Query         psy6684
Match_columns 77
No_of_seqs    80 out of 82
Neff          3.6 
Searched_HMMs 46136
Date          Sat Aug 17 00:25:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6684.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6684hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1777|consensus               99.9 2.3E-27   5E-32  193.4   5.3   72    6-77    525-596 (625)
  2 KOG0943|consensus               99.5 1.1E-14 2.3E-19  129.7   1.7   54   22-76   1238-1291(3015)
  3 PF02207 zf-UBR:  Putative zinc  99.4   2E-13 4.3E-18   84.5   2.5   47   25-76      1-48  (71)
  4 smart00396 ZnF_UBR1 Putative z  99.0 3.4E-10 7.4E-15   70.7   3.2   47   25-76      1-48  (71)
  5 KOG1776|consensus               98.3 2.8E-08 6.1E-13   85.8  -3.2   52   23-75    763-815 (1110)
  6 KOG2752|consensus               97.7   2E-05 4.4E-10   62.6   1.9   48   23-73     39-87  (345)
  7 PF00643 zf-B_box:  B-box zinc   96.1   0.005 1.1E-07   33.7   2.3   28   41-72     14-41  (42)
  8 smart00336 BBOX B-Box-type zin  93.9   0.044 9.5E-07   29.2   1.7   28   40-71     13-40  (42)
  9 cd00021 BBOX B-Box-type zinc f  93.2   0.065 1.4E-06   28.2   1.7   29   40-72     10-38  (39)
 10 smart00290 ZnF_UBP Ubiquitin C  62.8     4.1 8.9E-05   22.6   0.9   19   44-62      1-19  (50)
 11 PF07649 C1_3:  C1-like domain;  57.7     6.5 0.00014   20.3   1.1   18   40-61     13-30  (30)
 12 PF01422 zf-NF-X1:  NF-X1 type   56.6     3.2   7E-05   21.0  -0.2    9   59-67      5-13  (20)
 13 TIGR00269 conserved hypothetic  53.9     6.1 0.00013   25.6   0.7   20   42-61     80-99  (104)
 14 PF10186 Atg14:  UV radiation r  45.3      13 0.00028   26.6   1.3   20   44-63      1-20  (302)
 15 smart00659 RPOLCX RNA polymera  44.7      26 0.00056   20.1   2.3   28   42-75      2-34  (44)
 16 PF08271 TF_Zn_Ribbon:  TFIIB z  42.4      11 0.00023   20.9   0.4   19   43-61      1-26  (43)
 17 PF14976 FAM72:  FAM72 protein   40.0      25 0.00054   25.6   2.1   31   44-74     73-106 (150)
 18 PF01412 ArfGap:  Putative GTPa  37.7      15 0.00034   24.0   0.7   23   44-67     15-45  (116)
 19 PRK09853 putative selenate red  37.6      16 0.00034   33.1   0.9   32   35-71    878-909 (1019)
 20 PF07911 DUF1677:  Protein of u  35.9      22 0.00048   23.8   1.2   21   43-63      5-40  (91)
 21 PF02148 zf-UBP:  Zn-finger in   35.7      15 0.00032   21.7   0.3   10   41-50     10-19  (63)
 22 COG1439 Predicted nucleic acid  32.6      37 0.00079   25.1   2.1   30   41-76    138-169 (177)
 23 PF03604 DNA_RNApol_7kD:  DNA d  31.7      26 0.00057   19.0   0.9   26   43-74      1-31  (32)
 24 cd00729 rubredoxin_SM Rubredox  30.4      25 0.00053   19.0   0.7   19   42-60      2-24  (34)
 25 smart00438 ZnF_NFX Repressor o  29.5      16 0.00034   19.4  -0.2    9   59-67      5-13  (26)
 26 cd00350 rubredoxin_like Rubred  27.6      29 0.00064   18.3   0.7   18   43-60      2-23  (33)
 27 PF06689 zf-C4_ClpX:  ClpX C4-t  27.2      43 0.00093   18.7   1.3   13   53-65     23-35  (41)
 28 cd02340 ZZ_NBR1_like Zinc fing  26.5      54  0.0012   18.4   1.6   29   38-69     10-39  (43)
 29 cd06219 DHOD_e_trans_like1 FAD  25.3      18 0.00038   25.9  -0.6   15   54-68    218-240 (248)
 30 TIGR03315 Se_ygfK putative sel  24.0      38 0.00082   30.6   1.0   28   35-67    873-900 (1012)
 31 PF02132 RecR:  RecR protein;    23.8      28  0.0006   19.3   0.1   23   40-62     15-37  (41)
 32 PF12346 HJURP_mid:  Holliday j  23.5      21 0.00046   25.0  -0.5   12   31-43     13-24  (116)
 33 PF01363 FYVE:  FYVE zinc finge  22.9      37  0.0008   19.8   0.5   18   40-61     23-40  (69)
 34 COG2956 Predicted N-acetylgluc  21.9      44 0.00095   27.6   0.9   24   38-61    350-375 (389)
 35 cd06008 NF-X1-zinc-finger Pres  21.6      28  0.0006   20.0  -0.2   10   58-67     14-23  (49)
 36 PF01096 TFIIS_C:  Transcriptio  20.7      83  0.0018   17.2   1.7   16   35-50     21-36  (39)
 37 cd00974 DSRD Desulforedoxin (D  20.6      58  0.0013   17.1   1.0   13   40-52      2-14  (34)
 38 PF12838 Fer4_7:  4Fe-4S diclus  20.2      55  0.0012   18.0   0.9   11   57-67     41-51  (52)

