79.8     1.6 3.4E-05   28.9   2.1   34   25-67    114-147 (178)
 89 PRK00464 nrdR transcriptional   79.2    0.41 8.9E-06   30.9  -0.8   13   57-69     29-41  (154)
 90 PF13719 zinc_ribbon_5:  zinc-r  78.4     1.4 3.1E-05   21.0   1.2   10   31-40      5-14  (37)
 91 COG2888 Predicted Zn-ribbon RN  77.9     1.2 2.6E-05   23.7   0.8   33   55-92     26-58  (61)
 92 smart00531 TFIIE Transcription  77.8     3.7 8.1E-05   26.2   3.3   39   53-95     96-134 (147)
 93 PF07800 DUF1644:  Protein of u  77.3      16 0.00035   23.7   5.9   90   24-118    25-142 (162)
 94 TIGR02605 CxxC_CxxC_SSSS putat  77.2     0.7 1.5E-05   23.7  -0.1   11   57-67      6-16  (52)
 95 TIGR02098 MJ0042_CXXC MJ0042 f  75.1     1.7 3.6E-05   20.7   0.9   10   30-39      4-13  (38)
 96 KOG2071|consensus               75.0     2.3 4.9E-05   33.2   2.0   26   26-51    416-441 (579)
 97 smart00734 ZnF_Rad18 Rad18-lik  74.5     3.3 7.2E-05   18.1   1.7   18   30-48      3-20  (26)
 98 smart00834 CxxC_CXXC_SSSS Puta  73.5    0.95 2.1E-05   21.8  -0.2   11   57-67      6-16  (41)
 99 PF04959 ARS2:  Arsenite-resist  73.3     1.7 3.7E-05   29.7   0.9   25   57-81     78-102 (214)
100 COG1198 PriA Primosomal protei  72.9     1.2 2.6E-05   35.9   0.2   48   30-93    437-484 (730)
101 smart00659 RPOLCX RNA polymera  71.8     2.5 5.5E-05   21.1   1.1   10   29-38      3-12  (44)
102 KOG1280|consensus               70.5     5.3 0.00011   29.3   2.8   39   25-63     76-116 (381)
103 PRK00398 rpoP DNA-directed RNA  69.6     2.7 5.8E-05   21.0   0.9   10   29-38      4-13  (46)
104 KOG2785|consensus               69.4     8.3 0.00018   28.6   3.7   24   55-78    216-242 (390)
105 PF15135 UPF0515:  Uncharacteri  69.0     3.2   7E-05   28.9   1.5   63   22-97    106-168 (278)
106 PF12013 DUF3505:  Protein of u  68.0     5.1 0.00011   24.0   2.1   26   28-53     80-109 (109)
107 PF05191 ADK_lid:  Adenylate ki  67.8     2.7 5.8E-05   20.0   0.7    9   30-38      3-11  (36)
108 COG4530 Uncharacterized protei  67.6     3.6 7.8E-05   24.9   1.3   13   54-66     24-36  (129)
109 KOG4173|consensus               66.4     3.7 8.1E-05   27.8   1.3   49   55-106    78-128 (253)
110 PF07754 DUF1610:  Domain of un  66.3     2.4 5.1E-05   18.3   0.3   10   83-92     15-24  (24)
111 KOG2907|consensus               66.3       2 4.4E-05   26.0   0.1   40   57-96     75-114 (116)
112 PF13878 zf-C2H2_3:  zinc-finge  66.1     7.7 0.00017   18.9   2.2   24   29-52     14-39  (41)
113 PRK09678 DNA-binding transcrip  66.0     1.4 2.9E-05   24.6  -0.6   42   57-100     2-45  (72)
114 PF12760 Zn_Tnp_IS1595:  Transp  65.5       6 0.00013   19.7   1.8   11   82-92     35-45  (46)
115 COG4957 Predicted transcriptio  64.9       3 6.5E-05   26.2   0.7   24   85-111    77-100 (148)
116 PHA00626 hypothetical protein   64.9     2.5 5.4E-05   22.2   0.3   17   82-98     21-37  (59)
117 COG3357 Predicted transcriptio  64.7     4.8  0.0001   23.4   1.4   28   55-92     57-84  (97)
118 smart00440 ZnF_C2C2 C2C2 Zinc   64.6    0.69 1.5E-05   22.6  -1.8   10   85-94     29-38  (40)
119 KOG0782|consensus               64.5     1.1 2.5E-05   34.9  -1.5   51   42-98    239-290 (1004)
120 KOG4167|consensus               64.2     2.2 4.8E-05   34.3  -0.0   27   83-109   791-817 (907)
121 PRK14890 putative Zn-ribbon RN  63.6     5.4 0.00012   21.3   1.4   51   26-92      5-56  (59)
122 PRK03824 hypA hydrogenase nick  63.3     2.7 5.9E-05   26.5   0.3   10   83-92    106-115 (135)
123 PTZ00255 60S ribosomal protein  63.0     1.9 4.1E-05   25.1  -0.4   33   55-97     35-67  (90)
124 TIGR00280 L37a ribosomal prote  62.7     1.7 3.6E-05   25.4  -0.7   33   55-97     34-66  (91)
125 KOG2593|consensus               62.3     5.6 0.00012   30.0   1.7   38   24-64    124-161 (436)
126 COG5112 UFD2 U1-like Zn-finger  61.5     5.5 0.00012   23.9   1.3   26   81-106    52-77  (126)
127 PF10571 UPF0547:  Uncharacteri  60.3     3.7 7.9E-05   18.0   0.3    9   86-94     16-24  (26)
128 PF13717 zinc_ribbon_4:  zinc-r  60.1     4.5 9.8E-05   19.1   0.7   32   30-66      4-35  (36)
129 PF00301 Rubredoxin:  Rubredoxi  59.5     2.9 6.4E-05   21.2  -0.0   11   29-39      2-12  (47)
130 KOG3408|consensus               58.4     6.6 0.00014   24.2   1.3   26   25-50     54-79  (129)
131 PF08274 PhnA_Zn_Ribbon:  PhnA   57.5     3.8 8.2E-05   18.7   0.1    7   57-63     20-26  (30)
132 COG1996 RPC10 DNA-directed RNA  57.1     5.4 0.00012   20.4   0.7   11   28-38      6-16  (49)
133 COG1571 Predicted DNA-binding   56.8     6.5 0.00014   29.7   1.3   14   84-97    367-380 (421)
134 PF06524 NOA36:  NOA36 protein;  56.8     5.1 0.00011   28.2   0.7   84   23-107   137-232 (314)
135 TIGR00595 priA primosomal prot  56.8     3.2 6.9E-05   32.2  -0.3   11   82-92    251-261 (505)
136 PRK03976 rpl37ae 50S ribosomal  56.5     2.3 4.9E-05   24.8  -0.8   33   55-97     35-67  (90)
137 PRK14873 primosome assembly pr  56.2     6.5 0.00014   31.7   1.3   44   30-93    385-431 (665)
138 PF08790 zf-LYAR:  LYAR-type C2  55.7     1.6 3.5E-05   19.5  -1.2   19   85-104     1-19  (28)
139 PF04959 ARS2:  Arsenite-resist  54.5      10 0.00022   26.0   1.8   30   24-53     73-102 (214)
140 COG1655 Uncharacterized protei  54.3     3.1 6.6E-05   28.7  -0.6    8   85-92     63-70  (267)
141 PF09723 Zn-ribbon_8:  Zinc rib  53.3     4.2   9E-05   19.9  -0.1   15   85-99      6-20  (42)
142 KOG0717|consensus               52.7     7.2 0.00016   29.8   1.0   21   85-105   293-313 (508)
143 KOG2593|consensus               52.1     7.4 0.00016   29.4   1.0   35   54-91    126-160 (436)
144 KOG2636|consensus               52.0     9.9 0.00021   28.9   1.6   29   77-105   394-423 (497)
145 PF15269 zf-C2H2_7:  Zinc-finge  51.7      10 0.00022   19.0   1.1   22   57-78     21-42  (54)
146 COG3091 SprT Zn-dependent meta  51.5     6.3 0.00014   25.4   0.5   32   56-92    117-148 (156)
147 KOG4377|consensus               50.9     9.6 0.00021   28.7   1.4   50    3-52    237-297 (480)
148 cd00924 Cyt_c_Oxidase_Vb Cytoc  49.9     7.4 0.00016   23.1   0.6   16   23-39     75-90  (97)
149 KOG1994|consensus               49.8     7.3 0.00016   26.8   0.6   22   83-104   238-259 (268)
150 KOG0978|consensus               49.6     5.2 0.00011   32.2  -0.1   20   84-103   678-697 (698)
151 PLN03238 probable histone acet  48.9      19  0.0004   25.9   2.5   31   81-111    45-75  (290)
152 PF04780 DUF629:  Protein of un  48.3      11 0.00025   28.9   1.5   33   79-111    52-84  (466)
153 PRK04023 DNA polymerase II lar  47.8      14 0.00031   31.2   2.0   12   26-37    624-635 (1121)
154 PF03604 DNA_RNApol_7kD:  DNA d  47.6      16 0.00035   16.8   1.4    8   85-92     18-25  (32)
155 PF01096 TFIIS_C:  Transcriptio  47.5    0.54 1.2E-05   22.8  -3.8   10   85-94     29-38  (39)
156 KOG4167|consensus               47.4     4.6  0.0001   32.6  -0.7   27   26-52    790-816 (907)
157 PF04216 FdhE:  Protein involve  46.7     1.4   3E-05   31.5  -3.4    9   29-37    173-181 (290)
158 COG1773 Rubredoxin [Energy pro  46.3     6.8 0.00015   20.6   0.0   14   84-97      3-16  (55)
159 PF07282 OrfB_Zn_ribbon:  Putat  46.0      13 0.00028   20.1   1.2   11   83-93     45-55  (69)
160 KOG0978|consensus               44.8     8.4 0.00018   31.1   0.4   49   26-74    641-696 (698)
161 PF04423 Rad50_zn_hook:  Rad50   44.7      22 0.00047   18.3   1.8   10   58-67     22-31  (54)
162 PRK05580 primosome assembly pr  44.2     6.3 0.00014   31.8  -0.4   10   83-92    420-429 (679)
163 PF10083 DUF2321:  Uncharacteri  43.8     4.7  0.0001   26.0  -0.9   19   80-98     64-82  (158)
164 TIGR00100 hypA hydrogenase nic  43.8      10 0.00023   23.1   0.6   10   57-66     71-80  (115)
165 PF10276 zf-CHCC:  Zinc-finger   43.3      11 0.00024   18.4   0.5   12   27-38     28-39  (40)
166 PRK12380 hydrogenase nickel in  43.2      12 0.00026   22.8   0.8   10   57-66     71-80  (113)
167 KOG4124|consensus               42.9     2.3   5E-05   31.1  -2.7   71   26-105   347-419 (442)
168 PF13824 zf-Mss51:  Zinc-finger  42.7      19 0.00041   18.9   1.4   13   54-66     12-24  (55)
169 KOG1842|consensus               42.6      14 0.00029   28.2   1.1   21   57-77     16-36  (505)
170 PRK03564 formate dehydrogenase  42.5      13 0.00029   27.0   1.0   14   25-38    184-197 (309)
171 PF11931 DUF3449:  Domain of un  42.3     8.3 0.00018   26.0   0.0   27   78-104    95-122 (196)
172 PF13451 zf-trcl:  Probable zin  42.1      10 0.00022   19.5   0.3   20   82-101     2-21  (49)
173 PHA02998 RNA polymerase subuni  42.0     4.2   9E-05   26.9  -1.4   41   57-97    144-184 (195)
174 PF10013 DUF2256:  Uncharacteri  42.0      14  0.0003   18.2   0.8   12   86-97     10-21  (42)
175 COG0068 HypF Hydrogenase matur  41.7     4.3 9.2E-05   32.7  -1.6   55   31-92    126-181 (750)
176 PF12907 zf-met2:  Zinc-binding  41.7      24 0.00052   17.2   1.6   25   85-109     2-29  (40)
177 TIGR00686 phnA alkylphosphonat  41.0      12 0.00026   22.6   0.5   12   56-67     19-30  (109)
178 COG5027 SAS2 Histone acetyltra  40.5      20 0.00043   26.5   1.6   32   82-113   156-187 (395)
179 PRK00432 30S ribosomal protein  40.1      12 0.00027   19.1   0.4   10   56-65     37-46  (50)
180 TIGR01562 FdhE formate dehydro  40.1      23 0.00049   25.7   1.9   11   27-37    183-193 (305)
181 PLN00104 MYST -like histone ac  40.1      24 0.00053   27.0   2.1   30   82-111   196-225 (450)
182 PF02176 zf-TRAF:  TRAF-type zi  39.5      14  0.0003   19.2   0.6   25   71-95     25-53  (60)
183 PTZ00064 histone acetyltransfe  39.4      28  0.0006   27.2   2.3   30   81-110   277-306 (552)
184 COG1327 Predicted transcriptio  39.4     6.9 0.00015   25.2  -0.7   12   57-68     29-40  (156)
185 KOG2747|consensus               39.1      25 0.00054   26.5   2.0   33   82-114   156-188 (396)
186 smart00154 ZnF_AN1 AN1-like Zi  38.3      15 0.00033   17.7   0.6   14   28-41     12-25  (39)
187 cd00730 rubredoxin Rubredoxin;  37.9      11 0.00025   19.3   0.1   13   85-97      2-14  (50)
188 PF01363 FYVE:  FYVE zinc finge  37.6      15 0.00032   19.9   0.5    9   30-38     11-19  (69)
189 COG5151 SSL1 RNA polymerase II  36.9      44 0.00096   24.4   2.9   29   82-110   386-414 (421)
190 smart00661 RPOL9 RNA polymeras  36.7      16 0.00035   18.4   0.5   10   84-93     20-29  (52)
191 COG3677 Transposase and inacti  35.9      17 0.00036   22.8   0.6   16   82-97     51-66  (129)
192 PRK05978 hypothetical protein;  35.4      19 0.00042   23.1   0.8   10   86-95     54-63  (148)
193 KOG0717|consensus               35.2      24 0.00051   27.2   1.4   22   29-50    293-314 (508)
194 PF04780 DUF629:  Protein of un  35.1      32 0.00069   26.6   2.1   24   27-50     56-79  (466)
195 PLN02294 cytochrome c oxidase   35.0      18 0.00039   23.8   0.7   16   26-41    139-154 (174)
196 PF07975 C1_4:  TFIIH C1-like d  34.8     6.4 0.00014   20.4  -1.1   18   27-44     20-37  (51)
197 COG1675 TFA1 Transcription ini  34.7      22 0.00047   23.6   1.0   34   52-94    109-142 (176)
198 KOG2807|consensus               34.5      68  0.0015   23.6   3.5   27   83-109   344-370 (378)
199 KOG0320|consensus               34.5      20 0.00044   23.8   0.8   14   26-39    129-142 (187)
200 smart00064 FYVE Protein presen  34.2      23 0.00049   19.0   0.9   10   30-39     12-21  (68)
201 PF09845 DUF2072:  Zn-ribbon co  33.9      21 0.00046   22.4   0.8   14   28-41      1-14  (131)
202 PF01286 XPA_N:  XPA protein N-  33.6      12 0.00027   17.5  -0.2   11   58-68      5-15  (34)
203 COG5188 PRP9 Splicing factor 3  33.1      24 0.00053   26.1   1.1   23   83-105   237-259 (470)
204 COG3364 Zn-ribbon containing p  32.8      22 0.00047   21.3   0.7   12   56-67      2-13  (112)
205 PRK10220 hypothetical protein;  32.6      26 0.00056   21.3   1.0   11   56-66     20-30  (111)
206 PRK00564 hypA hydrogenase nick  32.5      20 0.00044   21.9   0.6    9   57-65     72-80  (117)
207 cd00065 FYVE FYVE domain; Zinc  32.5      30 0.00064   17.7   1.2    9   31-39      5-13  (57)
208 PF14803 Nudix_N_2:  Nudix N-te  32.2     4.3 9.2E-05   19.1  -1.9    6   86-91     24-29  (34)
209 PRK14714 DNA polymerase II lar  31.6      34 0.00073   29.9   1.8   10   28-37    667-676 (1337)
210 COG1594 RPB9 DNA-directed RNA   31.0      10 0.00022   23.2  -0.9   15   27-41     21-35  (113)
211 COG4391 Uncharacterized protei  30.6      19  0.0004   19.4   0.2   14   26-39     46-59  (62)
212 COG4888 Uncharacterized Zn rib  30.5     6.4 0.00014   23.4  -1.7   13   26-38     20-32  (104)
213 PF14311 DUF4379:  Domain of un  30.4      38 0.00082   17.4   1.4    9   29-37     29-37  (55)
214 PTZ00448 hypothetical protein;  30.2      35 0.00076   25.4   1.6   23   84-106   314-336 (373)
215 PF10537 WAC_Acf1_DNA_bd:  ATP-  29.6      80  0.0017   18.9   2.8   38   27-65      2-39  (102)
216 KOG2636|consensus               29.5      41 0.00088   25.8   1.8   27   51-77    396-423 (497)
217 PF01428 zf-AN1:  AN1-like Zinc  29.2      17 0.00038   17.7  -0.1   16   27-42     12-27  (43)
218 PRK00420 hypothetical protein;  27.9      33 0.00071   21.0   0.9   10   85-94     41-50  (112)
219 COG4338 Uncharacterized protei  27.7      21 0.00045   18.2   0.1   12   86-97     14-25  (54)
220 PRK05452 anaerobic nitric oxid  27.6      18 0.00039   27.9  -0.2   14   55-68    424-437 (479)
221 PRK03681 hypA hydrogenase nick  27.6      20 0.00043   21.8  -0.0   10   57-66     71-80  (114)
222 PRK14138 NAD-dependent deacety  26.7      75  0.0016   22.2   2.7   40   21-64    112-151 (244)
223 KOG2071|consensus               26.7      40 0.00086   26.8   1.4   26   83-108   417-442 (579)
224 PF08792 A2L_zn_ribbon:  A2L zi  26.7      23 0.00051   16.4   0.1   11   85-95     22-32  (33)
225 KOG4118|consensus               26.6      45 0.00097   18.2   1.2   27   85-111    39-65  (74)
226 PRK00762 hypA hydrogenase nick  26.5      27 0.00058   21.7   0.4   10   57-67     71-80  (124)
227 PF06397 Desulfoferrod_N:  Desu  26.4      25 0.00055   16.7   0.2   11   83-93      5-15  (36)
228 PLN03239 histone acetyltransfe  26.1      66  0.0014   23.9   2.3   25   82-106   104-128 (351)
229 PF11672 DUF3268:  Protein of u  26.1      32 0.00069   20.6   0.7   11   27-37      1-11  (102)
230 TIGR01384 TFS_arch transcripti  26.1     9.2  0.0002   22.7  -1.7   14   27-40     15-28  (104)
231 PF01155 HypA:  Hydrogenase exp  25.7      20 0.00042   21.8  -0.3   10   57-66     71-80  (113)
232 PF09416 UPF1_Zn_bind:  RNA hel  25.5      79  0.0017   20.5   2.4   11   82-92     58-68  (152)
233 KOG2932|consensus               25.4      86  0.0019   23.0   2.7   29   80-108   140-171 (389)
234 PF07295 DUF1451:  Protein of u  25.4      28 0.00061   22.3   0.4   28   55-92    111-138 (146)
235 KOG4727|consensus               25.4      33 0.00072   22.6   0.7   23   83-105    74-96  (193)
236 PF14353 CpXC:  CpXC protein     24.9      26 0.00057   21.6   0.2   25   83-107    37-61  (128)
237 COG5216 Uncharacterized conser  24.5      45 0.00098   17.8   1.0    9   54-62     42-50  (67)
238 KOG2857|consensus               24.2      92   0.002   20.0   2.4   21   57-77     18-38  (157)
239 COG4306 Uncharacterized protei  24.2      24 0.00052   22.0  -0.1   14   55-68     67-80  (160)
240 KOG3214|consensus               24.0      24 0.00053   21.0  -0.1   13   84-96     47-59  (109)
241 TIGR00627 tfb4 transcription f  23.4      48   0.001   23.8   1.2   10   85-94    256-265 (279)
242 PF03966 Trm112p:  Trm112p-like  23.2      32 0.00068   18.7   0.3   19   22-40     47-65  (68)
243 KOG0696|consensus               22.8      27 0.00058   26.9  -0.1   46   46-92     83-129 (683)
244 KOG1409|consensus               22.1      28  0.0006   25.8  -0.1    8   59-66    285-292 (404)
245 PF14787 zf-CCHC_5:  GAG-polypr  22.0      29 0.00063   16.5  -0.0   15   86-100     4-18  (36)
246 cd01410 SIRT7 SIRT7: Eukaryoti  22.0 1.4E+02   0.003   20.2   3.2   41   21-64     88-128 (206)
247 PF13821 DUF4187:  Domain of un  22.0      46   0.001   17.4   0.7   19   84-102    27-45  (55)
248 COG4640 Predicted membrane pro  21.6      58  0.0013   24.7   1.4   14   87-100    18-31  (465)
249 PF08209 Sgf11:  Sgf11 (transcr  21.5      51  0.0011   15.3   0.7   22   85-107     5-26  (33)
250 TIGR00515 accD acetyl-CoA carb  21.5      47   0.001   23.9   0.9   32   29-69     27-58  (285)
251 PF10263 SprT-like:  SprT-like   21.3      21 0.00045   22.7  -0.8   10   85-94    144-153 (157)
252 COG1779 C4-type Zn-finger prot  21.0      13 0.00028   25.1  -1.8    7   30-36     16-22  (201)
253 PF05495 zf-CHY:  CHY zinc fing  20.5      12 0.00027   20.6  -1.7   57   29-93     11-70  (71)
254 PF04988 AKAP95:  A-kinase anch  20.4      70  0.0015   21.0   1.4   21   29-49      1-21  (165)
255 KOG4696|consensus               20.4      65  0.0014   23.5   1.4   29   86-115     4-32  (393)
256 KOG4602|consensus               20.1      39 0.00085   23.9   0.3   11   83-93    267-277 (318)

No 1  
>KOG2462|consensus
Probab=99.83  E-value=7.6e-21  Score=128.41  Aligned_cols=86  Identities=35%  Similarity=0.692  Sum_probs=76.9

Q ss_pred             CCcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHhHh
Q psy6676          26 EKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRHSL  105 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  105 (144)
                      ++-+.|++|++.|.....|..|+++|.  .++.|.+||+.|...+.|+.|+|.|+||+||.|..|+|+|...++|+.|++
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ  236 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ  236 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHH
Confidence            566889999999999999999999986  578999999999999999999999999999999999999999999999999


Q ss_pred             hccCCCCC
Q psy6676         106 THNLGSAT  113 (144)
Q Consensus       106 ~h~~~~~~  113 (144)
                      +|......
T Consensus       237 THS~~K~~  244 (279)
T KOG2462|consen  237 THSDVKKH  244 (279)
T ss_pred             hhcCCccc
Confidence            99876543