No 1  
>KOG1777|consensus
Probab=99.94  E-value=2.3e-27  Score=193.43  Aligned_cols=72  Identities=64%  Similarity=1.203  Sum_probs=70.4

Q ss_pred             cccccccCCchhHHhhhhCCcceEEeecCcccceeceEEeecCCCCCCeeeehhhHHhhcCCCceEEeeeCC
Q psy6684           6 GKKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR   77 (77)
Q Consensus         6 ~k~~~~~~n~d~~e~al~~~~Ctf~~st~~~f~~Q~~Y~C~TC~~~d~~giC~~Ca~~CH~GHdv~y~r~sR   77 (77)
                      -+.|.||+|+|.||+|++.++|+|++|++++|||++||+|.|||++|+|+||.+|++.||+||+|+|+|+||
T Consensus       525 ~~~N~iydN~D~vekAik~GqCLfkvSs~~syPMHnFYRC~TCNttdRNAIC~nCI~~CH~GH~Vefir~Dr  596 (625)
T KOG1777|consen  525 ERGNQIYDNLDHVEKAIKKGQCLFKVSSYTSYPMHNFYRCITCNTTDRNAICVNCIKRCHEGHDVEFIRHDR  596 (625)
T ss_pred             ccccccccchHHHHHHhhcCceEEEecCCCcccccceeEeeecCCccccHHHHHHHHHhcCCCceEEEeece
Confidence            467999999999999999999999999999999999999999999999999999999999999999999998


No 2  
>KOG0943|consensus
Probab=99.47  E-value=1.1e-14  Score=129.70  Aligned_cols=54  Identities=24%  Similarity=0.628  Sum_probs=50.8

Q ss_pred             hhCCcceEEeecCcccceeceEEeecCCCCCCeeeehhhHHhhcCCCceEEeeeC
Q psy6684          22 VTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHD   76 (77)
Q Consensus        22 l~~~~Ctf~~st~~~f~~Q~~Y~C~TC~~~d~~giC~~Ca~~CH~GHdv~y~r~s   76 (77)
                      ..+.+|+|+|+ +.++++||.|.|.||++.++..||+.||.+||+|||..+.|.|
T Consensus      1238 C~NDtCSFTWT-GadHINQDIfECkTCGL~~SLCCCsECAltCHk~HDCkLKRTS 1291 (3015)
T KOG0943|consen 1238 CCNDTCSFTWT-GADHINQDIFECKTCGLLESLCCCSECALTCHKGHDCKLKRTS 1291 (3015)
T ss_pred             EecCccceeec-chhhccchhhhhcccccchhhhhhHHHHHHhccCCccceeccC
Confidence            56799999996 5689999999999999999999999999999999999999987


No 3  
>PF02207 zf-UBR:  Putative zinc finger in N-recognin (UBR box);  InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The N-end rule-based degradation signal, which targets a protein for ubiquitin-dependent proteolysis, comprises a destabilising amino-terminal residue and a specific internal lysine residue. This entry describes a putative zinc finger in N-recognin, a recognition component of the N-end rule pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0004842 ubiquitin-protein ligase activity, 0008270 zinc ion binding; PDB: 3NY1_B 3NIS_F 3NIM_A 3NIK_A 3NII_A 3NIH_A 3NIL_D 3NIN_B 3NIJ_A 3NIT_A ....
Probab=99.38  E-value=2e-13  Score=84.50  Aligned_cols=47  Identities=40%  Similarity=0.912  Sum_probs=35.5

Q ss_pred             CcceEEeecCcccceeceEEeecCCCCCCeeeehhh-HHhhcCCCceEEeeeC
Q psy6684          25 GQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNC-IKSCHAGHDVAFIRHD   76 (77)
Q Consensus        25 ~~Ctf~~st~~~f~~Q~~Y~C~TC~~~d~~giC~~C-a~~CH~GHdv~y~r~s   76 (77)
                      ++|+++++.+     |.+|+|.||.+.++.+||..| ++.||+||++++.+.+
T Consensus         1 ~~C~~~~~~~-----q~~y~C~tC~~~~~~~iC~~CF~~~~H~gH~~~~~~~~   48 (71)
T PF02207_consen    1 KKCTYVWTSG-----QIFYRCLTCSLDESSGICEECFANSCHEGHRVVYYRSS   48 (71)
T ss_dssp             -SS--B--TT------EEEEETTTBSSTT-BBEHHHHCTSGGGGSSEEEEE--
T ss_pred             CcCCCCCcCC-----CEEEECccCCCCCCEEEchhhCCCCCcCCCcEEEEEeC
Confidence            3688886433     999999999999999999999 9999999999999876


No 4  
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=98.99  E-value=3.4e-10  Score=70.73  Aligned_cols=47  Identities=32%  Similarity=0.846  Sum_probs=39.9

Q ss_pred             CcceEEeecCcccceeceEEeecCCCCCCeeeehhhHH-hhcCCCceEEeeeC
Q psy6684          25 GQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIK-SCHAGHDVAFIRHD   76 (77)
Q Consensus        25 ~~Ctf~~st~~~f~~Q~~Y~C~TC~~~d~~giC~~Ca~-~CH~GHdv~y~r~s   76 (77)
                      .+|+++++.+ ++    .|+|.||.+.+..+||..|++ .||+||++++.+.+
T Consensus         1 ~~C~~~~~~~-~~----~y~C~tC~~~~~~~iC~~Cf~~~~H~gH~~~~~~~~   48 (71)
T smart00396        1 DVCTYKFTGG-EV----IYRCKTCGLDPTCVLCSDCFRSNCHKGHDYSLKTSR   48 (71)
T ss_pred             CCCCCccCCC-CE----EEECcCCCCCCCEeEChHHCCCCCCCCCCEEEEEec
Confidence            3689997433 33    399999999999999999999 99999999988765


No 5  
>KOG1776|consensus
Probab=98.33  E-value=2.8e-08  Score=85.75  Aligned_cols=52  Identities=4%  Similarity=-0.162  Sum_probs=47.5

Q ss_pred             hCCcceEEeecCcccceeceEEeecCCCCCCe-eeehhhHHhhcCCCceEEeee
Q psy6684          23 TSGQCLYKISSYTSFPMHDFYRCQTCHTTDRN-AICVNCIKSCHAGHDVAFIRH   75 (77)
Q Consensus        23 ~~~~Ctf~~st~~~f~~Q~~Y~C~TC~~~d~~-giC~~Ca~~CH~GHdv~y~r~   75 (77)
                      ....||++ +++.-++.|+||.|+||+|..+. |.|++|+++||.||++.|+..
T Consensus       763 ~v~~~T~K-kk~q~~m~n~~~q~~k~~M~~~~gG~~kV~s~t~H~~~~i~~S~~  815 (1110)
T KOG1776|consen  763 LVRDETEK-KKKQMAMLNREKQLTKMRMKVGTGGQIKVSSRTLHNEPSIDDSDS  815 (1110)
T ss_pred             HHHHHHHh-hhhhHHHHHHHhhhhhheeeeccCceEEEeeecccCCCCccccCC
Confidence            34789999 67889999999999999999999 999999999999999999853


No 6  
>KOG2752|consensus
Probab=97.68  E-value=2e-05  Score=62.58  Aligned_cols=48  Identities=25%  Similarity=0.654  Sum_probs=39.9