No 2  
>KOG2462|consensus
Probab=99.79  E-value=1.3e-19  Score=122.42  Aligned_cols=87  Identities=38%  Similarity=0.735  Sum_probs=80.6

Q ss_pred             CCCCcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHh
Q psy6676          24 SKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRH  103 (144)
Q Consensus        24 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H  103 (144)
                      ...-+++|.+||+.|-..=-|+.|+++|+|++||.|+.|++.|...++|+-||++|.+.++|.|..|+|.|...+.|.+|
T Consensus       183 TH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH  262 (279)
T KOG2462|consen  183 THTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKH  262 (279)
T ss_pred             ccCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHh
Confidence            34478999999999999888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhccCC
Q psy6676         104 SLTHNLG  110 (144)
Q Consensus       104 ~~~h~~~  110 (144)
                      ....-..
T Consensus       263 ~ES~C~~  269 (279)
T KOG2462|consen  263 SESACLK  269 (279)
T ss_pred             hhhcccc
Confidence            9764433


No 3  
>KOG3576|consensus
Probab=99.58  E-value=4.6e-16  Score=101.22  Aligned_cols=87  Identities=36%  Similarity=0.702  Sum_probs=79.6

Q ss_pred             CCCCcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHh
Q psy6676          24 SKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRH  103 (144)
Q Consensus        24 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H  103 (144)
                      .+.-.|.|.+|++.|....-|.+|++.|...+.+.|..||+.|...-.|.+|++.|+|.+||+|..|+|+|+..-.|..|
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            34556899999999999999999999999889999999999999999999999999999999999999999999999999


Q ss_pred             HhhccCC
Q psy6676         104 SLTHNLG  110 (144)
Q Consensus       104 ~~~h~~~  110 (144)
                      ++.-|..
T Consensus       193 l~kvhgv  199 (267)
T KOG3576|consen  193 LKKVHGV  199 (267)
T ss_pred             HHHHcCc
Confidence            9765533


No 4  
>KOG3623|consensus
Probab=99.51  E-value=5.4e-15  Score=111.37  Aligned_cols=80  Identities=29%  Similarity=0.652  Sum_probs=76.6

Q ss_pred             CCcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHhHh
Q psy6676          26 EKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRHSL  105 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  105 (144)
                      ...|.|..|++.|--...|.+|.-.|.|.+||.|.+|.+.|..+-.|..|+|.|.|++||.|.+|+|.|+....+.+|+.
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            46799999999999999999999999999999999999999999999999999999999999999999999999999984


No 5  
>KOG1074|consensus
Probab=99.43  E-value=1.5e-13  Score=104.89  Aligned_cols=60  Identities=33%  Similarity=0.619  Sum_probs=56.4

Q ss_pred             cccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHhHhhccCCCCCCCC
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRHSLTHNLGSATSTS  116 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~  116 (144)
                      ..|.+|++.|.....|..|+++|+++++|.|.+|++.|....+|+.|+.+|++......-
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~srr  939 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPSRR  939 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCccC
Confidence            679999999999999999999999999999999999999999999999999998776655


No 6  
>KOG3576|consensus
Probab=99.37  E-value=1.5e-13  Score=89.65  Aligned_cols=93  Identities=34%  Similarity=0.523  Sum_probs=83.5

Q ss_pred             cccCCCCcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCC-----------CCCcccCc
Q psy6676          21 YIHSKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTD-----------IKPYNCAA   89 (144)
Q Consensus        21 ~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~-----------~~~~~C~~   89 (144)
                      +.|+..+.|.|..||+.|.+.-+|.+|+++|+|.+||+|..|++.|...-.|..|.+.-++           .+.|+|..
T Consensus       138 kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vced  217 (267)
T KOG3576|consen  138 KCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCED  217 (267)
T ss_pred             hhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecc
Confidence            6788899999999999999999999999999999999999999999999999999864333           35689999


Q ss_pred             chhhhcChHHHHHhHhhccCCCCC
Q psy6676          90 CGKVFRRNCDLRRHSLTHNLGSAT  113 (144)
Q Consensus        90 C~~~f~~~~~l~~H~~~h~~~~~~  113 (144)
                      ||.+-.....+..|++.||..++.
T Consensus       218 cg~t~~~~e~~~~h~~~~hp~Spa  241 (267)
T KOG3576|consen  218 CGYTSERPEVYYLHLKLHHPFSPA  241 (267)
T ss_pred             cCCCCCChhHHHHHHHhcCCCCHH
Confidence            999999999999999999977654


No 7  
>KOG3623|consensus
Probab=99.33  E-value=6.6e-13  Score=100.37  Aligned_cols=81  Identities=31%  Similarity=0.613  Sum_probs=71.4

Q ss_pred             CCcccccccccccCChHHHHHHHHHhCCC-------------CCcccccccccccCchHHHHHHhhcCCCCCcccCcchh
Q psy6676          26 EKPFKCTECGKGFCQSRTLAVHKILHLEE-------------SPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGK   92 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~-------------~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   92 (144)
                      +..|.|..|..+|.+...|.+|+..|...             +.|+|..|++.|..+-.|+.|+|+|.|++||.|..|+|
T Consensus       238 e~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkK  317 (1007)
T KOG3623|consen  238 EPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKK  317 (1007)
T ss_pred             CCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCccccc
Confidence            45588999999999999999998877432             44999999999999999999999999999999999999


Q ss_pred             hhcChHHHHHhHhh
Q psy6676          93 VFRRNCDLRRHSLT  106 (144)
Q Consensus        93 ~f~~~~~l~~H~~~  106 (144)
                      .|+....+..|+..
T Consensus       318 RFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  318 RFSHSGSYSSHMSS  331 (1007)
T ss_pred             ccccCCcccccccc
Confidence            99999999999853


No 8  
>KOG1074|consensus
Probab=99.22  E-value=3.1e-12  Score=97.97  Aligned_cols=88  Identities=30%  Similarity=0.594  Sum_probs=79.3

Q ss_pred             CCCcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCC----CCcccC---cchhhhcCh
Q psy6676          25 KEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDI----KPYNCA---ACGKVFRRN   97 (144)
Q Consensus        25 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~----~~~~C~---~C~~~f~~~   97 (144)
                      ...|..|-+|.+..-....|+.|+++|+|++||+|.+|++.|..+.+|+.|+..|...    ..+.|+   +|-+.|...
T Consensus       602 ~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~  681 (958)
T KOG1074|consen  602 RTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNA  681 (958)
T ss_pred             cCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccc
Confidence            3466889999999999999999999999999999999999999999999999888654    447899   999999999


Q ss_pred             HHHHHhHhhccCCCC
Q psy6676          98 CDLRRHSLTHNLGSA  112 (144)
Q Consensus        98 ~~l~~H~~~h~~~~~  112 (144)
                      -.|..|.++|..+..
T Consensus       682 V~lpQhIriH~~~~~  696 (958)
T KOG1074|consen  682 VTLPQHIRIHLGGQI  696 (958)
T ss_pred             ccccceEEeecCCCC
Confidence            999999999985433


No 9  
>PHA00733 hypothetical protein
Probab=99.19  E-value=2.1e-11  Score=75.82  Aligned_cols=84  Identities=21%  Similarity=0.312  Sum_probs=70.1

Q ss_pred             CCCcccccccccccCChHHHHHH--H---HHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHH
Q psy6676          25 KEKPFKCTECGKGFCQSRTLAVH--K---ILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCD   99 (144)
Q Consensus        25 ~~~~~~C~~C~~~f~~~~~l~~h--~---~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~   99 (144)
                      .++++.|..|...|.....|..+  .   ..+.+.++|.|..|++.|.....|..|++.+  ..+|.|..|++.|.....
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHH
Confidence            36779999999999887777665  1   1234467899999999999999999999876  357999999999999999


Q ss_pred             HHHhHhhccCC
Q psy6676         100 LRRHSLTHNLG  110 (144)
Q Consensus       100 l~~H~~~h~~~  110 (144)
                      |..|+...|..
T Consensus       115 L~~H~~~~h~~  125 (128)
T PHA00733        115 TLDHVCKKHNI  125 (128)
T ss_pred             HHHHHHHhcCc
Confidence            99999887643


No 10 
>KOG3608|consensus
Probab=98.99  E-value=1.2e-09  Score=77.05  Aligned_cols=90  Identities=29%  Similarity=0.554  Sum_probs=55.5

Q ss_pred             cccCCCCcccccccccccCChHHHHHHHHHhCCCCCccccc--ccccccCchHHHHHHhhcC-C--CCCcccCcchhhhc
Q psy6676          21 YIHSKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPV--CSRSFNQRSNLKTHLLTHT-D--IKPYNCAACGKVFR   95 (144)
Q Consensus        21 ~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~--C~~~~~~~~~l~~h~~~h~-~--~~~~~C~~C~~~f~   95 (144)
                      ..|+..+||+|..|+..+.++.+|..|+.+|. ...|.|..  |...+.+...+..|++.+. +  ..+|.|-.|.+.|+
T Consensus       285 ~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft  363 (467)
T KOG3608|consen  285 YRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFT  363 (467)
T ss_pred             hhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhc
Confidence            44566666666666666666666666666555 44566655  6666666666666665432 2  33466777777777


Q ss_pred             ChHHHHHhHhhccCCC
Q psy6676          96 RNCDLRRHSLTHNLGS  111 (144)
Q Consensus        96 ~~~~l~~H~~~h~~~~  111 (144)
                      +..+|..|+...|...
T Consensus       364 ~G~~L~~HL~kkH~f~  379 (467)
T KOG3608|consen  364 SGKSLSAHLMKKHGFR  379 (467)
T ss_pred             cchhHHHHHHHhhccc
Confidence            7777777766555443


No 11 
>KOG3608|consensus
Probab=98.94  E-value=9.2e-10  Score=77.56  Aligned_cols=90  Identities=26%  Similarity=0.510  Sum_probs=80.2

Q ss_pred             CCCCcccccccccccCChHHHHHHHHH-hCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCc--chhhhcChHHH
Q psy6676          24 SKEKPFKCTECGKGFCQSRTLAVHKIL-HLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAA--CGKVFRRNCDL  100 (144)
Q Consensus        24 ~~~~~~~C~~C~~~f~~~~~l~~h~~~-~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~--C~~~f~~~~~l  100 (144)
                      .....|+|+.|+........|..|++. |...+||+|..|...|.....|..|...|. +..|.|..  |...|.+...+
T Consensus       259 rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~  337 (467)
T KOG3608|consen  259 RHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQM  337 (467)
T ss_pred             HhhhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHH
Confidence            345679999999999999999999875 777899999999999999999999999888 68899987  99999999999


Q ss_pred             HHhHhhccCCCCCC
Q psy6676         101 RRHSLTHNLGSATS  114 (144)
Q Consensus       101 ~~H~~~h~~~~~~~  114 (144)
                      .+|.+-++.+..+.
T Consensus       338 ~~H~~evhEg~np~  351 (467)
T KOG3608|consen  338 RRHFLEVHEGNNPI  351 (467)
T ss_pred             HHHHHHhccCCCCC
Confidence            99999888665543


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=98.92  E-value=4.5e-10  Score=58.69  Aligned_cols=42  Identities=24%  Similarity=0.597  Sum_probs=31.3

Q ss_pred             cccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHH
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDL  100 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l  100 (144)
                      |.|+.||+.|.....|..|++.|+  ++|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            677777777777777777777776  577777788777766554


No 13 
>KOG3993|consensus
Probab=98.90  E-value=2.8e-10  Score=81.64  Aligned_cols=86  Identities=30%  Similarity=0.617  Sum_probs=72.5

Q ss_pred             ccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCC---------------------------
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTD---------------------------   81 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~---------------------------   81 (144)
                      |+|+.|...|.+--.|.+|.-.-....-|+|+.|++.|....+|..|+|+|--                           
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            99999999999999999996544444569999999999999999999998831                           


Q ss_pred             ------CCCcccCcchhhhcChHHHHHhHhhccCCCCCC
Q psy6676          82 ------IKPYNCAACGKVFRRNCDLRRHSLTHNLGSATS  114 (144)
Q Consensus        82 ------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~  114 (144)
                            +..|.|..|+|.|.+...|+.|+.+|+......
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k  386 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAK  386 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccch
Confidence                  124899999999999999999999888654433


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.72  E-value=5.8e-09  Score=46.77  Aligned_cols=25  Identities=56%  Similarity=1.084  Sum_probs=19.3

Q ss_pred             HHHHHHhhcCCCCCcccCcchhhhc
Q psy6676          71 NLKTHLLTHTDIKPYNCAACGKVFR   95 (144)
Q Consensus        71 ~l~~h~~~h~~~~~~~C~~C~~~f~   95 (144)
                      +|..|++.|+++++|.|..|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3677888888888888888887775


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.72  E-value=8.4e-09  Score=53.95  Aligned_cols=43  Identities=19%  Similarity=0.406  Sum_probs=38.2

Q ss_pred             cccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHH
Q psy6676          28 PFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNL   72 (144)
Q Consensus        28 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l   72 (144)
                      .|.|+.||+.|.....|..|++.|.  +++.|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            4799999999999999999999998  689999999998765544


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.70  E-value=3.3e-08  Score=74.73  Aligned_cols=78  Identities=18%  Similarity=0.517  Sum_probs=64.5

Q ss_pred             CCCcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcC--------
Q psy6676          25 KEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRR--------   96 (144)
Q Consensus        25 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~--------   96 (144)
                      ..+++.|+.|+..|. ...|..|+..++  .++.|+ |+..+ ....|..|+..|...+++.|..|++.|..        
T Consensus       450 l~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~  524 (567)
T PLN03086        450 AKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVR  524 (567)
T ss_pred             cccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchh
Confidence            346678999999985 677999998875  779999 99755 56889999999999999999999998852        


Q ss_pred             --hHHHHHhHhhc
Q psy6676          97 --NCDLRRHSLTH  107 (144)
Q Consensus        97 --~~~l~~H~~~h  107 (144)
                        ...|..|...+
T Consensus       525 d~~s~Lt~HE~~C  537 (567)
T PLN03086        525 DRLRGMSEHESIC  537 (567)
T ss_pred             hhhhhHHHHHHhc
Confidence              35788998875


No 17 
>PHA00733 hypothetical protein
Probab=98.57  E-value=1.2e-07  Score=59.05  Aligned_cols=57  Identities=25%  Similarity=0.519  Sum_probs=50.0

Q ss_pred             cCCCCcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCC
Q psy6676          23 HSKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTD   81 (144)
Q Consensus        23 h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~   81 (144)
                      +.+.+||.|+.|++.|.+...|..|+..+  ..++.|..|++.|.....|..|+...++
T Consensus        68 ~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         68 SKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            34588999999999999999999998876  3469999999999999999999986554


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.44  E-value=2.4e-07  Score=70.15  Aligned_cols=78  Identities=15%  Similarity=0.419  Sum_probs=64.9

Q ss_pred             CcccccccccccCChHHHHHHHHHhCCCCCcccccccccccC----------chHHHHHHhhcCCCCCcccCcchhhhcC
Q psy6676          27 KPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQ----------RSNLKTHLLTHTDIKPYNCAACGKVFRR   96 (144)
Q Consensus        27 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~----------~~~l~~h~~~h~~~~~~~C~~C~~~f~~   96 (144)
                      +++.|+ |+..+ ....|..|...|-..+++.|..|+..+..          ...|..|+... +.+++.|..||+.+..
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrl  553 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVML  553 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeee
Confidence            789999 99755 66889999999999999999999998842          35788998875 8899999999987766


Q ss_pred             hHHHHHhHhhcc
Q psy6676          97 NCDLRRHSLTHN  108 (144)
Q Consensus        97 ~~~l~~H~~~h~  108 (144)
                      . .+..|+-..|
T Consensus       554 r-dm~~H~~~~h  564 (567)
T PLN03086        554 K-EMDIHQIAVH  564 (567)
T ss_pred             h-hHHHHHHHhh
Confidence            5 6788886654


No 19 
>PHA00616 hypothetical protein
Probab=98.41  E-value=1.6e-07  Score=46.85  Aligned_cols=35  Identities=14%  Similarity=0.321  Sum_probs=29.9

Q ss_pred             cccccccccccCChHHHHHHHHHhCCCCCcccccc
Q psy6676          28 PFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVC   62 (144)
Q Consensus        28 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C   62 (144)
                      ||.|+.||+.|.....|..|++.+++.+++.|..-
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~   35 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYF   35 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeEE
Confidence            57899999999999999999999998888887653


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.34  E-value=4.4e-07  Score=40.56  Aligned_cols=25  Identities=44%  Similarity=0.822  Sum_probs=21.0

Q ss_pred             HHHHHHHHhCCCCCccccccccccc
Q psy6676          43 TLAVHKILHLEESPHKCPVCSRSFN   67 (144)
Q Consensus        43 ~l~~h~~~~~~~~~~~C~~C~~~~~   67 (144)
                      +|..|++.|.+.++|.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4778888898888999999988875


No 21 
>PHA00732 hypothetical protein
Probab=98.28  E-value=5.7e-07  Score=51.18  Aligned_cols=47  Identities=34%  Similarity=0.646  Sum_probs=34.7

Q ss_pred             cccccccccccCChHHHHHHHHH-hCCCCCcccccccccccCchHHHHHHhhcC
Q psy6676          28 PFKCTECGKGFCQSRTLAVHKIL-HLEESPHKCPVCSRSFNQRSNLKTHLLTHT   80 (144)
Q Consensus        28 ~~~C~~C~~~f~~~~~l~~h~~~-~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~   80 (144)
                      ||.|..|++.|.....|..|++. |.   ++.|..|++.|.   .+..|.+...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            57788888888888888888874 43   357888888886   3667775443


No 22 
>PHA00616 hypothetical protein
Probab=98.15  E-value=1.9e-06  Score=43.00  Aligned_cols=28  Identities=29%  Similarity=0.681  Sum_probs=16.5

Q ss_pred             CcccCcchhhhcChHHHHHhHhhccCCC
Q psy6676          84 PYNCAACGKVFRRNCDLRRHSLTHNLGS  111 (144)
Q Consensus        84 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~  111 (144)
                      +|+|..||+.|...+.|..|++.||...
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~   28 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQN   28 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCC
Confidence            3556666666666666666666655543


No 23 
>PHA00732 hypothetical protein
Probab=98.12  E-value=2.9e-06  Score=48.31  Aligned_cols=48  Identities=31%  Similarity=0.555  Sum_probs=39.6

Q ss_pred             CcccccccccccCchHHHHHHhh-cCCCCCcccCcchhhhcChHHHHHhHhhccC
Q psy6676          56 PHKCPVCSRSFNQRSNLKTHLLT-HTDIKPYNCAACGKVFRRNCDLRRHSLTHNL  109 (144)
Q Consensus        56 ~~~C~~C~~~~~~~~~l~~h~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  109 (144)
                      +|.|..|++.|.....|..|++. |.   ++.|..|++.|.   .+..|.++..+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccCC
Confidence            47899999999999999999984 54   368999999998   47778766543


No 24 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.09  E-value=1.5e-06  Score=37.59  Aligned_cols=23  Identities=43%  Similarity=1.002  Sum_probs=18.8

Q ss_pred             cccCcchhhhcChHHHHHhHhhc
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLTH  107 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~h  107 (144)
                      |.|..|++.|.+...|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57888888888888888888763


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.03  E-value=1.3e-05  Score=42.34  Aligned_cols=35  Identities=31%  Similarity=0.591  Sum_probs=17.3

Q ss_pred             ccccccccccCChHHHHHHHHHhCC--CCCcccccccc
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILHLE--ESPHKCPVCSR   64 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~~~--~~~~~C~~C~~   64 (144)
                      |.||+|++ ..+...|..|+...+.  .+.+.|++|..
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~   39 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSS   39 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchh
Confidence            55666666 4445556666443222  12345555544


No 26 
>KOG3993|consensus
Probab=98.00  E-value=4.4e-06  Score=60.63  Aligned_cols=53  Identities=32%  Similarity=0.683  Sum_probs=43.8

Q ss_pred             CcccccccccccCChHHHHHHHHHhCC---------------------------------CCCcccccccccccCchHHH
Q psy6676          27 KPFKCTECGKGFCQSRTLAVHKILHLE---------------------------------ESPHKCPVCSRSFNQRSNLK   73 (144)
Q Consensus        27 ~~~~C~~C~~~f~~~~~l~~h~~~~~~---------------------------------~~~~~C~~C~~~~~~~~~l~   73 (144)
                      .-|.|+.|++.|....+|..|.+.|.-                                 ..-|.|..|++.|.....|.
T Consensus       294 vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLr  373 (500)
T KOG3993|consen  294 VEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLR  373 (500)
T ss_pred             eeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHH
Confidence            458999999999999999999887731                                 12388999999999999999


Q ss_pred             HHHhhc
Q psy6676          74 THLLTH   79 (144)
Q Consensus        74 ~h~~~h   79 (144)
                      .|+-.|
T Consensus       374 KHqlth  379 (500)
T KOG3993|consen  374 KHQLTH  379 (500)
T ss_pred             HhHHhh
Confidence            996554


No 27 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.94  E-value=5.3e-06  Score=35.95  Aligned_cols=24  Identities=46%  Similarity=1.034  Sum_probs=18.5

Q ss_pred             cccCcchhhhcChHHHHHhHhhcc
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLTHN  108 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~h~  108 (144)
                      |.|..|++.|.+...|..|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578889999999999999888765


No 28 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.93  E-value=2.3e-06  Score=59.97  Aligned_cols=71  Identities=27%  Similarity=0.527  Sum_probs=41.4

Q ss_pred             CCcccccc--cccccCChHHHHHHHHHhC-CCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHH
Q psy6676          26 EKPFKCTE--CGKGFCQSRTLAVHKILHL-EESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRR  102 (144)
Q Consensus        26 ~~~~~C~~--C~~~f~~~~~l~~h~~~~~-~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~  102 (144)
                      .|||+|++  |.+.|+....|+-|+.--+ ..+...-+         . -..+.-.-...+||+|++|+|.|+....|+-
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p---------~-p~~~~~F~~~~KPYrCevC~KRYKNlNGLKY  416 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP---------S-PEKMNIFSAKDKPYRCEVCDKRYKNLNGLKY  416 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCC---------C-ccccccccccCCceeccccchhhccCcccee
Confidence            36777765  7777777777776643221 11110000         0 0001111234589999999999999999998


Q ss_pred             hHhh
Q psy6676         103 HSLT  106 (144)
Q Consensus       103 H~~~  106 (144)
                      |+.-
T Consensus       417 Hr~H  420 (423)
T COG5189         417 HRKH  420 (423)
T ss_pred             cccc
Confidence            8753


No 29 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.88  E-value=2.8e-05  Score=41.06  Aligned_cols=50  Identities=26%  Similarity=0.440  Sum_probs=39.3