Q ss_pred             hCCcceEEeecCcccceeceEEeecCCCCC-CeeeehhhHHhhcCCCceEEe
Q psy6684          23 TSGQCLYKISSYTSFPMHDFYRCQTCHTTD-RNAICVNCIKSCHAGHDVAFI   73 (77)
Q Consensus        23 ~~~~Ctf~~st~~~f~~Q~~Y~C~TC~~~d-~~giC~~Ca~~CH~GHdv~y~   73 (77)
                      +...|||.. +  .-+.|-.|.|.||-... .+|||..|+..||.||+++=.
T Consensus        39 ~~~~CTy~~-G--y~~rQ~l~sClTC~P~~~~agvC~~C~~~CH~~H~lveL   87 (345)
T KOG2752|consen   39 NPDVCTYAK-G--YKKRQALFSCLTCTPAPEMAGVCYACSLSCHDGHELVEL   87 (345)
T ss_pred             CCccccccc-C--cccccceeEeecccCChhhceeEEEeeeeecCCceeeec
Confidence            457899993 3  33469999999999987 569999999999999998744


No 7  
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=96.15  E-value=0.005  Score=33.67  Aligned_cols=28  Identities=29%  Similarity=0.688  Sum_probs=25.3

Q ss_pred             ceEEeecCCCCCCeeeehhhHHhhcCCCceEE
Q psy6684          41 DFYRCQTCHTTDRNAICVNCIKSCHAGHDVAF   72 (77)
Q Consensus        41 ~~Y~C~TC~~~d~~giC~~Ca~~CH~GHdv~y   72 (77)
                      --|.|.+|+.    .+|..|+..=|+||++.-
T Consensus        14 ~~~~C~~C~~----~~C~~C~~~~H~~H~~~~   41 (42)
T PF00643_consen   14 LSLFCEDCNE----PLCSECTVSGHKGHKIVP   41 (42)
T ss_dssp             EEEEETTTTE----EEEHHHHHTSTTTSEEEE
T ss_pred             eEEEecCCCC----ccCccCCCCCCCCCEEeE
Confidence            6789999998    899999999999999863


No 8  
>smart00336 BBOX B-Box-type zinc finger.
Probab=93.87  E-value=0.044  Score=29.23  Aligned_cols=28  Identities=29%  Similarity=0.720  Sum_probs=24.2

Q ss_pred             eceEEeecCCCCCCeeeehhhHHhhcCCCceE
Q psy6684          40 HDFYRCQTCHTTDRNAICVNCIKSCHAGHDVA   71 (77)
Q Consensus        40 Q~~Y~C~TC~~~d~~giC~~Ca~~CH~GHdv~   71 (77)
                      .-+|.|.+|..    .||..|...=|+||.+.
T Consensus        13 ~~~~~C~~c~~----~iC~~C~~~~H~~H~~~   40 (42)
T smart00336       13 PAEFFCEECGA----LLCRTCDEAEHRGHTVV   40 (42)
T ss_pred             ceEEECCCCCc----ccccccChhhcCCCcee
Confidence            34788999987    89999998899999885


No 9  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=93.22  E-value=0.065  Score=28.21  Aligned_cols=29  Identities=31%  Similarity=0.493  Sum_probs=23.8

Q ss_pred             eceEEeecCCCCCCeeeehhhHHhhcCCCceEE
Q psy6684          40 HDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAF   72 (77)
Q Consensus        40 Q~~Y~C~TC~~~d~~giC~~Ca~~CH~GHdv~y   72 (77)
                      .-.+.|.+|..    .+|..|...=|+||.+..
T Consensus        10 ~~~~fC~~~~~----~iC~~C~~~~H~~H~~~~   38 (39)
T cd00021          10 PLSLFCETDRA----LLCVDCDLSVHSGHRRVP   38 (39)
T ss_pred             ceEEEeCccCh----hhhhhcChhhcCCCCEee
Confidence            34788999887    899999866699999864


No 10 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=62.81  E-value=4.1  Score=22.57  Aligned_cols=19  Identities=32%  Similarity=0.875  Sum_probs=12.8

Q ss_pred             EeecCCCCCCeeeehhhHH
Q psy6684          44 RCQTCHTTDRNAICVNCIK   62 (77)
Q Consensus        44 ~C~TC~~~d~~giC~~Ca~   62 (77)
                      +|.+|+.....++|-.|-.
T Consensus         1 ~C~~C~~~~~l~~CL~C~~   19 (50)
T smart00290        1 RCSVCGTIENLWLCLTCGQ   19 (50)
T ss_pred             CcccCCCcCCeEEecCCCC
Confidence            4667777666777777654


No 11 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=57.71  E-value=6.5  Score=20.29  Aligned_cols=18  Identities=33%  Similarity=0.835  Sum_probs=7.9