Q ss_pred             CcccccccccccCchHHHHHHh-hcCCC-CCcccCcchhhhcChHHHHHhHhhcc
Q psy6676          56 PHKCPVCSRSFNQRSNLKTHLL-THTDI-KPYNCAACGKVFRRNCDLRRHSLTHN  108 (144)
Q Consensus        56 ~~~C~~C~~~~~~~~~l~~h~~-~h~~~-~~~~C~~C~~~f~~~~~l~~H~~~h~  108 (144)
                      .|.|+.|++ ......|..|.. .|..+ +.+.|++|...+.  .+|..|+..+|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            489999999 556688999976 45543 5699999998655  48999998776


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.84  E-value=8.2e-06  Score=36.65  Aligned_cols=26  Identities=38%  Similarity=0.847  Sum_probs=20.4

Q ss_pred             CcccCcchhhhcChHHHHHhHhhccC
Q psy6676          84 PYNCAACGKVFRRNCDLRRHSLTHNL  109 (144)
Q Consensus        84 ~~~C~~C~~~f~~~~~l~~H~~~h~~  109 (144)
                      +|.|..|++.|.+...|..|++.|+.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            47788888888888888888877653


No 31 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.79  E-value=1.8e-05  Score=34.05  Aligned_cols=22  Identities=36%  Similarity=0.730  Sum_probs=15.3

Q ss_pred             ccccccccccCChHHHHHHHHH
Q psy6676          29 FKCTECGKGFCQSRTLAVHKIL   50 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~   50 (144)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4677777777777777777654


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.61  E-value=4.9e-05  Score=44.96  Aligned_cols=74  Identities=20%  Similarity=0.347  Sum_probs=22.4

Q ss_pred             cccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHhHhhcc
Q psy6676          30 KCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRHSLTHN  108 (144)
Q Consensus        30 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  108 (144)
                      +|..|+..|.....+..|+...++-..   .. ...+.....+..+.+.. ....+.|..|++.|.+...|..|++.+.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~---~~-~~~l~~~~~~~~~~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI---PD-QKYLVDPNRLLNYLRKK-VKESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             Ccccccccccccccccccccccccccc---cc-ccccccccccccccccc-cCCCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            489999999999999999876554321   11 11111223333333322 2236999999999999999999998754


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.57  E-value=7.3e-05  Score=32.17  Aligned_cols=23  Identities=39%  Similarity=0.764  Sum_probs=15.6

Q ss_pred             ccccccccccCChHHHHHHHHHh
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILH   51 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~   51 (144)
                      |.|++|++.|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56777888887777777777655


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.39  E-value=0.0001  Score=32.94  Aligned_cols=24  Identities=50%  Similarity=0.956  Sum_probs=15.1

Q ss_pred             cccccccccccCChHHHHHHHHHh
Q psy6676          28 PFKCTECGKGFCQSRTLAVHKILH   51 (144)
Q Consensus        28 ~~~C~~C~~~f~~~~~l~~h~~~~   51 (144)
                      +|.|..|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            456666666666666666666554


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.39  E-value=0.00018  Score=31.36  Aligned_cols=24  Identities=46%  Similarity=1.005  Sum_probs=18.9

Q ss_pred             cccCcchhhhcChHHHHHhHhhcc
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLTHN  108 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~h~  108 (144)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            568888888888888888887554


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.96  E-value=0.00081  Score=34.47  Aligned_cols=32  Identities=31%  Similarity=0.647  Sum_probs=19.6

Q ss_pred             CCCCCcccCcchhhhcChHHHHHhHhhccCCC
Q psy6676          80 TDIKPYNCAACGKVFRRNCDLRRHSLTHNLGS  111 (144)
Q Consensus        80 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  111 (144)
                      ..+.|..|++|+..+....+|++|+.+.|...
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            34567788888888888888888887766543


No 37 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.82  E-value=0.00054  Score=29.89  Aligned_cols=22  Identities=32%  Similarity=0.724  Sum_probs=17.0

Q ss_pred             cccCcchhhhcChHHHHHhHhh
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLT  106 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~  106 (144)
                      |.|.+|++.|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5678888888888888888764


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.82  E-value=0.0017  Score=33.27  Aligned_cols=30  Identities=33%  Similarity=0.492  Sum_probs=14.3

Q ss_pred             CCcccccccccccCChHHHHHHHHHhCCCC
Q psy6676          26 EKPFKCTECGKGFCQSRTLAVHKILHLEES   55 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~   55 (144)
                      ..|..|++|+..+.+..+|.+|+...++.+
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            455566666666666666666655554443


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.78  E-value=0.0017  Score=28.09  Aligned_cols=23  Identities=39%  Similarity=0.790  Sum_probs=15.2

Q ss_pred             ccccccccccCChHHHHHHHHHh
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILH   51 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~   51 (144)
                      |.|..|++.|.....+..|+..|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45667777777777777776644


No 40 
>PRK04860 hypothetical protein; Provisional
Probab=96.72  E-value=0.00093  Score=43.25  Aligned_cols=38  Identities=21%  Similarity=0.576  Sum_probs=31.3

Q ss_pred             CcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcCh
Q psy6676          56 PHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRN   97 (144)
Q Consensus        56 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   97 (144)
                      +|.|. |+.   ....+..|.+.++++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            48887 876   566788999999999999999999887654


No 41 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.71  E-value=0.00089  Score=28.93  Aligned_cols=23  Identities=30%  Similarity=0.715  Sum_probs=16.6

Q ss_pred             cccCcchhhhcChHHHHHhHhhcc
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLTHN  108 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~h~  108 (144)
                      |+|..|..... ...|..|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            57888887777 778888888765


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.50  E-value=0.00091  Score=29.85  Aligned_cols=22  Identities=32%  Similarity=0.755  Sum_probs=18.1

Q ss_pred             cccCcchhhhcChHHHHHhHhh
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLT  106 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~  106 (144)
                      |.|..|++.|.+...+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888888764


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.42  E-value=0.0021  Score=27.98  Aligned_cols=22  Identities=32%  Similarity=0.603  Sum_probs=13.9

Q ss_pred             ccccccccccCChHHHHHHHHH
Q psy6676          29 FKCTECGKGFCQSRTLAVHKIL   50 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~   50 (144)
                      |.|.+|+..|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666543


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.20  E-value=0.0041  Score=26.78  Aligned_cols=23  Identities=26%  Similarity=0.495  Sum_probs=15.2

Q ss_pred             ccccccccccCChHHHHHHHHHhC
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILHL   52 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~~   52 (144)
                      |.|+.|..... ...|..|+..++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56788887776 777888876653


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=95.94  E-value=0.0055  Score=39.72  Aligned_cols=39  Identities=21%  Similarity=0.541  Sum_probs=33.0

Q ss_pred             CcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCc
Q psy6676          27 KPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQR   69 (144)
Q Consensus        27 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~   69 (144)
                      -+|.|. |+.   ....+..|.+.+.+.++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            368998 987   566789999999999999999999887543


No 46 
>KOG4173|consensus
Probab=95.83  E-value=0.0063  Score=40.57  Aligned_cols=80  Identities=24%  Similarity=0.501  Sum_probs=63.0

Q ss_pred             CCCcccccc--cccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhh-c---------CCCCCcccC--cc
Q psy6676          25 KEKPFKCTE--CGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLT-H---------TDIKPYNCA--AC   90 (144)
Q Consensus        25 ~~~~~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~-h---------~~~~~~~C~--~C   90 (144)
                      +...+.|++  |-+.|...-++..|..+.++   ..|.+|.+.|...-.|..|+-. |         .|.-.|.|.  .|
T Consensus        76 ~~~~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgC  152 (253)
T KOG4173|consen   76 RVPAFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGC  152 (253)
T ss_pred             ccccccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhh
Confidence            445578887  77888888888998766655   4899999999999888888753 3         345568995  59


Q ss_pred             hhhhcChHHHHHhHhhc
Q psy6676          91 GKVFRRNCDLRRHSLTH  107 (144)
Q Consensus        91 ~~~f~~~~~l~~H~~~h  107 (144)
                      +..|.+....+.|+-.-
T Consensus       153 t~KFkT~r~RkdH~I~~  169 (253)
T KOG4173|consen  153 TEKFKTSRDRKDHMIRM  169 (253)
T ss_pred             hhhhhhhhhhhhHHHHh
Confidence            99999999999998543


No 47 
>KOG1146|consensus
Probab=95.66  E-value=0.0056  Score=50.84  Aligned_cols=83  Identities=27%  Similarity=0.378  Sum_probs=52.9

Q ss_pred             ccccCCCCcccccccccccCChHHHHHHHHHhCCC-CCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChH
Q psy6676          20 GYIHSKEKPFKCTECGKGFCQSRTLAVHKILHLEE-SPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNC   98 (144)
Q Consensus        20 ~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~-~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~   98 (144)
                      ..+++..+.++|++|++.|+....|..|++..+.+ ..   .+|. .+...-.+..-...-.+.++|.|..|...++...
T Consensus       457 ~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~---~~c~-~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng  532 (1406)
T KOG1146|consen  457 VVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS---AYCK-AGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNG  532 (1406)
T ss_pred             eeeecccccccCCccchhhhhHHHhhhcccccccccch---hHhH-hccccccccccccccCCCCcccceeeeeeeecch
Confidence            35567778899999999999999999998874322 21   2221 1111000000011223457899999999999999


Q ss_pred             HHHHhHhh
Q psy6676          99 DLRRHSLT  106 (144)
Q Consensus        99 ~l~~H~~~  106 (144)
                      .|.+|+..
T Consensus       533 ~LsihlqS  540 (1406)
T KOG1146|consen  533 NLSIHLQS  540 (1406)
T ss_pred             HHHHHHHH
Confidence            99999864


No 48 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.61  E-value=0.0031  Score=28.09  Aligned_cols=20  Identities=35%  Similarity=0.695  Sum_probs=11.2

Q ss_pred             ccccccccccCChHHHHHHH
Q psy6676          29 FKCTECGKGFCQSRTLAVHK   48 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~   48 (144)
                      |.|..|++.|.+...+..|+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCT
T ss_pred             CCcccCCCCcCCHHHHHHHH
Confidence            45555665665555555554


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.46  E-value=0.013  Score=25.66  Aligned_cols=21  Identities=29%  Similarity=0.660  Sum_probs=13.3

Q ss_pred             cccCcchhhhcChHHHHHhHhh
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLT  106 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~  106 (144)
                      ..|+.||+.| ....|.+|+++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3567777777 45566666654


No 50 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.77  E-value=0.015  Score=30.33  Aligned_cols=33  Identities=18%  Similarity=0.278  Sum_probs=27.8

Q ss_pred             cccCCCCcccccccccccCChHHHHHHHHHhCC
Q psy6676          21 YIHSKEKPFKCTECGKGFCQSRTLAVHKILHLE   53 (144)
Q Consensus        21 ~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~   53 (144)
                      ....|+.-+.|+.|+..|....++.+|++.-++
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            446788889999999999999999999876554


No 51 
>KOG1146|consensus
Probab=93.90  E-value=0.026  Score=47.17  Aligned_cols=80  Identities=16%  Similarity=0.225  Sum_probs=55.2

Q ss_pred             ccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhc-----------------CCCCCcccCcch
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTH-----------------TDIKPYNCAACG   91 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h-----------------~~~~~~~C~~C~   91 (144)
                      +.|..|.+.+...-.+. ++   ....+|.|..|...|.....+..|.+.-                 ....+| |..|.
T Consensus      1261 ~~c~~~~~~~~~~~~~~-~l---~~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~ 1335 (1406)
T KOG1146|consen 1261 GECGAVDELLTPSFGIS-TL---DVTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACE 1335 (1406)
T ss_pred             chhhhccccccCcccee-ec---ccchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHH
Confidence            66878887776655555 32   2234578888888888888887777422                 122335 99999


Q ss_pred             hhhcChHHHHHhHhh-ccCCCCC
Q psy6676          92 KVFRRNCDLRRHSLT-HNLGSAT  113 (144)
Q Consensus        92 ~~f~~~~~l~~H~~~-h~~~~~~  113 (144)
                      ..|+....|++|+++ ++.....
T Consensus      1336 ~~~~~~~alqihm~~~~~~~kt~ 1358 (1406)
T KOG1146|consen 1336 VLLSGREALQIHMRSSAHRRKTA 1358 (1406)
T ss_pred             hhcchhHHHHHHHHHhhhcccCC
Confidence            999999999999986 4433333


No 52 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.90  E-value=0.04  Score=25.82  Aligned_cols=23  Identities=17%  Similarity=0.455  Sum_probs=18.7

Q ss_pred             CcccCcchhhhcChHHHHHhHhh
Q psy6676          84 PYNCAACGKVFRRNCDLRRHSLT  106 (144)
Q Consensus        84 ~~~C~~C~~~f~~~~~l~~H~~~  106 (144)
                      +|.|..|++.|.....+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57888899988888888888753


No 53 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.55  E-value=0.074  Score=24.85  Aligned_cols=22  Identities=23%  Similarity=0.480  Sum_probs=14.2

Q ss_pred             cccccccccccCChHHHHHHHH
Q psy6676          28 PFKCTECGKGFCQSRTLAVHKI   49 (144)
Q Consensus        28 ~~~C~~C~~~f~~~~~l~~h~~   49 (144)
                      +|.|.+|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4667777777766666666643


No 54 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.22  E-value=0.053  Score=25.33  Aligned_cols=9  Identities=44%  Similarity=1.446  Sum_probs=4.3

Q ss_pred             CCcccCcch
Q psy6676          83 KPYNCAACG   91 (144)
Q Consensus        83 ~~~~C~~C~   91 (144)
                      .++.|+.|+
T Consensus        16 ~~~~CP~Cg   24 (33)
T cd00350          16 APWVCPVCG   24 (33)
T ss_pred             CCCcCcCCC
Confidence            344555554


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.08  E-value=0.059  Score=28.18  Aligned_cols=30  Identities=33%  Similarity=0.561  Sum_probs=23.4

Q ss_pred             cCCCCCcccCcchhhhcChHHHHHhHhhcc
Q psy6676          79 HTDIKPYNCAACGKVFRRNCDLRRHSLTHN  108 (144)
Q Consensus        79 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  108 (144)
                      -.|+.-+.|+-|+..|.+...+.+|...-|
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            356677889999999999888888885433


No 56 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=93.07  E-value=0.065  Score=38.75  Aligned_cols=79  Identities=24%  Similarity=0.383  Sum_probs=49.2

Q ss_pred             cccccc--cccccCChHHHHHHHHHhCCCCCcccccccc---cc------cCchHHHHHHhhcCCCCC----cccCcchh
Q psy6676          28 PFKCTE--CGKGFCQSRTLAVHKILHLEESPHKCPVCSR---SF------NQRSNLKTHLLTHTDIKP----YNCAACGK   92 (144)
Q Consensus        28 ~~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~---~~------~~~~~l~~h~~~h~~~~~----~~C~~C~~   92 (144)
                      .|.|+.  |.........|..|.++.++.  +.|..|-.   .|      .....|..|......+..    -.|..|..
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~  228 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKI  228 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccc
Confidence            377875  666666677888888776643  56666652   22      233556666543332222    25788888


Q ss_pred             hhcChHHHHHhHhhcc
Q psy6676          93 VFRRNCDLRRHSLTHN  108 (144)
Q Consensus        93 ~f~~~~~l~~H~~~h~  108 (144)
                      -|.....|.+|.+..|
T Consensus       229 ~FYdDDEL~~HcR~~H  244 (493)
T COG5236         229 YFYDDDELRRHCRLRH  244 (493)
T ss_pred             eecChHHHHHHHHhhh
Confidence            8888888888877543


No 57 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.63  E-value=0.089  Score=31.82  Aligned_cols=15  Identities=33%  Similarity=0.866  Sum_probs=8.0

Q ss_pred             CCcccCcchhhhcCh
Q psy6676          83 KPYNCAACGKVFRRN   97 (144)
Q Consensus        83 ~~~~C~~C~~~f~~~   97 (144)
                      .|..|+.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            445555565555444


No 58 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.72  E-value=0.14  Score=31.01  Aligned_cols=30  Identities=30%  Similarity=0.805  Sum_probs=23.8

Q ss_pred             ccccccccccCChHHHHHHHHHhCCCCCcccccccccccCc
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQR   69 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~   69 (144)
                      ..|+.||..|-..           +..|.+|+.||..|...
T Consensus        10 R~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            4799999998543           24688999999988665


No 59 
>KOG2482|consensus
Probab=91.11  E-value=0.26  Score=35.72  Aligned_cols=79  Identities=24%  Similarity=0.380  Sum_probs=57.9

Q ss_pred             cccccccccccCChHHHHHHHHHhCCC-----------------------------------------------------
Q psy6676          28 PFKCTECGKGFCQSRTLAVHKILHLEE-----------------------------------------------------   54 (144)
Q Consensus        28 ~~~C~~C~~~f~~~~~l~~h~~~~~~~-----------------------------------------------------   54 (144)
                      .+.|-.|.+.|+.+..|..||+.....                                                     
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~  274 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDD  274 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCC
Confidence            478999999999999999998743210                                                     


Q ss_pred             -CC--cccccccccccCchHHHHHHhh-cCC--------------------------CCCcccCcchhhhcChHHHHHhH
Q psy6676          55 -SP--HKCPVCSRSFNQRSNLKTHLLT-HTD--------------------------IKPYNCAACGKVFRRNCDLRRHS  104 (144)
Q Consensus        55 -~~--~~C~~C~~~~~~~~~l~~h~~~-h~~--------------------------~~~~~C~~C~~~f~~~~~l~~H~  104 (144)
                       .+  .+|..|...+.+...|..||+. |.-                          .....|-.|.-.|.....|..|+
T Consensus       275 a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm  354 (423)
T KOG2482|consen  275 AEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHM  354 (423)
T ss_pred             CCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhc
Confidence             01  3688888888888888888874 321                          11246778888899999999888


Q ss_pred             hh
Q psy6676         105 LT  106 (144)
Q Consensus       105 ~~  106 (144)
                      .-
T Consensus       355 ~e  356 (423)
T KOG2482|consen  355 VE  356 (423)
T ss_pred             cc
Confidence            53


No 60 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=91.03  E-value=0.13  Score=33.47  Aligned_cols=24  Identities=33%  Similarity=0.805  Sum_probs=18.9

Q ss_pred             CcccccccccccCchHHHHHHhhcCCCCCcccCcchh
Q psy6676          56 PHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGK   92 (144)
Q Consensus        56 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   92 (144)
                      .|+|.+||..+             .++.|.+|++||.
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCCC
Confidence            69999998663             4478889999983


No 61 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=90.51  E-value=0.33  Score=28.23  Aligned_cols=24  Identities=29%  Similarity=0.886  Sum_probs=17.1

Q ss_pred             CcccccccccccCchHHHHHHhhc
Q psy6676          56 PHKCPVCSRSFNQRSNLKTHLLTH   79 (144)
Q Consensus        56 ~~~C~~C~~~~~~~~~l~~h~~~h   79 (144)
                      .+.|..|++.|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            577777777777777777777653


No 62 
>KOG2231|consensus
Probab=90.33  E-value=0.42  Score=37.81  Aligned_cols=81  Identities=23%  Similarity=0.399  Sum_probs=49.1

Q ss_pred             cccccccccc---------------CChHHHHHHHHHhCCCCCccccccc----------ccccCchHHHHHHhhc-CCC
Q psy6676          29 FKCTECGKGF---------------CQSRTLAVHKILHLEESPHKCPVCS----------RSFNQRSNLKTHLLTH-TDI   82 (144)
Q Consensus        29 ~~C~~C~~~f---------------~~~~~l~~h~~~~~~~~~~~C~~C~----------~~~~~~~~l~~h~~~h-~~~   82 (144)
                      +.|.+|.+.|               .....|+.|+...++  .+.|..|.          +.|. ...|..|++.. .++
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Yt-~~el~~h~~~gd~d~  176 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLYT-RAELNLHLMFGDPDD  176 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhh--hhccccccccceeeeeeeeheh-HHHHHHHHhcCCCcc
Confidence            4566666666               367788999865443  23444433          2332 34566666532 222


Q ss_pred             CC----cccCcchhhhcChHHHHHhHhhccCCCC
Q psy6676          83 KP----YNCAACGKVFRRNCDLRRHSLTHNLGSA  112 (144)
Q Consensus        83 ~~----~~C~~C~~~f~~~~~l~~H~~~h~~~~~  112 (144)
                      +.    -.|+.|...|.....|.+|++..|..--
T Consensus       177 ~s~rGhp~C~~C~~~fld~~el~rH~~~~h~~ch  210 (669)
T KOG2231|consen  177 ESCRGHPLCKFCHERFLDDDELYRHLRFDHEFCH  210 (669)
T ss_pred             ccccCCccchhhhhhhccHHHHHHhhccceehee
Confidence            22    3678888888888888888887654433


No 63 
>KOG2893|consensus
Probab=89.77  E-value=0.095  Score=35.97  Aligned_cols=28  Identities=25%  Similarity=0.644  Sum_probs=13.5

Q ss_pred             ccccccCChHHHHHHHHHhCCCCCcccccccc
Q psy6676          33 ECGKGFCQSRTLAVHKILHLEESPHKCPVCSR   64 (144)
Q Consensus        33 ~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~   64 (144)
                      +|++.|..+.-|-+|++..    .|+|.+|.+
T Consensus        15 ycnrefddekiliqhqkak----hfkchichk   42 (341)
T KOG2893|consen   15 YCNREFDDEKILIQHQKAK----HFKCHICHK   42 (341)
T ss_pred             ecccccchhhhhhhhhhhc----cceeeeehh
Confidence            4555555555444443332    245555543


No 64 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.70  E-value=0.087  Score=38.80  Aligned_cols=60  Identities=37%  Similarity=0.712  Sum_probs=30.4

Q ss_pred             cccccccccccCChHHHHHHHH--HhCCC--CCcccc--cccccccCchHHHHHHhhcCCCCCccc
Q psy6676          28 PFKCTECGKGFCQSRTLAVHKI--LHLEE--SPHKCP--VCSRSFNQRSNLKTHLLTHTDIKPYNC   87 (144)
Q Consensus        28 ~~~C~~C~~~f~~~~~l~~h~~--~~~~~--~~~~C~--~C~~~~~~~~~l~~h~~~h~~~~~~~C   87 (144)
                      ++.|..|...|.....+..|..  .|.+.  +++.|.  .|++.|.....+..|...|.+..++.+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            4455555555555555555555  44444  455555  455555555555555555544444433


No 65 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=88.93  E-value=0.75  Score=27.70  Aligned_cols=26  Identities=27%  Similarity=0.576  Sum_probs=23.1

Q ss_pred             Cccc----CcchhhhcChHHHHHhHhhccC
Q psy6676          84 PYNC----AACGKVFRRNCDLRRHSLTHNL  109 (144)
Q Consensus        84 ~~~C----~~C~~~f~~~~~l~~H~~~h~~  109 (144)
                      .|.|    ..|++...+...++.|.+.+|.
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3899    9999999999999999988763


No 66 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=88.66  E-value=0.27  Score=32.08  Aligned_cols=24  Identities=38%  Similarity=0.994  Sum_probs=19.7

Q ss_pred             cccccccccccCChHHHHHHHHHhCCCCCcccccccc
Q psy6676          28 PFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSR   64 (144)
Q Consensus        28 ~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~   64 (144)
                      -|.|++||..             +.+..|.+|++|+-
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            6999999976             45567899999984


No 67 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=88.60  E-value=0.26  Score=23.16  Aligned_cols=10  Identities=40%  Similarity=0.939  Sum_probs=5.1

Q ss_pred             cccccccccc
Q psy6676          57 HKCPVCSRSF   66 (144)
Q Consensus        57 ~~C~~C~~~~   66 (144)
                      |+|.+||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            4555555443


No 68 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=88.59  E-value=0.12  Score=38.01  Aligned_cols=59  Identities=42%  Similarity=0.723  Sum_probs=52.3

Q ss_pred             CCcccccccccccCchHHHHHHh--hcCCC--CCcccC--cchhhhcChHHHHHhHhhccCCCCC
Q psy6676          55 SPHKCPVCSRSFNQRSNLKTHLL--THTDI--KPYNCA--ACGKVFRRNCDLRRHSLTHNLGSAT  113 (144)
Q Consensus        55 ~~~~C~~C~~~~~~~~~l~~h~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~  113 (144)
                      .++.|..|...|.....+..|.+  .|.++  +++.|.  .|++.|.+...+..|..+|......
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPA  352 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcc
Confidence            35788889999999999999999  89999  999999  7999999999999999888766533


No 69 
>KOG2893|consensus
Probab=88.18  E-value=0.16  Score=34.85  Aligned_cols=42  Identities=29%  Similarity=0.543  Sum_probs=32.5

Q ss_pred             cccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHhH
Q psy6676          59 CPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRHS  104 (144)
Q Consensus        59 C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  104 (144)
                      |=.|++.|.....|.+|++.    +.|+|-+|-|.+-+.-.|..|-
T Consensus        13 cwycnrefddekiliqhqka----khfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             eeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeeh
Confidence            55688999998888888874    5589999988777766666664


No 70 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=87.48  E-value=0.55  Score=33.80  Aligned_cols=28  Identities=32%  Similarity=0.699  Sum_probs=24.2

Q ss_pred             CCCcccCc--chhhhcChHHHHHhHhhccC
Q psy6676          82 IKPYNCAA--CGKVFRRNCDLRRHSLTHNL  109 (144)
Q Consensus        82 ~~~~~C~~--C~~~f~~~~~l~~H~~~h~~  109 (144)
                      ++||+|++  |.|.|+....|+-|+.-.|.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~  376 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQ  376 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhcccc
Confidence            58999976  99999999999999876553


No 71 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=87.23  E-value=0.078  Score=36.10  Aligned_cols=17  Identities=35%  Similarity=0.854  Sum_probs=12.3

Q ss_pred             CCcccccccccccCChH
Q psy6676          26 EKPFKCTECGKGFCQSR   42 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~~   42 (144)
                      .+...||+|+..|....
T Consensus         3 ~k~~~CPvC~~~F~~~~   19 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKK   19 (214)
T ss_pred             CCceECCCCCCeeeeeE
Confidence            35667888888887664


No 72 
>KOG2482|consensus
Probab=85.92  E-value=0.85  Score=33.17  Aligned_cols=54  Identities=19%  Similarity=0.351  Sum_probs=36.1

Q ss_pred             CCCcccccccccccCCh-HHHHHHHHH-hC---C------------------CCCcccccccccccCchHHHHHHhh
Q psy6676          25 KEKPFKCTECGKGFCQS-RTLAVHKIL-HL---E------------------ESPHKCPVCSRSFNQRSNLKTHLLT   78 (144)
Q Consensus        25 ~~~~~~C~~C~~~f~~~-~~l~~h~~~-~~---~------------------~~~~~C~~C~~~~~~~~~l~~h~~~   78 (144)
                      ......|-.|...+.-. +.+-.|+-. |.   |                  -..+.|..|.+.|.....|..||+.
T Consensus       141 t~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  141 TIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             CeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            34556788888776543 334455422 21   1                  1237899999999999999999974


No 73 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=85.78  E-value=0.65  Score=23.00  Aligned_cols=26  Identities=38%  Similarity=0.715  Sum_probs=14.7

Q ss_pred             CCCCcccCcchhhhcCh----HHHHHhHhh
Q psy6676          81 DIKPYNCAACGKVFRRN----CDLRRHSLT  106 (144)
Q Consensus        81 ~~~~~~C~~C~~~f~~~----~~l~~H~~~  106 (144)
                      +....+|..|++.+...    ..|..|++.
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            34556788888776653    678888744


No 74 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=85.59  E-value=1.3  Score=27.01  Aligned_cols=82  Identities=26%  Similarity=0.394  Sum_probs=49.1

Q ss_pred             CcccccccccccCChHHHHHHHHHhCCCCC------------cccccccccccCchHHHHHHhhcCCCCCcccCcchhhh
Q psy6676          27 KPFKCTECGKGFCQSRTLAVHKILHLEESP------------HKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVF   94 (144)
Q Consensus        27 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~------------~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f   94 (144)
                      -|-.|+.|+-.......|.+...-.-.-++            ..|-.|...|........-  .-.....|.|..|...|
T Consensus        14 LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~--~~~~~~~y~C~~C~~~F   91 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFD--ELKDSHRYVCAVCKNVF   91 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCccccccc--ccccccceeCCCCCCcc
Confidence            567899999887777777654211000111            1377777777553211100  01223468999999999


Q ss_pred             cChHHHHHhHhhccCC
Q psy6676          95 RRNCDLRRHSLTHNLG  110 (144)
Q Consensus        95 ~~~~~l~~H~~~h~~~  110 (144)
                      =..=..-.|...|.-.
T Consensus        92 C~dCD~fiHe~Lh~CP  107 (112)
T TIGR00622        92 CVDCDVFVHESLHCCP  107 (112)
T ss_pred             ccccchhhhhhccCCc
Confidence            8777777787777643


No 75 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=84.90  E-value=0.56  Score=29.07  Aligned_cols=14  Identities=21%  Similarity=0.427  Sum_probs=6.6

Q ss_pred             CCcccccccccccC
Q psy6676          55 SPHKCPVCSRSFNQ   68 (144)
Q Consensus        55 ~~~~C~~C~~~~~~   68 (144)
                      .|.+|+.||..|..
T Consensus        25 ~p~vcP~cg~~~~~   38 (129)
T TIGR02300        25 RPAVSPYTGEQFPP   38 (129)
T ss_pred             CCccCCCcCCccCc
Confidence            34455555544433


No 76 
>KOG2186|consensus
Probab=84.62  E-value=0.63  Score=32.32  Aligned_cols=47  Identities=21%  Similarity=0.493  Sum_probs=33.4

Q ss_pred             ccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhh
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLT   78 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~   78 (144)
                      |.|..||....-. .+..|+..-++ .-|.|..|+..|.. ..+..|..-
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            6788888776554 46668777766 55888888888877 556666653


No 77 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=83.01  E-value=0.63  Score=29.22  Aligned_cols=25  Identities=36%  Similarity=0.538  Sum_probs=16.0

Q ss_pred             CCcccCcchhhhcChHHHHHhHhhccCC
Q psy6676          83 KPYNCAACGKVFRRNCDLRRHSLTHNLG  110 (144)
Q Consensus        83 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~  110 (144)
                      ....|..||+.|...   ++|++.||+-
T Consensus        71 d~i~clecGk~~k~L---krHL~~~~gl   95 (132)
T PF05443_consen   71 DYIICLECGKKFKTL---KRHLRTHHGL   95 (132)
T ss_dssp             S-EE-TBT--EESBH---HHHHHHTT-S
T ss_pred             CeeEEccCCcccchH---HHHHHHccCC
Confidence            346899999988765   8999998654


No 78 
>KOG2231|consensus
Probab=82.92  E-value=1.7  Score=34.55  Aligned_cols=69  Identities=22%  Similarity=0.411  Sum_probs=44.5

Q ss_pred             ccccccccccCChHHHHHHHHHhCCCCCccccccc------ccccCchHHHHHHhhcCCCCCcccC--cch-hhhcChHH
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCS------RSFNQRSNLKTHLLTHTDIKPYNCA--ACG-KVFRRNCD   99 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~------~~~~~~~~l~~h~~~h~~~~~~~C~--~C~-~~f~~~~~   99 (144)
                      -.|..|...|.....+..|++.++    |.|..|.      ..|.....|..|.+.++    |.|.  .|. +.|.....
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~~~~f~~~~~  254 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCRTKKFYVAFE  254 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC----ccccccccccceeeehhH
Confidence            358899999999999998877655    4566653      45666778888887544    5665  453 33444433


Q ss_pred             HHHhHh
Q psy6676         100 LRRHSL  105 (144)
Q Consensus       100 l~~H~~  105 (144)
                      +..+++
T Consensus       255 ~ei~lk  260 (669)
T KOG2231|consen  255 LEIELK  260 (669)
T ss_pred             HHHHHH
Confidence            444444


No 79 
>KOG2186|consensus
Probab=82.90  E-value=0.94  Score=31.50  Aligned_cols=46  Identities=26%  Similarity=0.697  Sum_probs=31.3

Q ss_pred             cccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHhHh
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRHSL  105 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  105 (144)
                      |.|.+||....-. .+..|+...++ ..|.|..|++.|.. ..+..|..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            6778887665443 35557766666 56788888888877 45666655


No 80 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=82.84  E-value=2.7  Score=30.75  Aligned_cols=79  Identities=27%  Similarity=0.442  Sum_probs=52.7

Q ss_pred             cccccccccCChHHHHHHHHHhCCCCCccccccc----ccccCchHHHHHHhhcCCCCCcccCc--c--h--hhhcChHH
Q psy6676          30 KCTECGKGFCQSRTLAVHKILHLEESPHKCPVCS----RSFNQRSNLKTHLLTHTDIKPYNCAA--C--G--KVFRRNCD   99 (144)
Q Consensus        30 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~----~~~~~~~~l~~h~~~h~~~~~~~C~~--C--~--~~f~~~~~   99 (144)
                      .|..|...|-+.-.|..|++..+. +-+.|+.-+    ..|.+...|..|.+..    .|.|.+  |  +  ..|.+...
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE-~ChICD~v~p~~~QYFK~Y~~Le~HF~~~----hy~ct~qtc~~~k~~vf~~~~e  296 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE-ACHICDMVGPIRYQYFKSYEDLEAHFRNA----HYCCTFQTCRVGKCYVFPYHTE  296 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh-hhhhhhccCccchhhhhCHHHHHHHhhcC----ceEEEEEEEecCcEEEeccHHH
Confidence            589999999888889999887663 334444322    2456667777777643    255533  3  2  47899999


Q ss_pred             HHHhHhhccCCCCC
Q psy6676         100 LRRHSLTHNLGSAT  113 (144)
Q Consensus       100 l~~H~~~h~~~~~~  113 (144)
                      |..|+-.-|.....
T Consensus       297 l~~h~~~~h~~~~~  310 (493)
T COG5236         297 LLEHLTRFHKVNAR  310 (493)
T ss_pred             HHHHHHHHhhcccc
Confidence            99998765554433


No 81 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=82.11  E-value=0.99  Score=23.07  Aligned_cols=22  Identities=41%  Similarity=0.773  Sum_probs=15.1

Q ss_pred             CcccCcchhhhcCh-----HHHHHhHh
Q psy6676          84 PYNCAACGKVFRRN-----CDLRRHSL  105 (144)
Q Consensus        84 ~~~C~~C~~~f~~~-----~~l~~H~~  105 (144)
                      .-.|..|++.+...     +.|.+|++
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            35677777777554     57777877


No 82 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=82.08  E-value=1.5  Score=28.38  Aligned_cols=34  Identities=18%  Similarity=0.512  Sum_probs=23.6

Q ss_pred             CCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhc
Q psy6676          53 EESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFR   95 (144)
Q Consensus        53 ~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~   95 (144)
                      ...-|.|+.|+..|.....+.         ..|.|+.||....
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLD  139 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEee
Confidence            345688888888776665553         3588988886543


No 83 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=81.86  E-value=0.7  Score=30.59  Aligned_cols=34  Identities=21%  Similarity=0.622  Sum_probs=22.4

Q ss_pred             CCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcC
Q psy6676          54 ESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRR   96 (144)
Q Consensus        54 ~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~   96 (144)
                      ..-|.|+.|+..|.....+.         ..|.|+.||.....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            45678888887776654431         35888888865543


No 84 
>KOG2785|consensus
Probab=81.76  E-value=1.5  Score=32.27  Aligned_cols=73  Identities=15%  Similarity=0.118  Sum_probs=39.0

Q ss_pred             ccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcch---hhhcChHHHHHhHh
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACG---KVFRRNCDLRRHSL  105 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~---~~f~~~~~l~~H~~  105 (144)
                      -.|-.|+..+.+...-..||..++|-  |....  ........|...+...-+ ..+.|..|.   +.|.+..+.+.|+.
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~Hgf--fIPdr--eYL~D~~GLl~YLgeKV~-~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGF--FIPDR--EYLTDEKGLLKYLGEKVG-IGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCC--cCCch--HhhhchhHHHHHHHHHhc-cCceEEEeccccCcccccHHHHHHHh
Confidence            44555555555555555555554431  11111  111122233333322222 348899998   99999999999985


Q ss_pred             h
Q psy6676         106 T  106 (144)
Q Consensus       106 ~  106 (144)
                      .
T Consensus       242 ~  242 (390)
T KOG2785|consen  242 D  242 (390)
T ss_pred             h
Confidence            3


No 85 
>KOG3408|consensus
Probab=80.88  E-value=1.2  Score=27.35  Aligned_cols=27  Identities=22%  Similarity=0.413  Sum_probs=22.8

Q ss_pred             CCCCCcccCcchhhhcChHHHHHhHhh
Q psy6676          80 TDIKPYNCAACGKVFRRNCDLRRHSLT  106 (144)
Q Consensus        80 ~~~~~~~C~~C~~~f~~~~~l~~H~~~  106 (144)
                      .|-..|.|..|.+-|.+...|..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            455669999999999999999999865


No 86 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=80.85  E-value=1  Score=29.24  Aligned_cols=35  Identities=17%  Similarity=0.445  Sum_probs=27.0

Q ss_pred             CCCCcccccccccccCChHHHHHHHHHhCCCCCccccccccccc
Q psy6676          24 SKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFN   67 (144)
Q Consensus        24 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~   67 (144)
                      .+..-|.|+.|+..|.....+.         ..|.|+.||....
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLD  139 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEee
Confidence            3456799999999998777664         2499999997543


No 87 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=79.97  E-value=0.89  Score=26.22  Aligned_cols=33  Identities=27%  Similarity=0.658  Sum_probs=21.4

Q ss_pred             CCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcCh
Q psy6676          55 SPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRN   97 (144)
Q Consensus        55 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   97 (144)
                      ..+.|+.|++.-        +.+..  ...|.|..||..|.-.
T Consensus        34 ~~~~Cp~C~~~~--------VkR~a--~GIW~C~kCg~~fAGg   66 (89)
T COG1997          34 AKHVCPFCGRTT--------VKRIA--TGIWKCRKCGAKFAGG   66 (89)
T ss_pred             cCCcCCCCCCcc--------eeeec--cCeEEcCCCCCeeccc
Confidence            347888888651        22332  3568899998887543


No 88 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=79.75  E-value=1.6  Score=28.94  Aligned_cols=34  Identities=21%  Similarity=0.573  Sum_probs=23.6

Q ss_pred             CCCcccccccccccCChHHHHHHHHHhCCCCCccccccccccc
Q psy6676          25 KEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFN   67 (144)
Q Consensus        25 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~   67 (144)
                      ...-|.|+.|+..|.....+.         ..|.|+.||....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            345688988888887665543         2488999886543


No 89 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=79.18  E-value=0.41  Score=30.89  Aligned_cols=13  Identities=23%  Similarity=0.764  Sum_probs=8.3

Q ss_pred             cccccccccccCc
Q psy6676          57 HKCPVCSRSFNQR   69 (144)
Q Consensus        57 ~~C~~C~~~~~~~   69 (144)
                      +.|+.||+.|...
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            5677777666543


No 90 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=78.43  E-value=1.4  Score=21.00  Aligned_cols=10  Identities=30%  Similarity=0.846  Sum_probs=4.8

Q ss_pred             ccccccccCC
Q psy6676          31 CTECGKGFCQ   40 (144)
Q Consensus        31 C~~C~~~f~~   40 (144)
                      |+.|+..|..
T Consensus         5 CP~C~~~f~v   14 (37)
T PF13719_consen    5 CPNCQTRFRV   14 (37)
T ss_pred             CCCCCceEEc
Confidence            4555544433


No 91 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=77.85  E-value=1.2  Score=23.73  Aligned_cols=33  Identities=27%  Similarity=0.526  Sum_probs=16.8

Q ss_pred             CCcccccccccccCchHHHHHHhhcCCCCCcccCcchh
Q psy6676          55 SPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGK   92 (144)
Q Consensus        55 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   92 (144)
                      ..|.|+.||..--..     -.+--....+|+|+.||.
T Consensus        26 v~F~CPnCGe~~I~R-----c~~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYR-----CAKCRKLGNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeeh-----hhhHHHcCCceECCCcCc
Confidence            347788887432111     111111236788888874


No 92 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=77.79  E-value=3.7  Score=26.18  Aligned_cols=39  Identities=18%  Similarity=0.492  Sum_probs=24.4

Q ss_pred             CCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhc
Q psy6676          53 EESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFR   95 (144)
Q Consensus        53 ~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~   95 (144)
                      ....|.|+.|+..|.....+..   ... ...|.|+.||....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEELE  134 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCEEE
Confidence            3456899999988875432221   012 34499999987553


No 93 
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=77.31  E-value=16  Score=23.72  Aligned_cols=90  Identities=17%  Similarity=0.331  Sum_probs=50.0

Q ss_pred             CCCCcccccccccccCChHHHHHHHHHhCCC--------------------------CCcccccccccccCchHHHHHHh
Q psy6676          24 SKEKPFKCTECGKGFCQSRTLAVHKILHLEE--------------------------SPHKCPVCSRSFNQRSNLKTHLL   77 (144)
Q Consensus        24 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~--------------------------~~~~C~~C~~~~~~~~~l~~h~~   77 (144)
                      .|-+||.|..   .+....-|.+-.+.+...                          ....|+.|............ -+
T Consensus        25 kgcRpymc~T---s~rhSNCLdqfkka~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~CPLCRG~V~GWtvve~-AR  100 (162)
T PF07800_consen   25 KGCRPYMCDT---SYRHSNCLDQFKKAYGKSSSSSSQSSSSAPSDSSSSESSESQEQPELACPLCRGEVKGWTVVEP-AR  100 (162)
T ss_pred             CCccccccCC---ccchhHHHHHHHHHhcCCCCccccccccCcCCCcccccccccccccccCccccCceeceEEchH-HH
Confidence            4557777655   555555566554443221                          23678888753333322222 23


Q ss_pred             hcCCCCCcccCc--chhhhcChHHHHHhHhhccCCCCCCCCCC
Q psy6676          78 THTDIKPYNCAA--CGKVFRRNCDLRRHSLTHNLGSATSTSSG  118 (144)
Q Consensus        78 ~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~~~~  118 (144)
                      .+-..++-.|..  |.. -.+...|++|.+.-|....+...++
T Consensus       101 ~~LN~K~RsC~~e~C~F-~GtY~eLrKHar~~HP~~rP~~vDP  142 (162)
T PF07800_consen  101 RFLNAKKRSCSQESCSF-SGTYSELRKHARSEHPSARPSEVDP  142 (162)
T ss_pred             HHhccCCccCccccccc-ccCHHHHHHHHHhhCCCCCCccCCH
Confidence            333345555643  543 3467789999999887666555443


No 94 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=77.17  E-value=0.7  Score=23.74  Aligned_cols=11  Identities=27%  Similarity=0.981  Sum_probs=4.8

Q ss_pred             ccccccccccc
Q psy6676          57 HKCPVCSRSFN   67 (144)
Q Consensus        57 ~~C~~C~~~~~   67 (144)
                      |.|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            34444444443


No 95 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=75.10  E-value=1.7  Score=20.68  Aligned_cols=10  Identities=30%  Similarity=0.989  Sum_probs=4.5

Q ss_pred             cccccccccC
Q psy6676          30 KCTECGKGFC   39 (144)
Q Consensus        30 ~C~~C~~~f~   39 (144)
                      .|+.|+..|.
T Consensus         4 ~CP~C~~~~~   13 (38)
T TIGR02098         4 QCPNCKTSFR   13 (38)
T ss_pred             ECCCCCCEEE
Confidence            3444444443


No 96 
>KOG2071|consensus
Probab=75.03  E-value=2.3  Score=33.24  Aligned_cols=26  Identities=31%  Similarity=0.636  Sum_probs=20.5

Q ss_pred             CCcccccccccccCChHHHHHHHHHh
Q psy6676          26 EKPFKCTECGKGFCQSRTLAVHKILH   51 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~l~~h~~~~   51 (144)
                      ..+..|..||.+|........|+-.|
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhh
Confidence            46689999999999887776666555


No 97 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=74.53  E-value=3.3  Score=18.05  Aligned_cols=18  Identities=17%  Similarity=0.444  Sum_probs=11.3

Q ss_pred             cccccccccCChHHHHHHH
Q psy6676          30 KCTECGKGFCQSRTLAVHK   48 (144)
Q Consensus        30 ~C~~C~~~f~~~~~l~~h~   48 (144)
                      .||+|++.+ ....+..|.
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            577887776 444555554


No 98 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=73.51  E-value=0.95  Score=21.80  Aligned_cols=11  Identities=27%  Similarity=0.923  Sum_probs=5.3

Q ss_pred             ccccccccccc
Q psy6676          57 HKCPVCSRSFN   67 (144)
Q Consensus        57 ~~C~~C~~~~~   67 (144)
                      |.|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            44555555443


No 99 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=73.30  E-value=1.7  Score=29.66  Aligned_cols=25  Identities=20%  Similarity=0.717  Sum_probs=10.4

Q ss_pred             cccccccccccCchHHHHHHhhcCC
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLLTHTD   81 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~~h~~   81 (144)
                      |.|..|++.|.-...+..|+...+.
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCH
Confidence            4444444444444444444444443


No 100
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=72.93  E-value=1.2  Score=35.93  Aligned_cols=48  Identities=23%  Similarity=0.500  Sum_probs=27.0