Q ss_pred             eceEEeecCCCCCCeeeehhhH
Q psy6684          40 HDFYRCQTCHTTDRNAICVNCI   61 (77)
Q Consensus        40 Q~~Y~C~TC~~~d~~giC~~Ca   61 (77)
                      +.+|+|..|+.    .+-..||
T Consensus        13 ~~~Y~C~~Cdf----~lH~~Ca   30 (30)
T PF07649_consen   13 GWFYRCSECDF----DLHEECA   30 (30)
T ss_dssp             --EEE-TTT---------HHHH
T ss_pred             CceEECccCCC----ccChhcC
Confidence            57899999988    4555554


No 12 
>PF01422 zf-NF-X1:  NF-X1 type zinc finger;  InterPro: IPR000967 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a domain presumed to be a zinc binding domain. The following pattern describes the zinc finger:  C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C  where X can be any amino acid, and numbers in brackets indicate the number of residues. The two position can be either His or Cys. This domain is found in the human transcriptional repressor NK-X1, a repressor of HLA-DRA transcription; the Drosophila shuttle craft protein, which plays an essential role during the late stages of embryonic neurogenesis; and a yeast hypothetical protein YNL023C. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=56.64  E-value=3.2  Score=20.96  Aligned_cols=9  Identities=44%  Similarity=1.254  Sum_probs=7.7

Q ss_pred             hhHHhhcCC
Q psy6684          59 NCIKSCHAG   67 (77)
Q Consensus        59 ~Ca~~CH~G   67 (77)
                      .|.++||.|
T Consensus         5 ~C~~~CH~G   13 (20)
T PF01422_consen    5 TCQQLCHPG   13 (20)
T ss_pred             ccCCcccCC
Confidence            588899998


No 13 
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=53.89  E-value=6.1  Score=25.64  Aligned_cols=20  Identities=30%  Similarity=0.841  Sum_probs=17.8

Q ss_pred             eEEeecCCCCCCeeeehhhH
Q psy6684          42 FYRCQTCHTTDRNAICVNCI   61 (77)
Q Consensus        42 ~Y~C~TC~~~d~~giC~~Ca   61 (77)
                      .-+|.-||..-+..||+.|.
T Consensus        80 ~~~C~~CG~pss~~iC~~C~   99 (104)
T TIGR00269        80 LRRCERCGEPTSGRICKACK   99 (104)
T ss_pred             CCcCCcCcCcCCccccHhhh
Confidence            44799999999999999995


No 14 
>PF10186 Atg14:  UV radiation resistance protein and autophagy-related subunit 14;  InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking. In yeast, two distinct PI3-kinase complexes are known: complex I (Vps34, Vps15, Vps30/Atg6, and Atg14) is involved in autophagy, and complex II (Vps34, Vps15, Vps30/Atg6, and Vps38) functions in the vacuolar protein sorting pathway. In mammals, the counterparts of Vps34, Vps15, and Vps30/Atg6 are Vps34, p150, and Beclin 1, respectively. Mammalian UV irradiation resistance-associated gene (UVRAG) has been identified as identical to yeast Vps38 [].  The Atg14 (autophagy-related protein 14) proteins are hydrophilic proteins and have a coiled-coil motif at the N terminus region. Yeast cells with mutant Atg14 are defective not only in autophagy but also in sorting of carboxypeptidase Y (CPY), a vacuolar-soluble hydrolase, to the vacuole []. This entry represents Atg14 and UVRAG, which bind Beclin 1 to forms two distinct PI3-kinase complexes. This entry also includes Bakor (beclin-1-associated autophagy-related key regulator), also known as autophagy-related protein 14-like protein, which share sequence similarity to the yeast Atg14 protein []. Barkor positively regulates autophagy through its interaction with Beclin-1, with decreased levels of autophagosome formation observed when Barkor expression is eliminated []. Autophagy mediates the cellular response to nutrient deprivation, protein aggregation, and pathogen invasion in humans, and malfunction of autophagy has been implicated in multiple human diseases including cancer. ; GO: 0010508 positive regulation of autophagy
Probab=45.30  E-value=13  Score=26.55  Aligned_cols=20  Identities=35%  Similarity=1.084  Sum_probs=17.8

Q ss_pred             EeecCCCCCCeeeehhhHHh
Q psy6684          44 RCQTCHTTDRNAICVNCIKS   63 (77)
Q Consensus        44 ~C~TC~~~d~~giC~~Ca~~   63 (77)
                      +|..|+.....-.|..|++.
T Consensus         1 ~C~iC~~~~~~~~C~~C~~~   20 (302)
T PF10186_consen    1 QCPICHNSRRRFYCANCVNN   20 (302)
T ss_pred             CCCCCCCCCCCeECHHHHHH
Confidence            59999988889999999974