Q ss_pred             cccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhh
Q psy6676          30 KCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKV   93 (144)
Q Consensus        30 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~   93 (144)
                      .|..||..+..... ...+..|.......|..||+               ....|..|+.||..
T Consensus       437 ~C~~Cg~v~~Cp~C-d~~lt~H~~~~~L~CH~Cg~---------------~~~~p~~Cp~Cgs~  484 (730)
T COG1198         437 LCRDCGYIAECPNC-DSPLTLHKATGQLRCHYCGY---------------QEPIPQSCPECGSE  484 (730)
T ss_pred             ecccCCCcccCCCC-CcceEEecCCCeeEeCCCCC---------------CCCCCCCCCCCCCC
Confidence            47777766654421 01122344444567777753               23577899999864


No 101
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=71.81  E-value=2.5  Score=21.08  Aligned_cols=10  Identities=40%  Similarity=1.129  Sum_probs=4.9

Q ss_pred             cccccccccc
Q psy6676          29 FKCTECGKGF   38 (144)
Q Consensus        29 ~~C~~C~~~f   38 (144)
                      |.|..|+..|
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            4455555444


No 102
>KOG1280|consensus
Probab=70.49  E-value=5.3  Score=29.26  Aligned_cols=39  Identities=26%  Similarity=0.600  Sum_probs=28.6

Q ss_pred             CCCcccccccccccCChHHHHHHHHHhCCCC--Cccccccc
Q psy6676          25 KEKPFKCTECGKGFCQSRTLAVHKILHLEES--PHKCPVCS   63 (144)
Q Consensus        25 ~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~--~~~C~~C~   63 (144)
                      ....|.|++|+..-.+...|..|+...+..-  ...|++|+
T Consensus        76 ~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   76 DPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3456999999999999999999987654332  24566665


No 103
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=69.57  E-value=2.7  Score=21.01  Aligned_cols=10  Identities=40%  Similarity=1.361  Sum_probs=5.2

Q ss_pred             cccccccccc
Q psy6676          29 FKCTECGKGF   38 (144)
Q Consensus        29 ~~C~~C~~~f   38 (144)
                      |.|+.|+..|
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            4555555544


No 104
>KOG2785|consensus
Probab=69.42  E-value=8.3  Score=28.64  Aligned_cols=24  Identities=21%  Similarity=0.538  Sum_probs=20.2

Q ss_pred             CCccccccc---ccccCchHHHHHHhh
Q psy6676          55 SPHKCPVCS---RSFNQRSNLKTHLLT   78 (144)
Q Consensus        55 ~~~~C~~C~---~~~~~~~~l~~h~~~   78 (144)
                      ..+.|..|.   +.|........||..
T Consensus       216 ~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  216 IGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             cCceEEEeccccCcccccHHHHHHHhh
Confidence            347888888   899999999999974


No 105
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=69.01  E-value=3.2  Score=28.90  Aligned_cols=63  Identities=19%  Similarity=0.554  Sum_probs=29.4

Q ss_pred             ccCCCCcccccccccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcCh
Q psy6676          22 IHSKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRN   97 (144)
Q Consensus        22 ~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   97 (144)
                      +-+...+|.|..|+...        +.+.-.....-.|..|.+.|.-.-   .-..  =|..-|.|+.|+..|.-.
T Consensus       106 ip~~drqFaC~~Cd~~W--------wRrvp~rKeVSRCr~C~~rYDPVP---~dkm--wG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  106 IPSVDRQFACSSCDHMW--------WRRVPQRKEVSRCRKCRKRYDPVP---CDKM--WGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             ccccceeeeccccchHH--------HhccCcccccccccccccccCCCc---cccc--cceeeeecccccccchhh
Confidence            34445778888886432        112222223345666655542211   0000  112236677777666554


No 106
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=67.98  E-value=5.1  Score=24.03  Aligned_cols=26  Identities=19%  Similarity=0.347  Sum_probs=21.1

Q ss_pred             cccc----cccccccCChHHHHHHHHHhCC
Q psy6676          28 PFKC----TECGKGFCQSRTLAVHKILHLE   53 (144)
Q Consensus        28 ~~~C----~~C~~~f~~~~~l~~h~~~~~~   53 (144)
                      .|.|    ..|+..+.+...|..|.+.++|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3778    8899998899999999877653


No 107
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=67.77  E-value=2.7  Score=20.00  Aligned_cols=9  Identities=33%  Similarity=1.187  Sum_probs=4.3

Q ss_pred             ccccccccc
Q psy6676          30 KCTECGKGF   38 (144)
Q Consensus        30 ~C~~C~~~f   38 (144)
                      .|+.|+..|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            344555444


No 108
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=67.65  E-value=3.6  Score=24.85  Aligned_cols=13  Identities=23%  Similarity=0.542  Sum_probs=7.0

Q ss_pred             CCCcccccccccc
Q psy6676          54 ESPHKCPVCSRSF   66 (144)
Q Consensus        54 ~~~~~C~~C~~~~   66 (144)
                      +.|.+|+.||+.|
T Consensus        24 rdPiVsPytG~s~   36 (129)
T COG4530          24 RDPIVSPYTGKSY   36 (129)
T ss_pred             CCccccCcccccc
Confidence            3455555555555


No 109
>KOG4173|consensus
Probab=66.44  E-value=3.7  Score=27.80  Aligned_cols=49  Identities=24%  Similarity=0.525  Sum_probs=34.8

Q ss_pred             CCccccc--ccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHhHhh
Q psy6676          55 SPHKCPV--CSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRHSLT  106 (144)
Q Consensus        55 ~~~~C~~--C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  106 (144)
                      ..+.|++  |.+.|........|.-.-++   -.|.+|.+.|.+...|..|+.-
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E  128 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILE  128 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHH
Confidence            3477887  66777666655555433222   4899999999999999988753


No 110
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=66.34  E-value=2.4  Score=18.27  Aligned_cols=10  Identities=40%  Similarity=1.212  Sum_probs=6.0

Q ss_pred             CCcccCcchh
Q psy6676          83 KPYNCAACGK   92 (144)
Q Consensus        83 ~~~~C~~C~~   92 (144)
                      ..|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4566666663


No 111
>KOG2907|consensus
Probab=66.28  E-value=2  Score=26.00  Aligned_cols=40  Identities=25%  Similarity=0.509  Sum_probs=20.7

Q ss_pred             cccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcC
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRR   96 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~   96 (144)
                      .+|+.||..-.....++..-.--....-|.|..|++.|+.
T Consensus        75 ~kCpkCghe~m~Y~T~QlRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQLRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhhcccccCCceEEEEcCccceeeec
Confidence            5788887543332222221111112234789899887764


No 112
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=66.06  E-value=7.7  Score=18.93  Aligned_cols=24  Identities=25%  Similarity=0.495  Sum_probs=17.6

Q ss_pred             ccccccccccC--ChHHHHHHHHHhC
Q psy6676          29 FKCTECGKGFC--QSRTLAVHKILHL   52 (144)
Q Consensus        29 ~~C~~C~~~f~--~~~~l~~h~~~~~   52 (144)
                      -.|+.|+..|.  ...+...|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            57999999986  4466777766653


No 113
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=66.04  E-value=1.4  Score=24.64  Aligned_cols=42  Identities=19%  Similarity=0.464  Sum_probs=22.4

Q ss_pred             cccccccccccCchHHHHHHhhcCCCCCcccC--cchhhhcChHHH
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCA--ACGKVFRRNCDL  100 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~--~C~~~f~~~~~l  100 (144)
                      +.|+.|+..-.........  ....+..+.|.  .||..|.....+
T Consensus         2 m~CP~Cg~~a~irtSr~~s--~~~~~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYIT--DTTKERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             ccCCCCCCccEEEEChhcC--hhhheeeeecCCCCCCCEEEEEEEE
Confidence            3566676543222211111  11345667887  788888876543


No 114
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=65.49  E-value=6  Score=19.74  Aligned_cols=11  Identities=45%  Similarity=0.936  Sum_probs=7.7

Q ss_pred             CCCcccCcchh
Q psy6676          82 IKPYNCAACGK   92 (144)
Q Consensus        82 ~~~~~C~~C~~   92 (144)
                      ...|+|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            46678887765


No 115
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=64.94  E-value=3  Score=26.18  Aligned_cols=24  Identities=38%  Similarity=0.497  Sum_probs=18.5

Q ss_pred             cccCcchhhhcChHHHHHhHhhccCCC
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLTHNLGS  111 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~h~~~~  111 (144)
                      ..|..+|+.|+   .|++|+.+|+.-.
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmT  100 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLT  100 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCC
Confidence            57888998776   4789999887543


No 116
>PHA00626 hypothetical protein
Probab=64.87  E-value=2.5  Score=22.24  Aligned_cols=17  Identities=24%  Similarity=0.585  Sum_probs=13.0

Q ss_pred             CCCcccCcchhhhcChH
Q psy6676          82 IKPYNCAACGKVFRRNC   98 (144)
Q Consensus        82 ~~~~~C~~C~~~f~~~~   98 (144)
                      ...|+|+.||..|+..+
T Consensus        21 snrYkCkdCGY~ft~~~   37 (59)
T PHA00626         21 SDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             CcceEcCCCCCeechhh
Confidence            35689999998887653


No 117
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=64.69  E-value=4.8  Score=23.45  Aligned_cols=28  Identities=29%  Similarity=0.721  Sum_probs=18.7

Q ss_pred             CCcccccccccccCchHHHHHHhhcCCCCCcccCcchh
Q psy6676          55 SPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGK   92 (144)
Q Consensus        55 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   92 (144)
                      +|..|..||+.|...          .-.+|-+|+.|..
T Consensus        57 ~Pa~CkkCGfef~~~----------~ik~pSRCP~CKS   84 (97)
T COG3357          57 RPARCKKCGFEFRDD----------KIKKPSRCPKCKS   84 (97)
T ss_pred             cChhhcccCcccccc----------ccCCcccCCcchh
Confidence            567888888887541          1235678888864


No 118
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=64.56  E-value=0.69  Score=22.57  Aligned_cols=10  Identities=40%  Similarity=1.251  Sum_probs=6.4

Q ss_pred             cccCcchhhh
Q psy6676          85 YNCAACGKVF   94 (144)
Q Consensus        85 ~~C~~C~~~f   94 (144)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            6676676554


No 119
>KOG0782|consensus
Probab=64.50  E-value=1.1  Score=34.93  Aligned_cols=51  Identities=20%  Similarity=0.496  Sum_probs=35.7

Q ss_pred             HHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCC-CCcccCcchhhhcChH
Q psy6676          42 RTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDI-KPYNCAACGKVFRRNC   98 (144)
Q Consensus        42 ~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~-~~~~C~~C~~~f~~~~   98 (144)
                      ..+.+|-.+|.....-+|..|++.|..+..+      |..+ ....|.+|..+|-...
T Consensus       239 ~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  239 SGFVRHHWVHRRRQEGKCNTCGKGFQQKFFF------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchHHhHhhHhhhccccchhhhhhhhheee------ccccEEEEEehHHHHHhhcch
Confidence            4677776677666667899999999776443      3332 3468999998887654


No 120
>KOG4167|consensus
Probab=64.20  E-value=2.2  Score=34.26  Aligned_cols=27  Identities=33%  Similarity=0.552  Sum_probs=23.2

Q ss_pred             CCcccCcchhhhcChHHHHHhHhhccC
Q psy6676          83 KPYNCAACGKVFRRNCDLRRHSLTHNL  109 (144)
Q Consensus        83 ~~~~C~~C~~~f~~~~~l~~H~~~h~~  109 (144)
                      ..|-|..|+|.|.....+..|+++|..
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            459999999999998899999988753


No 121
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=63.59  E-value=5.4  Score=21.28  Aligned_cols=51  Identities=27%  Similarity=0.645  Sum_probs=26.5

Q ss_pred             CCcccccccccccCChHHHHHHHHHhCCCCCccccccccc-ccCchHHHHHHhhcCCCCCcccCcchh
Q psy6676          26 EKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRS-FNQRSNLKTHLLTHTDIKPYNCAACGK   92 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~-~~~~~~l~~h~~~h~~~~~~~C~~C~~   92 (144)
                      ..+..|..|+....-.          .....|.|+.||.. ...-.      +--....+|.|+.||.
T Consensus         5 ~~~~~CtSCg~~i~~~----------~~~~~F~CPnCG~~~I~RC~------~CRk~~~~Y~CP~CGF   56 (59)
T PRK14890          5 MEPPKCTSCGIEIAPR----------EKAVKFLCPNCGEVIIYRCE------KCRKQSNPYTCPKCGF   56 (59)
T ss_pred             ccCccccCCCCcccCC----------CccCEeeCCCCCCeeEeech------hHHhcCCceECCCCCC
Confidence            3445677777553211          11234788888764 21111      1111236788888884


No 122
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=63.27  E-value=2.7  Score=26.47  Aligned_cols=10  Identities=30%  Similarity=0.873  Sum_probs=6.0

Q ss_pred             CCcccCcchh
Q psy6676          83 KPYNCAACGK   92 (144)
Q Consensus        83 ~~~~C~~C~~   92 (144)
                      ..+.|+.||.
T Consensus       106 ~~~~CP~Cgs  115 (135)
T PRK03824        106 AFLKCPKCGS  115 (135)
T ss_pred             cCcCCcCCCC
Confidence            3356777764


No 123
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=63.00  E-value=1.9  Score=25.14  Aligned_cols=33  Identities=18%  Similarity=0.516  Sum_probs=21.4

Q ss_pred             CCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcCh
Q psy6676          55 SPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRN   97 (144)
Q Consensus        55 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   97 (144)
                      ..|.|+.|++.-..        +  .+...|.|..|++.|.-.
T Consensus        35 a~y~CpfCgk~~vk--------R--~a~GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         35 AKYFCPFCGKHAVK--------R--QAVGIWRCKGCKKTVAGG   67 (90)
T ss_pred             CCccCCCCCCCcee--------e--eeeEEEEcCCCCCEEeCC
Confidence            45889999754211        1  223668999999888654


No 124
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=62.74  E-value=1.7  Score=25.41  Aligned_cols=33  Identities=21%  Similarity=0.580  Sum_probs=21.3

Q ss_pred             CCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcCh
Q psy6676          55 SPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRN   97 (144)
Q Consensus        55 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   97 (144)
                      ..|.|+.|++.-..        +  .+...|.|..|++.|.-.
T Consensus        34 a~y~CpfCgk~~vk--------R--~a~GIW~C~~C~~~~AGG   66 (91)
T TIGR00280        34 AKYVCPFCGKKTVK--------R--GSTGIWTCRKCGAKFAGG   66 (91)
T ss_pred             cCccCCCCCCCceE--------E--EeeEEEEcCCCCCEEeCC
Confidence            35889999754211        1  223568999999888654


No 125
>KOG2593|consensus
Probab=62.35  E-value=5.6  Score=30.01  Aligned_cols=38  Identities=18%  Similarity=0.486  Sum_probs=22.1

Q ss_pred             CCCCcccccccccccCChHHHHHHHHHhCCCCCcccccccc
Q psy6676          24 SKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSR   64 (144)
Q Consensus        24 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~   64 (144)
                      .....|.|+.|.+.|.....++.-   .-....|.|..|+.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L~---~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQLL---DNETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHHhh---cccCceEEEecCCC
Confidence            345667788888777655444321   22233477777764


No 126
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=61.46  E-value=5.5  Score=23.92  Aligned_cols=26  Identities=19%  Similarity=0.387  Sum_probs=21.7

Q ss_pred             CCCCcccCcchhhhcChHHHHHhHhh
Q psy6676          81 DIKPYNCAACGKVFRRNCDLRRHSLT  106 (144)
Q Consensus        81 ~~~~~~C~~C~~~f~~~~~l~~H~~~  106 (144)
                      |-..+.|..|.+-|.+...|..|.+.
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhcc
Confidence            44558999999999999999999763


No 127
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=60.33  E-value=3.7  Score=17.98  Aligned_cols=9  Identities=44%  Similarity=1.036  Sum_probs=5.0

Q ss_pred             ccCcchhhh
Q psy6676          86 NCAACGKVF   94 (144)
Q Consensus        86 ~C~~C~~~f   94 (144)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            455555555


No 128
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=60.07  E-value=4.5  Score=19.15  Aligned_cols=32  Identities=16%  Similarity=0.503  Sum_probs=18.2

Q ss_pred             cccccccccCChHHHHHHHHHhCCCCCcccccccccc
Q psy6676          30 KCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSF   66 (144)
Q Consensus        30 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~   66 (144)
                      .|+.|+..|......     .-.......|..|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEe
Confidence            577777777665431     11223345777777655


No 129
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=59.54  E-value=2.9  Score=21.20  Aligned_cols=11  Identities=27%  Similarity=0.935  Sum_probs=5.7

Q ss_pred             ccccccccccC
Q psy6676          29 FKCTECGKGFC   39 (144)
Q Consensus        29 ~~C~~C~~~f~   39 (144)
                      |.|..|+..|.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            45555555543


No 130
>KOG3408|consensus
Probab=58.44  E-value=6.6  Score=24.24  Aligned_cols=26  Identities=27%  Similarity=0.526  Sum_probs=20.3

Q ss_pred             CCCcccccccccccCChHHHHHHHHH
Q psy6676          25 KEKPFKCTECGKGFCQSRTLAVHKIL   50 (144)
Q Consensus        25 ~~~~~~C~~C~~~f~~~~~l~~h~~~   50 (144)
                      |-.+|-|-.|.+-|.+...|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            56668888888888888888888654


No 131
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=57.51  E-value=3.8  Score=18.66  Aligned_cols=7  Identities=43%  Similarity=1.213  Sum_probs=3.3

Q ss_pred             ccccccc
Q psy6676          57 HKCPVCS   63 (144)
Q Consensus        57 ~~C~~C~   63 (144)
                      +.|+.|+
T Consensus        20 ~vCp~C~   26 (30)
T PF08274_consen   20 LVCPECG   26 (30)
T ss_dssp             EEETTTT
T ss_pred             EeCCccc
Confidence            4444444


No 132
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=57.11  E-value=5.4  Score=20.45  Aligned_cols=11  Identities=36%  Similarity=1.223  Sum_probs=6.3

Q ss_pred             ccccccccccc
Q psy6676          28 PFKCTECGKGF   38 (144)
Q Consensus        28 ~~~C~~C~~~f   38 (144)
                      .|.|..|++.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            35566666555


No 133
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=56.85  E-value=6.5  Score=29.70  Aligned_cols=14  Identities=29%  Similarity=0.809  Sum_probs=7.7

Q ss_pred             CcccCcchhhhcCh
Q psy6676          84 PYNCAACGKVFRRN   97 (144)
Q Consensus        84 ~~~C~~C~~~f~~~   97 (144)
                      -|+|+.||..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            56666666555443


No 134
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=56.78  E-value=5.1  Score=28.19  Aligned_cols=84  Identities=24%  Similarity=0.366  Sum_probs=47.1

Q ss_pred             cCCCCcccccccccccCChHHHHHHHHH--hCCCCCcccccccccccCc------hHHHHHHhh----cCCCCCcccCcc
Q psy6676          23 HSKEKPFKCTECGKGFCQSRTLAVHKIL--HLEESPHKCPVCSRSFNQR------SNLKTHLLT----HTDIKPYNCAAC   90 (144)
Q Consensus        23 h~~~~~~~C~~C~~~f~~~~~l~~h~~~--~~~~~~~~C~~C~~~~~~~------~~l~~h~~~----h~~~~~~~C~~C   90 (144)
                      ..|.+-|.|..|.... .+-+-=.|+..  ......|+|.-|.+.-..+      -....|.+.    ....+++.|+.|
T Consensus       137 ~hGGrif~CsfC~~fl-CEDDQFEHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKC  215 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFL-CEDDQFEHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKC  215 (314)
T ss_pred             cCCCeEEEeecCCCee-eccchhhhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCC
Confidence            3466778999998544 33333334332  2334567887777643321      112234432    123367899999


Q ss_pred             hhhhcChHHHHHhHhhc
Q psy6676          91 GKVFRRNCDLRRHSLTH  107 (144)
Q Consensus        91 ~~~f~~~~~l~~H~~~h  107 (144)
                      +.-......|.--.|+|
T Consensus       216 g~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  216 GYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCcccccccceeeeecc
Confidence            98776666665444444


No 135
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=56.76  E-value=3.2  Score=32.17  Aligned_cols=11  Identities=36%  Similarity=0.942  Sum_probs=7.2

Q ss_pred             CCCcccCcchh
Q psy6676          82 IKPYNCAACGK   92 (144)
Q Consensus        82 ~~~~~C~~C~~   92 (144)
                      ..+..|+.|+.
T Consensus       251 ~~~~~Cp~C~s  261 (505)
T TIGR00595       251 PIPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCCC
Confidence            34567878865


No 136
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=56.53  E-value=2.3  Score=24.83  Aligned_cols=33  Identities=30%  Similarity=0.719  Sum_probs=21.1

Q ss_pred             CCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcCh
Q psy6676          55 SPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRN   97 (144)
Q Consensus        55 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   97 (144)
                      ..|.|+.|++.-..        +  .+...|.|..|++.|.-.
T Consensus        35 a~y~CpfCgk~~vk--------R--~a~GIW~C~~C~~~~AGG   67 (90)
T PRK03976         35 AKHVCPVCGRPKVK--------R--VGTGIWECRKCGAKFAGG   67 (90)
T ss_pred             cCccCCCCCCCceE--------E--EEEEEEEcCCCCCEEeCC
Confidence            35889998754211        1  223568999999888654


No 137
>PRK14873 primosome assembly protein PriA; Provisional
Probab=56.18  E-value=6.5  Score=31.68  Aligned_cols=44  Identities=20%  Similarity=0.558  Sum_probs=26.0

Q ss_pred             cccccccccCChH---HHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhh
Q psy6676          30 KCTECGKGFCQSR---TLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKV   93 (144)
Q Consensus        30 ~C~~C~~~f~~~~---~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~   93 (144)
                      .|..|+..+....   .|..    |.......|..||..                ..++.|+.||..
T Consensus       385 ~C~~Cg~~~~C~~C~~~L~~----h~~~~~l~Ch~CG~~----------------~~p~~Cp~Cgs~  431 (665)
T PRK14873        385 ACARCRTPARCRHCTGPLGL----PSAGGTPRCRWCGRA----------------APDWRCPRCGSD  431 (665)
T ss_pred             EhhhCcCeeECCCCCCceeE----ecCCCeeECCCCcCC----------------CcCccCCCCcCC
Confidence            5777777665442   2332    333445678888632                146788888754


No 138
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=55.65  E-value=1.6  Score=19.53  Aligned_cols=19  Identities=26%  Similarity=0.754  Sum_probs=10.3

Q ss_pred             cccCcchhhhcChHHHHHhH
Q psy6676          85 YNCAACGKVFRRNCDLRRHS  104 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~  104 (144)
                      |.|..|++.| .....+.|.
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT--
T ss_pred             CeeecCCCCc-CcCCcCCCC
Confidence            4577788877 333444443


No 139
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=54.46  E-value=10  Score=26.01  Aligned_cols=30  Identities=23%  Similarity=0.419  Sum_probs=22.5

Q ss_pred             CCCCcccccccccccCChHHHHHHHHHhCC
Q psy6676          24 SKEKPFKCTECGKGFCQSRTLAVHKILHLE   53 (144)
Q Consensus        24 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~   53 (144)
                      .++..|.|+.|++.|.-..-+..|+...+.
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            355679999999999999999999876554


No 140
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=54.27  E-value=3.1  Score=28.72  Aligned_cols=8  Identities=25%  Similarity=0.546  Sum_probs=6.3

Q ss_pred             cccCcchh
Q psy6676          85 YNCAACGK   92 (144)
Q Consensus        85 ~~C~~C~~   92 (144)
                      ..|+.|+.
T Consensus        63 vvCP~C~y   70 (267)
T COG1655          63 VVCPICYY   70 (267)
T ss_pred             EEcchhhH
Confidence            57899975


No 141
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=53.29  E-value=4.2  Score=19.95  Aligned_cols=15  Identities=33%  Similarity=0.820  Sum_probs=11.8

Q ss_pred             cccCcchhhhcChHH
Q psy6676          85 YNCAACGKVFRRNCD   99 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~   99 (144)
                      |+|..||..|.....
T Consensus         6 y~C~~Cg~~fe~~~~   20 (42)
T PF09723_consen    6 YRCEECGHEFEVLQS   20 (42)
T ss_pred             EEeCCCCCEEEEEEE
Confidence            789999988876644


No 142
>KOG0717|consensus
Probab=52.68  E-value=7.2  Score=29.82  Aligned_cols=21  Identities=29%  Similarity=0.684  Sum_probs=18.9

Q ss_pred             cccCcchhhhcChHHHHHhHh
Q psy6676          85 YNCAACGKVFRRNCDLRRHSL  105 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~  105 (144)
                      +.|.+|.|.|.+...+..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999999988864


No 143
>KOG2593|consensus
Probab=52.12  E-value=7.4  Score=29.40  Aligned_cols=35  Identities=20%  Similarity=0.653  Sum_probs=21.9

Q ss_pred             CCCcccccccccccCchHHHHHHhhcCCCCCcccCcch
Q psy6676          54 ESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACG   91 (144)
Q Consensus        54 ~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~   91 (144)
                      ...|.|+.|.+.|...-.++-   .......|.|..|+
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCG  160 (436)
T ss_pred             cccccCCccccchhhhHHHHh---hcccCceEEEecCC
Confidence            455889999888866543322   22223458888885


No 144
>KOG2636|consensus
Probab=52.03  E-value=9.9  Score=28.92  Aligned_cols=29  Identities=31%  Similarity=0.500  Sum_probs=23.4

Q ss_pred             hhcCCCCCcccCcch-hhhcChHHHHHhHh
Q psy6676          77 LTHTDIKPYNCAACG-KVFRRNCDLRRHSL  105 (144)
Q Consensus        77 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  105 (144)
                      +.|.....|.|.+|| +++.-...+.+|-.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            566667789999999 78888888888853


No 145
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=51.65  E-value=10  Score=19.01  Aligned_cols=22  Identities=32%  Similarity=0.519  Sum_probs=15.3

Q ss_pred             cccccccccccCchHHHHHHhh
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLLT   78 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~~   78 (144)
                      |.|-.|...+...+.|..||+.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            5666677777777777777763


No 146
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=51.49  E-value=6.3  Score=25.37  Aligned_cols=32  Identities=25%  Similarity=0.788  Sum_probs=17.4

Q ss_pred             CcccccccccccCchHHHHHHhhcCCCCCcccCcchh
Q psy6676          56 PHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGK   92 (144)
Q Consensus        56 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   92 (144)
                      +|.|. |+..|..   ...|-..-.|+ .|.|..|+-
T Consensus       117 ~Y~C~-C~q~~l~---~RRhn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         117 PYRCQ-CQQHYLR---IRRHNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             eEEee-cCCccch---hhhcccccccc-eEEeccCCc
Confidence            46676 7665433   23333344454 677777764


No 147
>KOG4377|consensus
Probab=50.92  E-value=9.6  Score=28.69  Aligned_cols=50  Identities=16%  Similarity=0.187  Sum_probs=33.3

Q ss_pred             cccccccccccccccccc---------cccCCCCcccc--cccccccCChHHHHHHHHHhC
Q psy6676           3 RAQHRDDMALETINLAQG---------YIHSKEKPFKC--TECGKGFCQSRTLAVHKILHL   52 (144)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~---------~~h~~~~~~~C--~~C~~~f~~~~~l~~h~~~~~   52 (144)
                      |+-+++.+.|....+...         .+..+.+.|.|  +.|+..+..+.++-.|+..|.
T Consensus       237 ~a~le~~~~lqg~arfsss~~c~~~~c~~e~~rEhyhcl~e~C~ykr~~k~DvirH~~~hk  297 (480)
T KOG4377|consen  237 RARLEGTGQLQGYARFSSSVKCSFFGCHVEAGREHYHCLNEYCFYKRGQKNDVIRHVEIHK  297 (480)
T ss_pred             hhhccchhhhhhhhhhhhhhhhccccceeeccchhhcccCccccccccchhhhHHHHHHHh
Confidence            455666666666544433         23345667888  459888888888888887664


No 148
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=49.89  E-value=7.4  Score=23.08  Aligned_cols=16  Identities=44%  Similarity=0.924  Sum_probs=11.3

Q ss_pred             cCCCCcccccccccccC
Q psy6676          23 HSKEKPFKCTECGKGFC   39 (144)
Q Consensus        23 h~~~~~~~C~~C~~~f~   39 (144)
                      +.| +++.|+.|+..|.
T Consensus        75 ~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          75 EKG-KPKRCPECGHVFK   90 (97)
T ss_pred             eCC-CceeCCCCCcEEE
Confidence            444 6778888887775


No 149
>KOG1994|consensus
Probab=49.76  E-value=7.3  Score=26.83  Aligned_cols=22  Identities=32%  Similarity=0.705  Sum_probs=18.9

Q ss_pred             CCcccCcchhhhcChHHHHHhH
Q psy6676          83 KPYNCAACGKVFRRNCDLRRHS  104 (144)
Q Consensus        83 ~~~~C~~C~~~f~~~~~l~~H~  104 (144)
                      ..|.|-+||..|.+...|..|-
T Consensus       238 eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             cceEEEEeccccCCHHHHHHhC
Confidence            3489999999999999998774


No 150
>KOG0978|consensus
Probab=49.61  E-value=5.2  Score=32.20  Aligned_cols=20  Identities=30%  Similarity=0.522  Sum_probs=14.6

Q ss_pred             CcccCcchhhhcChHHHHHh
Q psy6676          84 PYNCAACGKVFRRNCDLRRH  103 (144)
Q Consensus        84 ~~~C~~C~~~f~~~~~l~~H  103 (144)
                      .-+||.|+.+|....-+..|
T Consensus       678 qRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  678 QRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             cCCCCCCCCCCCcccccccC
Confidence            34899999999877665544


No 151
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=48.94  E-value=19  Score=25.89  Aligned_cols=31  Identities=29%  Similarity=0.434  Sum_probs=25.3

Q ss_pred             CCCCcccCcchhhhcChHHHHHhHhhccCCC
Q psy6676          81 DIKPYNCAACGKVFRRNCDLRRHSLTHNLGS  111 (144)
Q Consensus        81 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  111 (144)
                      ....|.|..|-+-|.+...|.+|+..+....
T Consensus        45 ~~~lyiCe~Clky~~~~~~l~~H~~~C~~r~   75 (290)
T PLN03238         45 CTKLYICEYCLKYMRKKKSLLRHLAKCDIRQ   75 (290)
T ss_pred             CCeEEEcCCCcchhCCHHHHHHHHHhCCCCC
Confidence            3567999999999999999999998765443


No 152
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=48.33  E-value=11  Score=28.89  Aligned_cols=33  Identities=15%  Similarity=0.270  Sum_probs=25.8

Q ss_pred             cCCCCCcccCcchhhhcChHHHHHhHhhccCCC
Q psy6676          79 HTDIKPYNCAACGKVFRRNCDLRRHSLTHNLGS  111 (144)
Q Consensus        79 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  111 (144)
                      +...+-+.|+.|.+.|.....+..|+...|.+.
T Consensus        52 n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   52 NKSWRFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             cCceeEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            444566889999999999999999998766554


No 153
>PRK04023 DNA polymerase II large subunit; Validated
Probab=47.80  E-value=14  Score=31.20  Aligned_cols=12  Identities=42%  Similarity=0.767  Sum_probs=8.1

Q ss_pred             CCcccccccccc
Q psy6676          26 EKPFKCTECGKG   37 (144)
Q Consensus        26 ~~~~~C~~C~~~   37 (144)
                      .....|+.||..
T Consensus       624 Vg~RfCpsCG~~  635 (1121)
T PRK04023        624 IGRRKCPSCGKE  635 (1121)
T ss_pred             ccCccCCCCCCc
Confidence            344578888866


No 154
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=47.59  E-value=16  Score=16.83  Aligned_cols=8  Identities=38%  Similarity=1.252  Sum_probs=3.5

Q ss_pred             cccCcchh
Q psy6676          85 YNCAACGK   92 (144)
Q Consensus        85 ~~C~~C~~   92 (144)
                      .+|+.||.
T Consensus        18 irC~~CG~   25 (32)
T PF03604_consen   18 IRCPECGH   25 (32)
T ss_dssp             SSBSSSS-
T ss_pred             EECCcCCC
Confidence            35555543


No 155
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=47.51  E-value=0.54  Score=22.81  Aligned_cols=10  Identities=40%  Similarity=1.251  Sum_probs=6.7

Q ss_pred             cccCcchhhh
Q psy6676          85 YNCAACGKVF   94 (144)
Q Consensus        85 ~~C~~C~~~f   94 (144)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6777777654


No 156
>KOG4167|consensus
Probab=47.36  E-value=4.6  Score=32.59  Aligned_cols=27  Identities=33%  Similarity=0.595  Sum_probs=22.5

Q ss_pred             CCcccccccccccCChHHHHHHHHHhC
Q psy6676          26 EKPFKCTECGKGFCQSRTLAVHKILHL   52 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~l~~h~~~~~   52 (144)
                      ..-|.|..|++.|.-...+..|++.|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            344889999999988888888888885


No 157
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=46.71  E-value=1.4  Score=31.47  Aligned_cols=9  Identities=33%  Similarity=0.704  Sum_probs=3.5

Q ss_pred             ccccccccc
Q psy6676          29 FKCTECGKG   37 (144)
Q Consensus        29 ~~C~~C~~~   37 (144)
                      -.||+||..
T Consensus       173 g~CPvCGs~  181 (290)
T PF04216_consen  173 GYCPVCGSP  181 (290)
T ss_dssp             SS-TTT---
T ss_pred             CcCCCCCCc
Confidence            368888854


No 158
>COG1773 Rubredoxin [Energy production and conversion]
Probab=46.28  E-value=6.8  Score=20.61  Aligned_cols=14  Identities=29%  Similarity=0.961  Sum_probs=10.2

Q ss_pred             CcccCcchhhhcCh
Q psy6676          84 PYNCAACGKVFRRN   97 (144)
Q Consensus        84 ~~~C~~C~~~f~~~   97 (144)
                      .|+|.+||..|.-.
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            57888888777544


No 159
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=45.99  E-value=13  Score=20.10  Aligned_cols=11  Identities=27%  Similarity=0.936  Sum_probs=5.5

Q ss_pred             CCcccCcchhh
Q psy6676          83 KPYNCAACGKV   93 (144)
Q Consensus        83 ~~~~C~~C~~~   93 (144)
                      +.|.|+.||..
T Consensus        45 r~~~C~~Cg~~   55 (69)
T PF07282_consen   45 RVFTCPNCGFE   55 (69)
T ss_pred             ceEEcCCCCCE
Confidence            44555555543


No 160
>KOG0978|consensus
Probab=44.82  E-value=8.4  Score=31.07  Aligned_cols=49  Identities=20%  Similarity=0.461  Sum_probs=29.2

Q ss_pred             CCcccccccccccCChHH-HHHH------HHHhCCCCCcccccccccccCchHHHH
Q psy6676          26 EKPFKCTECGKGFCQSRT-LAVH------KILHLEESPHKCPVCSRSFNQRSNLKT   74 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~-l~~h------~~~~~~~~~~~C~~C~~~~~~~~~l~~   74 (144)
                      +....|+.|+..++..-- -..|      +..-.+.+.-+||.|+..|.....+..
T Consensus       641 K~~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganDv~~I  696 (698)
T KOG0978|consen  641 KELLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGANDVHRI  696 (698)
T ss_pred             HhceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCccccccc
Confidence            345689999877654421 1333      222233344699999999977654443


No 161
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=44.67  E-value=22  Score=18.32  Aligned_cols=10  Identities=40%  Similarity=1.308  Sum_probs=3.6

Q ss_pred             cccccccccc
Q psy6676          58 KCPVCSRSFN   67 (144)
Q Consensus        58 ~C~~C~~~~~   67 (144)
                      .|++|++.|.
T Consensus        22 ~CPlC~r~l~   31 (54)
T PF04423_consen   22 CCPLCGRPLD   31 (54)
T ss_dssp             E-TTT--EE-
T ss_pred             cCCCCCCCCC
Confidence            5666665553


No 162
>PRK05580 primosome assembly protein PriA; Validated
Probab=44.15  E-value=6.3  Score=31.80  Aligned_cols=10  Identities=40%  Similarity=1.102  Sum_probs=6.3

Q ss_pred             CCcccCcchh
Q psy6676          83 KPYNCAACGK   92 (144)
Q Consensus        83 ~~~~C~~C~~   92 (144)
                      .+..|+.||.
T Consensus       420 ~~~~Cp~Cg~  429 (679)
T PRK05580        420 IPKACPECGS  429 (679)
T ss_pred             CCCCCCCCcC
Confidence            4556777754


No 163
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=43.80  E-value=4.7  Score=26.02  Aligned_cols=19  Identities=26%  Similarity=0.494  Sum_probs=14.2

Q ss_pred             CCCCCcccCcchhhhcChH
Q psy6676          80 TDIKPYNCAACGKVFRRNC   98 (144)
Q Consensus        80 ~~~~~~~C~~C~~~f~~~~   98 (144)
                      +.+.|..|..||+.|++-.
T Consensus        64 ~~~~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   64 HYEAPSYCHNCGKPYPWTE   82 (158)
T ss_pred             CCCCChhHHhCCCCCchHH
Confidence            3457788888998888853


No 164
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=43.76  E-value=10  Score=23.10  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=5.2

Q ss_pred             cccccccccc
Q psy6676          57 HKCPVCSRSF   66 (144)
Q Consensus        57 ~~C~~C~~~~   66 (144)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (115)
T TIGR00100        71 CECEDCSEEV   80 (115)
T ss_pred             EEcccCCCEE
Confidence            4555555444


No 165
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=43.31  E-value=11  Score=18.42  Aligned_cols=12  Identities=33%  Similarity=1.002  Sum_probs=9.4

Q ss_pred             Cccccccccccc
Q psy6676          27 KPFKCTECGKGF   38 (144)
Q Consensus        27 ~~~~C~~C~~~f   38 (144)
                      ++-.|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            467899998876


No 166
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=43.19  E-value=12  Score=22.75  Aligned_cols=10  Identities=30%  Similarity=0.454  Sum_probs=5.3

Q ss_pred             cccccccccc
Q psy6676          57 HKCPVCSRSF   66 (144)
Q Consensus        57 ~~C~~C~~~~   66 (144)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4555565444


No 167
>KOG4124|consensus
Probab=42.86  E-value=2.3  Score=31.12  Aligned_cols=71  Identities=25%  Similarity=0.460  Sum_probs=38.5

Q ss_pred             CCcccccc--cccccCChHHHHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcChHHHHHh
Q psy6676          26 EKPFKCTE--CGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRNCDLRRH  103 (144)
Q Consensus        26 ~~~~~C~~--C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H  103 (144)
                      .++|.|++  |++.+.....|..|....+-.      --  ..... .-..|+..-...++|+|++|.+.++....|.-|
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s------~i--~~~s~-~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~  417 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCS------PI--TTPTP-APIPHQGFVVENKPYRCEVCSKRYKNLNGLKYH  417 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCC------CC--CCCCC-CCCCcceeeeccCcccChhhhhhhccCCCCCce
Confidence            46677755  777777666666553221110      00  00000 111233333345789999999988887776655


Q ss_pred             Hh
Q psy6676         104 SL  105 (144)
Q Consensus       104 ~~  105 (144)
                      +-
T Consensus       418 ~~  419 (442)
T KOG4124|consen  418 RT  419 (442)
T ss_pred             ee
Confidence            43


No 168
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=42.67  E-value=19  Score=18.94  Aligned_cols=13  Identities=23%  Similarity=0.603  Sum_probs=6.5

Q ss_pred             CCCcccccccccc
Q psy6676          54 ESPHKCPVCSRSF   66 (144)
Q Consensus        54 ~~~~~C~~C~~~~   66 (144)
                      ...|.|+.||..+
T Consensus        12 ~v~~~Cp~cGipt   24 (55)
T PF13824_consen   12 HVNFECPDCGIPT   24 (55)
T ss_pred             ccCCcCCCCCCcC
Confidence            3445555555433


No 169
>KOG1842|consensus
Probab=42.56  E-value=14  Score=28.23  Aligned_cols=21  Identities=33%  Similarity=0.635  Sum_probs=12.7

Q ss_pred             cccccccccccCchHHHHHHh
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLL   77 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~   77 (144)
                      |.|++|...|.+...|..|..
T Consensus        16 flCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHh
Confidence            566666666666666666654


No 170
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=42.48  E-value=13  Score=26.96  Aligned_cols=14  Identities=29%  Similarity=0.425  Sum_probs=9.7

Q ss_pred             CCCccccccccccc
Q psy6676          25 KEKPFKCTECGKGF   38 (144)
Q Consensus        25 ~~~~~~C~~C~~~f   38 (144)
                      +.....||+||...
T Consensus       184 ~~~~~~CPvCGs~P  197 (309)
T PRK03564        184 GEQRQFCPVCGSMP  197 (309)
T ss_pred             ccCCCCCCCCCCcc
Confidence            44556799999653


No 171
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=42.29  E-value=8.3  Score=25.99  Aligned_cols=27  Identities=22%  Similarity=0.533  Sum_probs=0.0

Q ss_pred             hcCCCCCcccCcch-hhhcChHHHHHhH
Q psy6676          78 THTDIKPYNCAACG-KVFRRNCDLRRHS  104 (144)
Q Consensus        78 ~h~~~~~~~C~~C~-~~f~~~~~l~~H~  104 (144)
                      .|...+.|.|.+|| .+|.-...+.+|-
T Consensus        95 LhGL~~ey~CEICGN~~Y~GrkaFekHF  122 (196)
T PF11931_consen   95 LHGLGVEYKCEICGNQSYKGRKAFEKHF  122 (196)
T ss_dssp             ----------------------------
T ss_pred             HhCCCCeeeeEeCCCcceecHHHHHHhc
Confidence            44455668888887 3555566666664


No 172
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=42.06  E-value=10  Score=19.47  Aligned_cols=20  Identities=25%  Similarity=0.471  Sum_probs=13.2

Q ss_pred             CCCcccCcchhhhcChHHHH
Q psy6676          82 IKPYNCAACGKVFRRNCDLR  101 (144)
Q Consensus        82 ~~~~~C~~C~~~f~~~~~l~  101 (144)
                      ++.+.|..||..|.....-+
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ   21 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQ   21 (49)
T ss_pred             CeeEEcccCCCeEEEehhHH
Confidence            35677888888776655443


No 173
>PHA02998 RNA polymerase subunit; Provisional
Probab=42.05  E-value=4.2  Score=26.88  Aligned_cols=41  Identities=20%  Similarity=0.432  Sum_probs=20.1

Q ss_pred             cccccccccccCchHHHHHHhhcCCCCCcccCcchhhhcCh
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVFRRN   97 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   97 (144)
                      ..|+.|+..-.....++..-.--.--.-|.|..||+.|.-.
T Consensus       144 v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCceEEEEEeeccCCCCceEEEEcCCCCCccCCc
Confidence            57888875433322222111000111237899999877543


No 174
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=42.00  E-value=14  Score=18.23  Aligned_cols=12  Identities=33%  Similarity=0.933  Sum_probs=6.6

Q ss_pred             ccCcchhhhcCh
Q psy6676          86 NCAACGKVFRRN   97 (144)
Q Consensus        86 ~C~~C~~~f~~~   97 (144)
                      .|.+|++.|+..
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            455566555544


No 175
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=41.69  E-value=4.3  Score=32.68  Aligned_cols=55  Identities=27%  Similarity=0.652  Sum_probs=26.6

Q ss_pred             ccccccccCChHHHHHHHHHhCCCCC-cccccccccccCchHHHHHHhhcCCCCCcccCcchh
Q psy6676          31 CTECGKGFCQSRTLAVHKILHLEESP-HKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGK   92 (144)
Q Consensus        31 C~~C~~~f~~~~~l~~h~~~~~~~~~-~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   92 (144)
                      |..||.+|.....|--- +.++.-.. -.|+.|.+-|....+.    |.|.  .+.-|+.||-
T Consensus       126 CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nR----RfHA--Qp~aCp~CGP  181 (750)
T COG0068         126 CTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNR----RFHA--QPIACPKCGP  181 (750)
T ss_pred             cCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCcccc----cccc--ccccCcccCC
Confidence            66666666554433110 11111111 2466676666555433    2332  4567777874


No 176
>PF12907 zf-met2:  Zinc-binding
Probab=41.68  E-value=24  Score=17.23  Aligned_cols=25  Identities=20%  Similarity=0.481  Sum_probs=16.8

Q ss_pred             cccCcchhhh---cChHHHHHhHhhccC
Q psy6676          85 YNCAACGKVF---RRNCDLRRHSLTHNL  109 (144)
Q Consensus        85 ~~C~~C~~~f---~~~~~l~~H~~~h~~  109 (144)
                      ++|.+|...|   .....|..|-..-|.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHp   29 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHP   29 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCC
Confidence            5788888555   455678888765443


No 177
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=40.98  E-value=12  Score=22.61  Aligned_cols=12  Identities=33%  Similarity=0.808  Sum_probs=6.5

Q ss_pred             Cccccccccccc
Q psy6676          56 PHKCPVCSRSFN   67 (144)
Q Consensus        56 ~~~C~~C~~~~~   67 (144)
                      .|.|+.|+.-|.
T Consensus        19 ~~iCpeC~~EW~   30 (109)
T TIGR00686        19 QLICPSCLYEWN   30 (109)
T ss_pred             eeECcccccccc
Confidence            356666655443