No 15 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=44.67  E-value=26  Score=20.09  Aligned_cols=28  Identities=21%  Similarity=0.693  Sum_probs=20.8

Q ss_pred             eEEeecCCCCC-----CeeeehhhHHhhcCCCceEEeee
Q psy6684          42 FYRCQTCHTTD-----RNAICVNCIKSCHAGHDVAFIRH   75 (77)
Q Consensus        42 ~Y~C~TC~~~d-----~~giC~~Ca~~CH~GHdv~y~r~   75 (77)
                      .|.|-.|+..-     ..--|..|      ||.|.|...
T Consensus         2 ~Y~C~~Cg~~~~~~~~~~irC~~C------G~rIlyK~R   34 (44)
T smart00659        2 IYICGECGRENEIKSKDVVRCREC------GYRILYKKR   34 (44)
T ss_pred             EEECCCCCCEeecCCCCceECCCC------CceEEEEeC
Confidence            48999998743     23667777      999999764


No 16 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=42.35  E-value=11  Score=20.88  Aligned_cols=19  Identities=26%  Similarity=0.894  Sum_probs=9.4

Q ss_pred             EEeecCCCCC-------CeeeehhhH
Q psy6684          43 YRCQTCHTTD-------RNAICVNCI   61 (77)
Q Consensus        43 Y~C~TC~~~d-------~~giC~~Ca   61 (77)
                      |.|..|+...       +.-||..|-
T Consensus         1 m~Cp~Cg~~~~~~D~~~g~~vC~~CG   26 (43)
T PF08271_consen    1 MKCPNCGSKEIVFDPERGELVCPNCG   26 (43)
T ss_dssp             ESBTTTSSSEEEEETTTTEEEETTT-
T ss_pred             CCCcCCcCCceEEcCCCCeEECCCCC
Confidence            4455555532       345666663


No 17 
>PF14976 FAM72:  FAM72 protein
Probab=39.95  E-value=25  Score=25.59  Aligned_cols=31  Identities=29%  Similarity=0.641  Sum_probs=26.2

Q ss_pred             EeecCCCCCCe---eeehhhHHhhcCCCceEEee
Q psy6684          44 RCQTCHTTDRN---AICVNCIKSCHAGHDVAFIR   74 (77)
Q Consensus        44 ~C~TC~~~d~~---giC~~Ca~~CH~GHdv~y~r   74 (77)
                      .|+.|+.+-+-   .-|+.|-..|-.||--+|-.
T Consensus        73 aC~~CGn~vGYhV~~PC~~Cl~scNNGH~wmFhs  106 (150)
T PF14976_consen   73 ACLGCGNIVGYHVVVPCSRCLSSCNNGHFWMFHS  106 (150)
T ss_pred             eeecCCCeeeeEEEEEcchHhcCccCCceEEEec
Confidence            69999998876   55899999999999988753


No 18 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=37.75  E-value=15  Score=24.05  Aligned_cols=23  Identities=22%  Similarity=0.678  Sum_probs=14.9

Q ss_pred             EeecCCCCC--------CeeeehhhHHhhcCC
Q psy6684          44 RCQTCHTTD--------RNAICVNCIKSCHAG   67 (77)
Q Consensus        44 ~C~TC~~~d--------~~giC~~Ca~~CH~G   67 (77)
                      .|-+|+..+        +.-+|..||.+ |+.
T Consensus        15 ~CaDCg~~~p~w~s~~~GiflC~~Cag~-HR~   45 (116)
T PF01412_consen   15 VCADCGAPNPTWASLNYGIFLCLECAGI-HRS   45 (116)
T ss_dssp             B-TTT-SBS--EEETTTTEEE-HHHHHH-HHH
T ss_pred             cCCCCCCCCCCEEEeecChhhhHHHHHH-HHH
Confidence            477888766        45789999987 774


No 19 
>PRK09853 putative selenate reductase subunit YgfK; Provisional
Probab=37.59  E-value=16  Score=33.07  Aligned_cols=32  Identities=25%  Similarity=0.759  Sum_probs=26.0