No 178
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=40.54  E-value=20  Score=26.51  Aligned_cols=32  Identities=25%  Similarity=0.351  Sum_probs=27.2

Q ss_pred             CCCcccCcchhhhcChHHHHHhHhhccCCCCC
Q psy6676          82 IKPYNCAACGKVFRRNCDLRRHSLTHNLGSAT  113 (144)
Q Consensus        82 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  113 (144)
                      ...|.|..|-+.|.+...|.+|++.+....++
T Consensus       156 d~vyICefClkY~~s~~~~~rH~~kC~~~~pP  187 (395)
T COG5027         156 DIVYICEFCLKYYGSQTSLVRHRKKCSLQHPP  187 (395)
T ss_pred             ceEEEhhhhHHHhcchhHHHHHHhcCcCcCCC
Confidence            45699999999999999999999988776533


No 179
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=40.15  E-value=12  Score=19.14  Aligned_cols=10  Identities=20%  Similarity=0.624  Sum_probs=5.9

Q ss_pred             Cccccccccc
Q psy6676          56 PHKCPVCSRS   65 (144)
Q Consensus        56 ~~~C~~C~~~   65 (144)
                      .+.|..|+..
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            4566666644


No 180
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=40.11  E-value=23  Score=25.74  Aligned_cols=11  Identities=27%  Similarity=0.700  Sum_probs=7.8

Q ss_pred             Ccccccccccc
Q psy6676          27 KPFKCTECGKG   37 (144)
Q Consensus        27 ~~~~C~~C~~~   37 (144)
                      ....||+||..
T Consensus       183 ~~~~CPvCGs~  193 (305)
T TIGR01562       183 SRTLCPACGSP  193 (305)
T ss_pred             CCCcCCCCCCh
Confidence            34479999955


No 181
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=40.07  E-value=24  Score=27.05  Aligned_cols=30  Identities=33%  Similarity=0.529  Sum_probs=25.2

Q ss_pred             CCCcccCcchhhhcChHHHHHhHhhccCCC
Q psy6676          82 IKPYNCAACGKVFRRNCDLRRHSLTHNLGS  111 (144)
Q Consensus        82 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  111 (144)
                      ...|.|..|-+-|.....|.+|+..+....
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~C~~~~  225 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKKCDLKH  225 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhcCCCCC
Confidence            355999999999999999999998765543


No 182
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=39.55  E-value=14  Score=19.22  Aligned_cols=25  Identities=24%  Similarity=0.493  Sum_probs=10.6

Q ss_pred             HHHHHHhhcCCCCCcccCc----chhhhc
Q psy6676          71 NLKTHLLTHTDIKPYNCAA----CGKVFR   95 (144)
Q Consensus        71 ~l~~h~~~h~~~~~~~C~~----C~~~f~   95 (144)
                      .|..|....-..++..|..    |+..+.
T Consensus        25 ~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen   25 ELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             CHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             HHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            4555555433444455555    554443


No 183
>PTZ00064 histone acetyltransferase; Provisional
Probab=39.42  E-value=28  Score=27.17  Aligned_cols=30  Identities=23%  Similarity=0.170  Sum_probs=25.4

Q ss_pred             CCCCcccCcchhhhcChHHHHHhHhhccCC
Q psy6676          81 DIKPYNCAACGKVFRRNCDLRRHSLTHNLG  110 (144)
Q Consensus        81 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  110 (144)
                      ....|.|..|-+-|.....|.+|+..+...
T Consensus       277 ~d~LYICEfCLkY~~s~~~l~rH~~~C~~r  306 (552)
T PTZ00064        277 VDTLHFCEYCLDFFCFEDELIRHLSRCQLR  306 (552)
T ss_pred             CCeEEEccchhhhhCCHHHHHHHHhcCCCC
Confidence            345699999999999999999999876554


No 184
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=39.37  E-value=6.9  Score=25.15  Aligned_cols=12  Identities=25%  Similarity=0.797  Sum_probs=7.2

Q ss_pred             cccccccccccC
Q psy6676          57 HKCPVCSRSFNQ   68 (144)
Q Consensus        57 ~~C~~C~~~~~~   68 (144)
                      -.|..|+..|+.
T Consensus        29 ReC~~C~~RFTT   40 (156)
T COG1327          29 RECLECGERFTT   40 (156)
T ss_pred             hcccccccccch
Confidence            356666666654


No 185
>KOG2747|consensus
Probab=39.07  E-value=25  Score=26.46  Aligned_cols=33  Identities=27%  Similarity=0.406  Sum_probs=27.7

Q ss_pred             CCCcccCcchhhhcChHHHHHhHhhccCCCCCC
Q psy6676          82 IKPYNCAACGKVFRRNCDLRRHSLTHNLGSATS  114 (144)
Q Consensus        82 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~  114 (144)
                      ...|.|..|-+-+.....|++|+..+....++.
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~kC~~rhPPG  188 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLKKCKLRHPPG  188 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHHhcCCCCCCc
Confidence            456899999999999999999999887764443


No 186
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=38.30  E-value=15  Score=17.66  Aligned_cols=14  Identities=50%  Similarity=1.248  Sum_probs=11.7

Q ss_pred             cccccccccccCCh
Q psy6676          28 PFKCTECGKGFCQS   41 (144)
Q Consensus        28 ~~~C~~C~~~f~~~   41 (144)
                      |+.|..|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899999988765


No 187
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=37.92  E-value=11  Score=19.31  Aligned_cols=13  Identities=31%  Similarity=1.063  Sum_probs=9.7

Q ss_pred             cccCcchhhhcCh
Q psy6676          85 YNCAACGKVFRRN   97 (144)
Q Consensus        85 ~~C~~C~~~f~~~   97 (144)
                      |+|..||..|.-.
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            7888998777543


No 188
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=37.55  E-value=15  Score=19.86  Aligned_cols=9  Identities=56%  Similarity=1.339  Sum_probs=2.8

Q ss_pred             ccccccccc
Q psy6676          30 KCTECGKGF   38 (144)
Q Consensus        30 ~C~~C~~~f   38 (144)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            355566665


No 189
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=36.95  E-value=44  Score=24.39  Aligned_cols=29  Identities=28%  Similarity=0.520  Sum_probs=22.3

Q ss_pred             CCCcccCcchhhhcChHHHHHhHhhccCC
Q psy6676          82 IKPYNCAACGKVFRRNCDLRRHSLTHNLG  110 (144)
Q Consensus        82 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  110 (144)
                      ...|.|+.|...|-..-..-.|...|...
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh~C~  414 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLHFCI  414 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHhhCC
Confidence            45699999999998877777777766543


No 190
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=36.73  E-value=16  Score=18.40  Aligned_cols=10  Identities=30%  Similarity=0.886  Sum_probs=4.8

Q ss_pred             CcccCcchhh
Q psy6676          84 PYNCAACGKV   93 (144)
Q Consensus        84 ~~~C~~C~~~   93 (144)
                      .+.|+.||..
T Consensus        20 ~~vC~~Cg~~   29 (52)
T smart00661       20 RFVCRKCGYE   29 (52)
T ss_pred             EEECCcCCCe
Confidence            3455555543


No 191
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=35.90  E-value=17  Score=22.76  Aligned_cols=16  Identities=31%  Similarity=0.897  Sum_probs=12.9

Q ss_pred             CCCcccCcchhhhcCh
Q psy6676          82 IKPYNCAACGKVFRRN   97 (144)
Q Consensus        82 ~~~~~C~~C~~~f~~~   97 (144)
                      ...|+|..|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            5669999999988654


No 192
>PRK05978 hypothetical protein; Provisional
Probab=35.37  E-value=19  Score=23.14  Aligned_cols=10  Identities=60%  Similarity=1.354  Sum_probs=5.5

Q ss_pred             ccCcchhhhc
Q psy6676          86 NCAACGKVFR   95 (144)
Q Consensus        86 ~C~~C~~~f~   95 (144)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            5666665443


No 193
>KOG0717|consensus
Probab=35.23  E-value=24  Score=27.18  Aligned_cols=22  Identities=27%  Similarity=0.546  Sum_probs=19.6

Q ss_pred             ccccccccccCChHHHHHHHHH
Q psy6676          29 FKCTECGKGFCQSRTLAVHKIL   50 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~   50 (144)
                      +-|.+|+++|.+...+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999643


No 194
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=35.13  E-value=32  Score=26.59  Aligned_cols=24  Identities=21%  Similarity=0.473  Sum_probs=20.9

Q ss_pred             CcccccccccccCChHHHHHHHHH
Q psy6676          27 KPFKCTECGKGFCQSRTLAVHKIL   50 (144)
Q Consensus        27 ~~~~C~~C~~~f~~~~~l~~h~~~   50 (144)
                      +-+.|+.|.+.|.....+..|+..
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHH
Confidence            347899999999999999999764


No 195
>PLN02294 cytochrome c oxidase subunit Vb
Probab=34.99  E-value=18  Score=23.80  Aligned_cols=16  Identities=31%  Similarity=0.650  Sum_probs=11.3

Q ss_pred             CCcccccccccccCCh
Q psy6676          26 EKPFKCTECGKGFCQS   41 (144)
Q Consensus        26 ~~~~~C~~C~~~f~~~   41 (144)
                      .+++.|+.|+..|+-+
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            3577788888887543


No 196
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=34.81  E-value=6.4  Score=20.36  Aligned_cols=18  Identities=22%  Similarity=0.857  Sum_probs=6.5

Q ss_pred             CcccccccccccCChHHH
Q psy6676          27 KPFKCTECGKGFCQSRTL   44 (144)
Q Consensus        27 ~~~~C~~C~~~f~~~~~l   44 (144)
                      ..|.|+.|+..|-..-++
T Consensus        20 ~~y~C~~C~~~FC~dCD~   37 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDV   37 (51)
T ss_dssp             EEE--TTTT--B-HHHHH
T ss_pred             CeEECCCCCCccccCcCh
Confidence            345566665555444443


No 197
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=34.75  E-value=22  Score=23.61  Aligned_cols=34  Identities=21%  Similarity=0.601  Sum_probs=16.9

Q ss_pred             CCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhhh
Q psy6676          52 LEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKVF   94 (144)
Q Consensus        52 ~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f   94 (144)
                      ....-|.|+.|...|......      .   ..|.|+.||...
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~------~---~~F~Cp~Cg~~L  142 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAM------E---LGFTCPKCGEDL  142 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHH------H---hCCCCCCCCchh
Confidence            334557776665554332111      1   117777777543


No 198
>KOG2807|consensus
Probab=34.52  E-value=68  Score=23.65  Aligned_cols=27  Identities=37%  Similarity=0.760  Sum_probs=19.2

Q ss_pred             CCcccCcchhhhcChHHHHHhHhhccC
Q psy6676          83 KPYNCAACGKVFRRNCDLRRHSLTHNL  109 (144)
Q Consensus        83 ~~~~C~~C~~~f~~~~~l~~H~~~h~~  109 (144)
                      ..|.|..|...|=..-..-.|...|..
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh~C  370 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLHNC  370 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhhcC
Confidence            448888888888766666667666654


No 199
>KOG0320|consensus
Probab=34.50  E-value=20  Score=23.80  Aligned_cols=14  Identities=29%  Similarity=0.667  Sum_probs=8.8

Q ss_pred             CCcccccccccccC
Q psy6676          26 EKPFKCTECGKGFC   39 (144)
Q Consensus        26 ~~~~~C~~C~~~f~   39 (144)
                      +..|.|+.|--.+.
T Consensus       129 ~~~~~CPiCl~~~s  142 (187)
T KOG0320|consen  129 EGTYKCPICLDSVS  142 (187)
T ss_pred             ccccCCCceecchh
Confidence            44478888765553


No 200
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=33.86  E-value=21  Score=22.39  Aligned_cols=14  Identities=43%  Similarity=1.118  Sum_probs=7.5

Q ss_pred             cccccccccccCCh
Q psy6676          28 PFKCTECGKGFCQS   41 (144)
Q Consensus        28 ~~~C~~C~~~f~~~   41 (144)
                      |+.|..|++.|...
T Consensus         1 PH~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    1 PHQCTKCGRVFEDG   14 (131)
T ss_pred             CcccCcCCCCcCCC
Confidence            34555666555543


No 202
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=33.57  E-value=12  Score=17.53  Aligned_cols=11  Identities=36%  Similarity=0.993  Sum_probs=3.0

Q ss_pred             ccccccccccC
Q psy6676          58 KCPVCSRSFNQ   68 (144)
Q Consensus        58 ~C~~C~~~~~~   68 (144)
                      .|..|++.|..
T Consensus         5 ~C~eC~~~f~d   15 (34)
T PF01286_consen    5 KCDECGKPFMD   15 (34)
T ss_dssp             E-TTT--EES-
T ss_pred             hHhHhCCHHHH
Confidence            34444444433


No 203
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=33.10  E-value=24  Score=26.13  Aligned_cols=23  Identities=26%  Similarity=0.505  Sum_probs=20.1

Q ss_pred             CCcccCcchhhhcChHHHHHhHh
Q psy6676          83 KPYNCAACGKVFRRNCDLRRHSL  105 (144)
Q Consensus        83 ~~~~C~~C~~~f~~~~~l~~H~~  105 (144)
                      ..+.|.+|++-|.....+..|+.
T Consensus       237 ~~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         237 PKVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             cceeeHhhhhHhhhhHHHHHHHh
Confidence            34789999999999999999984


No 204
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=32.82  E-value=22  Score=21.31  Aligned_cols=12  Identities=42%  Similarity=1.254  Sum_probs=6.8

Q ss_pred             Cccccccccccc
Q psy6676          56 PHKCPVCSRSFN   67 (144)
Q Consensus        56 ~~~C~~C~~~~~   67 (144)
                      ++.|..||..|.
T Consensus         2 pH~CtrCG~vf~   13 (112)
T COG3364           2 PHQCTRCGEVFD   13 (112)
T ss_pred             Cceecccccccc
Confidence            455666666553


No 205
>PRK10220 hypothetical protein; Provisional
Probab=32.59  E-value=26  Score=21.27  Aligned_cols=11  Identities=27%  Similarity=0.833  Sum_probs=6.3

Q ss_pred             Ccccccccccc
Q psy6676          56 PHKCPVCSRSF   66 (144)
Q Consensus        56 ~~~C~~C~~~~   66 (144)
                      .|.|+.|+.-|
T Consensus        20 ~~vCpeC~hEW   30 (111)
T PRK10220         20 MYICPECAHEW   30 (111)
T ss_pred             eEECCcccCcC
Confidence            36666666544


No 206
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=32.54  E-value=20  Score=21.93  Aligned_cols=9  Identities=33%  Similarity=0.763  Sum_probs=3.9

Q ss_pred             ccccccccc
Q psy6676          57 HKCPVCSRS   65 (144)
Q Consensus        57 ~~C~~C~~~   65 (144)
                      +.|..|+..
T Consensus        72 ~~C~~Cg~~   80 (117)
T PRK00564         72 LECKDCSHV   80 (117)
T ss_pred             EEhhhCCCc
Confidence            344444433


No 207
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=32.47  E-value=30  Score=17.72  Aligned_cols=9  Identities=56%  Similarity=1.342  Sum_probs=4.6

Q ss_pred             ccccccccC
Q psy6676          31 CTECGKGFC   39 (144)
Q Consensus        31 C~~C~~~f~   39 (144)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            455555553


No 208
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=32.16  E-value=4.3  Score=19.06  Aligned_cols=6  Identities=67%  Similarity=1.669  Sum_probs=2.3

Q ss_pred             ccCcch
Q psy6676          86 NCAACG   91 (144)
Q Consensus        86 ~C~~C~   91 (144)
                      .|..||
T Consensus        24 vC~~Cg   29 (34)
T PF14803_consen   24 VCPACG   29 (34)
T ss_dssp             EETTTT
T ss_pred             ECCCCC
Confidence            343333


No 209
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=31.61  E-value=34  Score=29.89  Aligned_cols=10  Identities=30%  Similarity=0.926  Sum_probs=6.6

Q ss_pred             cccccccccc
Q psy6676          28 PFKCTECGKG   37 (144)
Q Consensus        28 ~~~C~~C~~~   37 (144)
                      .+.|+.|+..
T Consensus       667 ~rkCPkCG~~  676 (1337)
T PRK14714        667 RRRCPSCGTE  676 (1337)
T ss_pred             EEECCCCCCc
Confidence            3667777754


No 210
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=30.98  E-value=10  Score=23.17  Aligned_cols=15  Identities=27%  Similarity=0.476  Sum_probs=10.7

Q ss_pred             CcccccccccccCCh
Q psy6676          27 KPFKCTECGKGFCQS   41 (144)
Q Consensus        27 ~~~~C~~C~~~f~~~   41 (144)
                      .-+.|..|+..+...
T Consensus        21 ~~l~C~kCgye~~~~   35 (113)
T COG1594          21 GKLVCRKCGYEEEAS   35 (113)
T ss_pred             cEEECCCCCcchhcc
Confidence            367888888776544


No 211
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.60  E-value=19  Score=19.40  Aligned_cols=14  Identities=21%  Similarity=0.553  Sum_probs=10.2

Q ss_pred             CCcccccccccccC
Q psy6676          26 EKPFKCTECGKGFC   39 (144)
Q Consensus        26 ~~~~~C~~C~~~f~   39 (144)
                      ..--.|++|+..|.
T Consensus        46 ~gev~CPYC~t~y~   59 (62)
T COG4391          46 EGEVVCPYCSTRYR   59 (62)
T ss_pred             CCcEecCccccEEE
Confidence            34457999998875


No 212
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=30.47  E-value=6.4  Score=23.43  Aligned_cols=13  Identities=38%  Similarity=0.935  Sum_probs=8.1

Q ss_pred             CCccccccccccc
Q psy6676          26 EKPFKCTECGKGF   38 (144)
Q Consensus        26 ~~~~~C~~C~~~f   38 (144)
                      .+.|.|+.|+..-
T Consensus        20 ~k~FtCp~Cghe~   32 (104)
T COG4888          20 PKTFTCPRCGHEK   32 (104)
T ss_pred             CceEecCccCCee
Confidence            4457777777553


No 213
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=30.37  E-value=38  Score=17.43  Aligned_cols=9  Identities=44%  Similarity=1.387  Sum_probs=3.6

Q ss_pred             ccccccccc
Q psy6676          29 FKCTECGKG   37 (144)
Q Consensus        29 ~~C~~C~~~   37 (144)
                      +.|+.|+..
T Consensus        29 W~C~~Cgh~   37 (55)
T PF14311_consen   29 WKCPKCGHE   37 (55)
T ss_pred             EECCCCCCe
Confidence            334444333


No 214
>PTZ00448 hypothetical protein; Provisional
Probab=30.20  E-value=35  Score=25.44  Aligned_cols=23  Identities=13%  Similarity=0.322  Sum_probs=20.6

Q ss_pred             CcccCcchhhhcChHHHHHhHhh
Q psy6676          84 PYNCAACGKVFRRNCDLRRHSLT  106 (144)
Q Consensus        84 ~~~C~~C~~~f~~~~~l~~H~~~  106 (144)
                      .|.|..|+-.|.+....+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999988899999886


No 215
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=29.61  E-value=80  Score=18.90  Aligned_cols=38  Identities=18%  Similarity=0.206  Sum_probs=27.4

Q ss_pred             CcccccccccccCChHHHHHHHHHhCCCCCccccccccc
Q psy6676          27 KPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRS   65 (144)
Q Consensus        27 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~   65 (144)
                      +-|.|+.-+..|.+...+-..+.... .+.|.|.+.|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~-~~vwtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYN-QRVWTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHh-CCeeEEecCCCC
Confidence            34678888888888888766655544 466889888763


No 216
>KOG2636|consensus
Probab=29.55  E-value=41  Score=25.83  Aligned_cols=27  Identities=19%  Similarity=0.466  Sum_probs=16.6

Q ss_pred             hCCCCCccccccc-ccccCchHHHHHHh
Q psy6676          51 HLEESPHKCPVCS-RSFNQRSNLKTHLL   77 (144)
Q Consensus        51 ~~~~~~~~C~~C~-~~~~~~~~l~~h~~   77 (144)
                      |--...|.|.+|| ..|.....+.+|..
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhH
Confidence            3334556777777 56666666666654


No 217
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=29.16  E-value=17  Score=17.75  Aligned_cols=16  Identities=56%  Similarity=1.394  Sum_probs=10.1

Q ss_pred             CcccccccccccCChH
Q psy6676          27 KPFKCTECGKGFCQSR   42 (144)
Q Consensus        27 ~~~~C~~C~~~f~~~~   42 (144)
                      -|+.|..|+..|-...
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            5788999999987653


No 218
>PRK00420 hypothetical protein; Validated
Probab=27.88  E-value=33  Score=20.98  Aligned_cols=10  Identities=40%  Similarity=0.853  Sum_probs=5.1

Q ss_pred             cccCcchhhh
Q psy6676          85 YNCAACGKVF   94 (144)
Q Consensus        85 ~~C~~C~~~f   94 (144)
                      ..|+.||...
T Consensus        41 ~~Cp~Cg~~~   50 (112)
T PRK00420         41 VVCPVHGKVY   50 (112)
T ss_pred             eECCCCCCee
Confidence            4555555533


No 219
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.66  E-value=21  Score=18.17  Aligned_cols=12  Identities=25%  Similarity=0.722  Sum_probs=6.1

Q ss_pred             ccCcchhhhcCh
Q psy6676          86 NCAACGKVFRRN   97 (144)
Q Consensus        86 ~C~~C~~~f~~~   97 (144)
                      .|++|+.-|+..
T Consensus        14 ICpvCqRPFsWR   25 (54)
T COG4338          14 ICPVCQRPFSWR   25 (54)
T ss_pred             hhhhhcCchHHH
Confidence            455555555443


No 220
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=27.63  E-value=18  Score=27.93  Aligned_cols=14  Identities=21%  Similarity=0.724  Sum_probs=8.4

Q ss_pred             CCcccccccccccC
Q psy6676          55 SPHKCPVCSRSFNQ   68 (144)
Q Consensus        55 ~~~~C~~C~~~~~~   68 (144)
                      ..|.|..|+..|.-
T Consensus       424 ~~~~c~~c~~~yd~  437 (479)
T PRK05452        424 PRMQCSVCQWIYDP  437 (479)
T ss_pred             CeEEECCCCeEECC
Confidence            34667777766543


No 221
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=27.62  E-value=20  Score=21.84  Aligned_cols=10  Identities=20%  Similarity=0.587  Sum_probs=5.1

Q ss_pred             cccccccccc
Q psy6676          57 HKCPVCSRSF   66 (144)
Q Consensus        57 ~~C~~C~~~~   66 (144)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            4555555433


No 222
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=26.73  E-value=75  Score=22.16  Aligned_cols=40  Identities=23%  Similarity=0.571  Sum_probs=24.0