Q ss_pred             cccceeceEEeecCCCCCCeeeehhhHHhhcCCCceE
Q psy6684          35 TSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVA   71 (77)
Q Consensus        35 ~~f~~Q~~Y~C~TC~~~d~~giC~~Ca~~CH~GHdv~   71 (77)
                      ..+..|+--+|..|+.     +|..|..+|-.+=+++
T Consensus       878 ~~~~~~~~~rC~~C~~-----~C~~C~~vCP~~A~~~  909 (1019)
T PRK09853        878 DAFVAQEAARCLECNY-----VCEKCVDVCPNRANVS  909 (1019)
T ss_pred             cccccccccccCCccc-----ccchhhhhCCcccccc
Confidence            3456788899999997     9999999999765443


No 20 
>PF07911 DUF1677:  Protein of unknown function (DUF1677);  InterPro: IPR012876 The sequences found in this family are all derived from hypothetical plant proteins of unknown function. The region features a number of highly conserved cysteine residues. 
Probab=35.90  E-value=22  Score=23.80  Aligned_cols=21  Identities=24%  Similarity=0.686  Sum_probs=16.8

Q ss_pred             EEeecCCCCC---------------CeeeehhhHHh
Q psy6684          43 YRCQTCHTTD---------------RNAICVNCIKS   63 (77)
Q Consensus        43 Y~C~TC~~~d---------------~~giC~~Ca~~   63 (77)
                      =+|.-|++++               +.|||.-|+..
T Consensus         5 akCeCCG~~EECT~~YI~~VR~ry~GrWvCGLC~EA   40 (91)
T PF07911_consen    5 AKCECCGLTEECTPEYIARVRERYGGRWVCGLCSEA   40 (91)
T ss_pred             eeecCCCCchhccHHHHHHHHHHhCCeehhhcCHHH
Confidence            3688899986               57999999863


No 21 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=35.75  E-value=15  Score=21.73  Aligned_cols=10  Identities=30%  Similarity=0.889  Sum_probs=4.6

Q ss_pred             ceEEeecCCC
Q psy6684          41 DFYRCQTCHT   50 (77)
Q Consensus        41 ~~Y~C~TC~~   50 (77)
                      +.|-|.+|+.
T Consensus        10 ~lw~CL~Cg~   19 (63)
T PF02148_consen   10 NLWLCLTCGY   19 (63)
T ss_dssp             SEEEETTTS-
T ss_pred             ceEEeCCCCc
Confidence            4455555554


No 22 
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=32.59  E-value=37  Score=25.10  Aligned_cols=30  Identities=23%  Similarity=0.431  Sum_probs=23.8

Q ss_pred             ceEEeecCCCCCC--eeeehhhHHhhcCCCceEEeeeC
Q psy6684          41 DFYRCQTCHTTDR--NAICVNCIKSCHAGHDVAFIRHD   76 (77)
Q Consensus        41 ~~Y~C~TC~~~d~--~giC~~Ca~~CH~GHdv~y~r~s   76 (77)
                      .-|+|+-|...-.  ..+|..|      ||.+.-.|.+
T Consensus       138 w~~rC~GC~~~f~~~~~~Cp~C------G~~~~~~~~~  169 (177)
T COG1439         138 WRLRCHGCKRIFPEPKDFCPIC------GSPLKRKRVK  169 (177)
T ss_pred             eeEEEecCceecCCCCCcCCCC------CCceEEeeec
Confidence            4589999998766  6999999      8887766544


No 23 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=31.74  E-value=26  Score=19.01  Aligned_cols=26  Identities=27%  Similarity=0.765  Sum_probs=15.4

Q ss_pred             EEeecCCCCCCe-----eeehhhHHhhcCCCceEEee
Q psy6684          43 YRCQTCHTTDRN-----AICVNCIKSCHAGHDVAFIR   74 (77)
Q Consensus        43 Y~C~TC~~~d~~-----giC~~Ca~~CH~GHdv~y~r   74 (77)
                      |.|-.|+...+.     -.|..|      ||.+.|.+
T Consensus         1 Y~C~~Cg~~~~~~~~~~irC~~C------G~RIlyK~   31 (32)
T PF03604_consen    1 YICGECGAEVELKPGDPIRCPEC------GHRILYKK   31 (32)
T ss_dssp             EBESSSSSSE-BSTSSTSSBSSS------S-SEEBE-
T ss_pred             CCCCcCCCeeEcCCCCcEECCcC------CCeEEEec
Confidence            667777765332     457766      88888764


No 24 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=30.35  E-value=25  Score=18.99  Aligned_cols=19  Identities=21%  Similarity=0.702  Sum_probs=12.8