Q ss_pred             cccCCCCcccccccccccCChHHHHHHHHHhCCCCCcccccccc
Q psy6676          21 YIHSKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSR   64 (144)
Q Consensus        21 ~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~   64 (144)
                      ++|..-....|..|+..|.....+.   ..... ..-.|+.|+.
T Consensus       112 elHG~~~~~~C~~C~~~~~~~~~~~---~~~~~-~~p~Cp~Cgg  151 (244)
T PRK14138        112 ELHGNVEEYYCVRCGKRYTVEDVIE---KLEKS-DVPRCDDCSG  151 (244)
T ss_pred             EccCCcCeeEECCCCCcccHHHHHH---HHhcC-CCCCCCCCCC
Confidence            5677777788999998876543322   11111 2237888874


No 223
>KOG2071|consensus
Probab=26.69  E-value=40  Score=26.76  Aligned_cols=26  Identities=27%  Similarity=0.625  Sum_probs=20.5

Q ss_pred             CCcccCcchhhhcChHHHHHhHhhcc
Q psy6676          83 KPYNCAACGKVFRRNCDLRRHSLTHN  108 (144)
Q Consensus        83 ~~~~C~~C~~~f~~~~~l~~H~~~h~  108 (144)
                      .+-.|..||..|........|+-+|-
T Consensus       417 ~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  417 SPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CcchhcccccccccchhhhhHhhhhh
Confidence            45789999999998887777776653


No 224
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=26.67  E-value=23  Score=16.37  Aligned_cols=11  Identities=36%  Similarity=0.812  Sum_probs=6.4

Q ss_pred             cccCcchhhhc
Q psy6676          85 YNCAACGKVFR   95 (144)
Q Consensus        85 ~~C~~C~~~f~   95 (144)
                      +.|..|+..|.
T Consensus        22 ~~C~~Cg~~~~   32 (33)
T PF08792_consen   22 EVCIFCGSSFP   32 (33)
T ss_pred             EEcccCCcEee
Confidence            46666666553


No 225
>KOG4118|consensus
Probab=26.60  E-value=45  Score=18.22  Aligned_cols=27  Identities=11%  Similarity=0.224  Sum_probs=18.9

Q ss_pred             cccCcchhhhcChHHHHHhHhhccCCC
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLTHNLGS  111 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~h~~~~  111 (144)
                      |+|.+|.-.......+..|...-|...
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~   65 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKE   65 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCC
Confidence            677788777777777777776655443


No 226
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=26.49  E-value=27  Score=21.66  Aligned_cols=10  Identities=20%  Similarity=0.384  Sum_probs=5.4

Q ss_pred             ccccccccccc
Q psy6676          57 HKCPVCSRSFN   67 (144)
Q Consensus        57 ~~C~~C~~~~~   67 (144)
                      +.| .|+..|.
T Consensus        71 ~~C-~Cg~~~~   80 (124)
T PRK00762         71 IEC-ECGYEGV   80 (124)
T ss_pred             EEe-eCcCccc
Confidence            556 6665543


No 227
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=26.43  E-value=25  Score=16.70  Aligned_cols=11  Identities=36%  Similarity=1.171  Sum_probs=5.7

Q ss_pred             CCcccCcchhh
Q psy6676          83 KPYNCAACGKV   93 (144)
Q Consensus        83 ~~~~C~~C~~~   93 (144)
                      +.|+|..||..
T Consensus         5 ~~YkC~~CGni   15 (36)
T PF06397_consen    5 EFYKCEHCGNI   15 (36)
T ss_dssp             EEEE-TTT--E
T ss_pred             cEEEccCCCCE
Confidence            45888888854


No 228
>PLN03239 histone acetyltransferase; Provisional
Probab=26.11  E-value=66  Score=23.92  Aligned_cols=25  Identities=24%  Similarity=0.283  Sum_probs=22.1

Q ss_pred             CCCcccCcchhhhcChHHHHHhHhh
Q psy6676          82 IKPYNCAACGKVFRRNCDLRRHSLT  106 (144)
Q Consensus        82 ~~~~~C~~C~~~f~~~~~l~~H~~~  106 (144)
                      ...|.|..|-+-|.+...|.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            4679999999999999999999864


No 229
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=26.07  E-value=32  Score=20.64  Aligned_cols=11  Identities=45%  Similarity=1.029  Sum_probs=6.5

Q ss_pred             Ccccccccccc
Q psy6676          27 KPFKCTECGKG   37 (144)
Q Consensus        27 ~~~~C~~C~~~   37 (144)
                      ||-.|+.|+..
T Consensus         1 ~p~~CpYCg~~   11 (102)
T PF11672_consen    1 KPIICPYCGGP   11 (102)
T ss_pred             CCcccCCCCCe
Confidence            34566666654


No 230
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=26.06  E-value=9.2  Score=22.69  Aligned_cols=14  Identities=21%  Similarity=0.541  Sum_probs=10.3

Q ss_pred             CcccccccccccCC
Q psy6676          27 KPFKCTECGKGFCQ   40 (144)
Q Consensus        27 ~~~~C~~C~~~f~~   40 (144)
                      ..+.|+.|+..+..
T Consensus        15 ~~~~C~~C~~~~~~   28 (104)
T TIGR01384        15 GVYVCPSCGYEKEK   28 (104)
T ss_pred             CeEECcCCCCcccc
Confidence            36889999977654


No 231
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=25.71  E-value=20  Score=21.80  Aligned_cols=10  Identities=30%  Similarity=0.976  Sum_probs=4.9

Q ss_pred             cccccccccc
Q psy6676          57 HKCPVCSRSF   66 (144)
Q Consensus        57 ~~C~~C~~~~   66 (144)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PF01155_consen   71 ARCRDCGHEF   80 (113)
T ss_dssp             EEETTTS-EE
T ss_pred             EECCCCCCEE
Confidence            4555555554


No 232
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=25.51  E-value=79  Score=20.48  Aligned_cols=11  Identities=27%  Similarity=0.685  Sum_probs=3.0

Q ss_pred             CCCcccCcchh
Q psy6676          82 IKPYNCAACGK   92 (144)
Q Consensus        82 ~~~~~C~~C~~   92 (144)
                      +..++|-.||-
T Consensus        58 dt~leCy~Cg~   68 (152)
T PF09416_consen   58 DTVLECYNCGS   68 (152)
T ss_dssp             S-B---TTT--
T ss_pred             CcEEEEEecCC
Confidence            34567777764


No 233
>KOG2932|consensus
Probab=25.44  E-value=86  Score=23.00  Aligned_cols=29  Identities=24%  Similarity=0.354  Sum_probs=22.6

Q ss_pred             CCCCCcccCc---chhhhcChHHHHHhHhhcc
Q psy6676          80 TDIKPYNCAA---CGKVFRRNCDLRRHSLTHN  108 (144)
Q Consensus        80 ~~~~~~~C~~---C~~~f~~~~~l~~H~~~h~  108 (144)
                      .-...|.|..   |.++|.+...|+.|+.--|
T Consensus       140 ~~g~iFmC~~~~GC~RTyLsqrDlqAHInhrH  171 (389)
T KOG2932|consen  140 MMGGIFMCAAPHGCLRTYLSQRDLQAHINHRH  171 (389)
T ss_pred             cccceEEeecchhHHHHHhhHHHHHHHhhhhh
Confidence            3446789954   9999999999999986443


No 234
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=25.39  E-value=28  Score=22.31  Aligned_cols=28  Identities=25%  Similarity=0.662  Sum_probs=15.5

Q ss_pred             CCcccccccccccCchHHHHHHhhcCCCCCcccCcchh
Q psy6676          55 SPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGK   92 (144)
Q Consensus        55 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   92 (144)
                      ..++|..||.....         .+++ ..-.|+.|+.
T Consensus       111 G~l~C~~Cg~~~~~---------~~~~-~l~~Cp~C~~  138 (146)
T PF07295_consen  111 GTLVCENCGHEVEL---------THPE-RLPPCPKCGH  138 (146)
T ss_pred             ceEecccCCCEEEe---------cCCC-cCCCCCCCCC
Confidence            44777777754311         1232 3447777764


No 235
>KOG4727|consensus
Probab=25.37  E-value=33  Score=22.65  Aligned_cols=23  Identities=22%  Similarity=0.470  Sum_probs=19.5

Q ss_pred             CCcccCcchhhhcChHHHHHhHh
Q psy6676          83 KPYNCAACGKVFRRNCDLRRHSL  105 (144)
Q Consensus        83 ~~~~C~~C~~~f~~~~~l~~H~~  105 (144)
                      ..|.|.+|.-.+....++..|+.
T Consensus        74 ~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             CceeeeecceeehhhHHHHHHhc
Confidence            34999999999999988888873


No 236
>PF14353 CpXC:  CpXC protein
Probab=24.88  E-value=26  Score=21.55  Aligned_cols=25  Identities=28%  Similarity=0.620  Sum_probs=18.2

Q ss_pred             CCcccCcchhhhcChHHHHHhHhhc
Q psy6676          83 KPYNCAACGKVFRRNCDLRRHSLTH  107 (144)
Q Consensus        83 ~~~~C~~C~~~f~~~~~l~~H~~~h  107 (144)
                      ..|.|+.||..|.-...+.-|...+
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D~~~   61 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHDPEK   61 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEcCCC
Confidence            4589999999887776666555443


No 237
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=24.53  E-value=45  Score=17.77  Aligned_cols=9  Identities=44%  Similarity=1.195  Sum_probs=4.0

Q ss_pred             CCCcccccc
Q psy6676          54 ESPHKCPVC   62 (144)
Q Consensus        54 ~~~~~C~~C   62 (144)
                      ....+|+-|
T Consensus        42 E~VArCPSC   50 (67)
T COG5216          42 EVVARCPSC   50 (67)
T ss_pred             ceEEEcCCc
Confidence            334445444


No 238
>KOG2857|consensus
Probab=24.18  E-value=92  Score=19.96  Aligned_cols=21  Identities=33%  Similarity=0.585  Sum_probs=13.8

Q ss_pred             cccccccccccCchHHHHHHh
Q psy6676          57 HKCPVCSRSFNQRSNLKTHLL   77 (144)
Q Consensus        57 ~~C~~C~~~~~~~~~l~~h~~   77 (144)
                      |+|+.|...|-+...+..|..
T Consensus        18 YKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   18 YKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             ccCCCCCCccccchhhhhccC
Confidence            667777766666666666654


No 239
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.16  E-value=24  Score=21.98  Aligned_cols=14  Identities=29%  Similarity=0.657  Sum_probs=8.1

Q ss_pred             CCcccccccccccC
Q psy6676          55 SPHKCPVCSRSFNQ   68 (144)
Q Consensus        55 ~~~~C~~C~~~~~~   68 (144)
                      .|-.|..||..|.+
T Consensus        67 ~psfchncgs~fpw   80 (160)
T COG4306          67 PPSFCHNCGSRFPW   80 (160)
T ss_pred             CcchhhcCCCCCCc
Confidence            44556666666654


No 240
>KOG3214|consensus
Probab=24.02  E-value=24  Score=20.99  Aligned_cols=13  Identities=23%  Similarity=0.703  Sum_probs=7.3

Q ss_pred             CcccCcchhhhcC
Q psy6676          84 PYNCAACGKVFRR   96 (144)
Q Consensus        84 ~~~C~~C~~~f~~   96 (144)
                      ...|.+|+..|..
T Consensus        47 ~~sC~iC~esFqt   59 (109)
T KOG3214|consen   47 KASCRICEESFQT   59 (109)
T ss_pred             eeeeeehhhhhcc
Confidence            3456666666644


No 241
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.38  E-value=48  Score=23.78  Aligned_cols=10  Identities=30%  Similarity=0.939  Sum_probs=4.7

Q ss_pred             cccCcchhhh
Q psy6676          85 YNCAACGKVF   94 (144)
Q Consensus        85 ~~C~~C~~~f   94 (144)
                      |.|++|.-.|
T Consensus       256 yvCs~Clsi~  265 (279)
T TIGR00627       256 FVCSVCLSVL  265 (279)
T ss_pred             EECCCccCCc
Confidence            5555554433


No 242
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=23.22  E-value=32  Score=18.68  Aligned_cols=19  Identities=26%  Similarity=0.653  Sum_probs=14.2

Q ss_pred             ccCCCCcccccccccccCC
Q psy6676          22 IHSKEKPFKCTECGKGFCQ   40 (144)
Q Consensus        22 ~h~~~~~~~C~~C~~~f~~   40 (144)
                      ++..+....|+.|++.|..
T Consensus        47 ~~i~eg~L~Cp~c~r~YPI   65 (68)
T PF03966_consen   47 VEIVEGELICPECGREYPI   65 (68)
T ss_dssp             EETTTTEEEETTTTEEEEE
T ss_pred             ccccCCEEEcCCCCCEEeC
Confidence            4556677889999988864


No 243
>KOG0696|consensus
Probab=22.81  E-value=27  Score=26.91  Aligned_cols=46  Identities=28%  Similarity=0.429  Sum_probs=18.3

Q ss_pred             HHHHHhCCCCCcccccccccccCchHHHHHH-hhcCCCCCcccCcchh
Q psy6676          46 VHKILHLEESPHKCPVCSRSFNQRSNLKTHL-LTHTDIKPYNCAACGK   92 (144)
Q Consensus        46 ~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~-~~h~~~~~~~C~~C~~   92 (144)
                      .|.+.|.- ..|.|+.-++.+........|. +.|+-.-|--|..||.
T Consensus        83 vHkrChef-VtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCGs  129 (683)
T KOG0696|consen   83 VHKRCHEF-VTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCGS  129 (683)
T ss_pred             hhhhhcce-EEEECCCCCCCCCCCCcccccceeeeecCCCchhhhHHH
Confidence            34444432 2345554444444433333333 2233333333444443


No 244
>KOG1409|consensus
Probab=22.10  E-value=28  Score=25.84  Aligned_cols=8  Identities=38%  Similarity=1.286  Sum_probs=3.5

Q ss_pred             cccccccc
Q psy6676          59 CPVCSRSF   66 (144)
Q Consensus        59 C~~C~~~~   66 (144)
                      |+.|...|
T Consensus       285 cQ~c~qpf  292 (404)
T KOG1409|consen  285 CQKCNQPF  292 (404)
T ss_pred             hhhhCchH
Confidence            44444443


No 245
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=22.02  E-value=29  Score=16.49  Aligned_cols=15  Identities=33%  Similarity=0.738  Sum_probs=7.7

Q ss_pred             ccCcchhhhcChHHH
Q psy6676          86 NCAACGKVFRRNCDL  100 (144)
Q Consensus        86 ~C~~C~~~f~~~~~l  100 (144)
                      .|..|++.|-+.+..
T Consensus         4 ~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    4 LCPRCGKGFHWASEC   18 (36)
T ss_dssp             C-TTTSSSCS-TTT-
T ss_pred             cCcccCCCcchhhhh
Confidence            466777777665543


No 246
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=22.02  E-value=1.4e+02  Score=20.24  Aligned_cols=41  Identities=17%  Similarity=0.430  Sum_probs=23.0

Q ss_pred             cccCCCCcccccccccccCChHHHHHHHHHhCCCCCcccccccc
Q psy6676          21 YIHSKEKPFKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSR   64 (144)
Q Consensus        21 ~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~   64 (144)
                      ++|..-....|..|+..+.....+..   .......-.|+.|+.
T Consensus        88 elHG~~~~~~C~~C~~~~~~~~~~~~---~~~~~~~p~C~~Cgg  128 (206)
T cd01410          88 ELHGNMFIEVCKSCGPEYVRDDVVET---RGDKETGRRCHACGG  128 (206)
T ss_pred             EecCCcCcccCCCCCCccchHHHHHH---hhcCCCCCcCCCCcC
Confidence            56666677788888877654332211   111222346888874


No 247
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=21.96  E-value=46  Score=17.42  Aligned_cols=19  Identities=32%  Similarity=0.604  Sum_probs=13.0

Q ss_pred             CcccCcchhhhcChHHHHH
Q psy6676          84 PYNCAACGKVFRRNCDLRR  102 (144)
Q Consensus        84 ~~~C~~C~~~f~~~~~l~~  102 (144)
                      -+.|-.||..|.+...|..
T Consensus        27 ~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   27 HNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             CceeeeeCCccCCHHHHHh
Confidence            3567777777777766653


No 248
>COG4640 Predicted membrane protein [Function unknown]
Probab=21.56  E-value=58  Score=24.68  Aligned_cols=14  Identities=29%  Similarity=0.769  Sum_probs=7.5

Q ss_pred             cCcchhhhcChHHH
Q psy6676          87 CAACGKVFRRNCDL  100 (144)
Q Consensus        87 C~~C~~~f~~~~~l  100 (144)
                      |..||..|.....+
T Consensus        18 C~qCG~~~t~~~sq   31 (465)
T COG4640          18 CTQCGHKFTSRQSQ   31 (465)
T ss_pred             ccccCCcCCchhhh
Confidence            55565555554443


No 249
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=21.54  E-value=51  Score=15.30  Aligned_cols=22  Identities=18%  Similarity=0.459  Sum_probs=10.8

Q ss_pred             cccCcchhhhcChHHHHHhHhhc
Q psy6676          85 YNCAACGKVFRRNCDLRRHSLTH  107 (144)
Q Consensus        85 ~~C~~C~~~f~~~~~l~~H~~~h  107 (144)
                      +.|+.|++..... -+..|+..+
T Consensus         5 ~~C~nC~R~v~a~-RfA~HLekC   26 (33)
T PF08209_consen    5 VECPNCGRPVAAS-RFAPHLEKC   26 (33)
T ss_dssp             EE-TTTSSEEEGG-GHHHHHHHH
T ss_pred             EECCCCcCCcchh-hhHHHHHHH
Confidence            5666676644332 345555443


No 250
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=21.45  E-value=47  Score=23.90  Aligned_cols=32  Identities=25%  Similarity=0.639  Sum_probs=19.2

Q ss_pred             ccccccccccCChHHHHHHHHHhCCCCCcccccccccccCc
Q psy6676          29 FKCTECGKGFCQSRTLAVHKILHLEESPHKCPVCSRSFNQR   69 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~   69 (144)
                      .+|+.|+.....+ .|..        ..++|+.|+..|...
T Consensus        27 ~~c~~c~~~~~~~-~l~~--------~~~vc~~c~~h~rl~   58 (285)
T TIGR00515        27 TKCPKCGQVLYTK-ELER--------NLEVCPKCDHHMRMD   58 (285)
T ss_pred             eECCCCcchhhHH-HHHh--------hCCCCCCCCCcCcCC
Confidence            4588888665332 2221        226899998876543


No 251
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=21.31  E-value=21  Score=22.68  Aligned_cols=10  Identities=40%  Similarity=1.222  Sum_probs=5.8

Q ss_pred             cccCcchhhh
Q psy6676          85 YNCAACGKVF   94 (144)
Q Consensus        85 ~~C~~C~~~f   94 (144)
                      |.|..|+-.|
T Consensus       144 ~~C~~C~~~l  153 (157)
T PF10263_consen  144 YRCGRCGGPL  153 (157)
T ss_pred             EECCCCCCEE
Confidence            6666666433


No 252
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=21.03  E-value=13  Score=25.08  Aligned_cols=7  Identities=43%  Similarity=1.293  Sum_probs=3.9

Q ss_pred             ccccccc
Q psy6676          30 KCTECGK   36 (144)
Q Consensus        30 ~C~~C~~   36 (144)
                      .||.|+.
T Consensus        16 ~CPvCg~   22 (201)
T COG1779          16 DCPVCGG   22 (201)
T ss_pred             cCCcccc
Confidence            4566654


No 253
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=20.53  E-value=12  Score=20.63  Aligned_cols=57  Identities=19%  Similarity=0.297  Sum_probs=22.2

Q ss_pred             ccccccccccCChHH---HHHHHHHhCCCCCcccccccccccCchHHHHHHhhcCCCCCcccCcchhh
Q psy6676          29 FKCTECGKGFCQSRT---LAVHKILHLEESPHKCPVCSRSFNQRSNLKTHLLTHTDIKPYNCAACGKV   93 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~---l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~   93 (144)
                      +.++-|++.|.-..-   +..|...........|..|...+.....       ..+ ..+.|+.|+..
T Consensus        11 ~~~~cC~~~y~C~~CHde~~~H~~~~~~~~~v~Cg~C~~~~~~~~~-------~c~-~~~~C~~C~~~   70 (71)
T PF05495_consen   11 IRFPCCGKYYPCRFCHDELEDHPFDRWPVKRVICGKCRTEQPIDEY-------SCG-ADYFCPICGLY   70 (71)
T ss_dssp             EEETTTTEEESSHHHHHHCSSS---TTT--EEEETTT--EEES-SB-------TT---SEEETTTTEE
T ss_pred             EECCcccCeecHHHHHHHhccCccccccccCeECCCCCCccChhhh-------hcC-CCccCcCcCCC
Confidence            445566666654311   1122111122224566666654433221       111 45677777654


No 254
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=20.43  E-value=70  Score=20.97  Aligned_cols=21  Identities=19%  Similarity=0.415  Sum_probs=18.3

Q ss_pred             ccccccccccCChHHHHHHHH
Q psy6676          29 FKCTECGKGFCQSRTLAVHKI   49 (144)
Q Consensus        29 ~~C~~C~~~f~~~~~l~~h~~   49 (144)
                      |.|..|.........+..|..
T Consensus         1 F~Cs~CKfrtf~~~ei~~Hle   21 (165)
T PF04988_consen    1 FTCSFCKFRTFEEKEIEKHLE   21 (165)
T ss_pred             CccceeeeecccHHHHHHHHc
Confidence            679999999999999999964


No 255
>KOG4696|consensus
Probab=20.42  E-value=65  Score=23.45  Aligned_cols=29  Identities=14%  Similarity=0.138  Sum_probs=15.8

Q ss_pred             ccCcchhhhcChHHHHHhHhhccCCCCCCC
Q psy6676          86 NCAACGKVFRRNCDLRRHSLTHNLGSATST  115 (144)
Q Consensus        86 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~  115 (144)
                      .|++|..+ .....+.-|...|.......+
T Consensus         4 iCP~CkLs-v~~~~m~~HieaHFEqDEvN~   32 (393)
T KOG4696|consen    4 ICPFCKLS-VNYDEMCFHIEAHFEQDEVNS   32 (393)
T ss_pred             cccceecc-cCHHHHHHHHHhhccccccch
Confidence            46666655 445555666666555544433


No 256
>KOG4602|consensus
Probab=20.08  E-value=39  Score=23.89  Aligned_cols=11  Identities=36%  Similarity=1.132  Sum_probs=7.1

Q ss_pred             CCcccCcchhh
Q psy6676          83 KPYNCAACGKV   93 (144)
Q Consensus        83 ~~~~C~~C~~~   93 (144)
                      +.|.|++||.+
T Consensus       267 R~YVCPiCGAT  277 (318)
T KOG4602|consen  267 RSYVCPICGAT  277 (318)
T ss_pred             hhhcCcccccc
Confidence            34777777753


Done!