Q ss_pred             eEEeecCCCC-CCe---eeehhh
Q psy6684          42 FYRCQTCHTT-DRN---AICVNC   60 (77)
Q Consensus        42 ~Y~C~TC~~~-d~~---giC~~C   60 (77)
                      .|+|..|+.+ ++.   ..|..|
T Consensus         2 ~~~C~~CG~i~~g~~~p~~CP~C   24 (34)
T cd00729           2 VWVCPVCGYIHEGEEAPEKCPIC   24 (34)
T ss_pred             eEECCCCCCEeECCcCCCcCcCC
Confidence            5888888887 322   466666


No 25 
>smart00438 ZnF_NFX Repressor of transcription.
Probab=29.52  E-value=16  Score=19.43  Aligned_cols=9  Identities=56%  Similarity=1.328  Sum_probs=7.5

Q ss_pred             hhHHhhcCC
Q psy6684          59 NCIKSCHAG   67 (77)
Q Consensus        59 ~Ca~~CH~G   67 (77)
                      .|.+.||.|
T Consensus         5 ~C~~~CH~G   13 (26)
T smart00438        5 KCQKLCHPG   13 (26)
T ss_pred             cCCCCCCCC
Confidence            588899987


No 26 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=27.62  E-value=29  Score=18.31  Aligned_cols=18  Identities=33%  Similarity=0.859  Sum_probs=9.8

Q ss_pred             EEeecCCCC-C---Ceeeehhh
Q psy6684          43 YRCQTCHTT-D---RNAICVNC   60 (77)
Q Consensus        43 Y~C~TC~~~-d---~~giC~~C   60 (77)
                      |.|..|+.+ +   ..+.|-.|
T Consensus         2 ~~C~~CGy~y~~~~~~~~CP~C   23 (33)
T cd00350           2 YVCPVCGYIYDGEEAPWVCPVC   23 (33)
T ss_pred             EECCCCCCEECCCcCCCcCcCC
Confidence            566666665 1   23555555


No 27 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=27.16  E-value=43  Score=18.65  Aligned_cols=13  Identities=23%  Similarity=0.623  Sum_probs=10.8

Q ss_pred             CeeeehhhHHhhc
Q psy6684          53 RNAICVNCIKSCH   65 (77)
Q Consensus        53 ~~giC~~Ca~~CH   65 (77)
                      +..||..|+..|+
T Consensus        23 ~~~IC~~Cv~~~~   35 (41)
T PF06689_consen   23 GAYICDECVEQAY   35 (41)
T ss_dssp             SEEEEHHHHHHHH
T ss_pred             CcEECHHHHHHHH
Confidence            4689999999886


No 28 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=26.54  E-value=54  Score=18.43  Aligned_cols=29  Identities=24%  Similarity=0.616  Sum_probs=20.4

Q ss_pred             ceeceEEeecCCCCCCeeeehhhHHh-hcCCCc
Q psy6684          38 PMHDFYRCQTCHTTDRNAICVNCIKS-CHAGHD   69 (77)
Q Consensus        38 ~~Q~~Y~C~TC~~~d~~giC~~Ca~~-CH~GHd   69 (77)
                      +.-.+|+|.+|.-   --.|..|... -|..|.
T Consensus        10 i~G~ry~C~~C~d---~dLC~~C~~~~~H~~H~   39 (43)
T cd02340          10 IVGVRYKCLVCPD---YDLCESCEAKGVHPEHA   39 (43)
T ss_pred             CcCCeEECCCCCC---ccchHHhhCcCCCCCCC
Confidence            4557899999973   5789999554 454444


No 29 
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as NAD binding. NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD,
Probab=25.34  E-value=18  Score=25.87  Aligned_cols=15  Identities=27%  Similarity=0.769  Sum_probs=11.1

Q ss_pred             eeeehhhHH--------hhcCCC
Q psy6684          54 NAICVNCIK--------SCHAGH   68 (77)
Q Consensus        54 ~giC~~Ca~--------~CH~GH   68 (77)
                      .|+|..|+.        +|+.|=
T Consensus       218 ~G~C~~C~~~~~~~~~~~C~~Gp  240 (248)
T cd06219         218 TGMCGACRVTVGGETKFACVDGP  240 (248)
T ss_pred             cceeeeEEEEeCCCEEEEeCcCC
Confidence            499999954        677763


No 30 
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit. Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase.
Probab=23.98  E-value=38  Score=30.60  Aligned_cols=28  Identities=29%  Similarity=0.883  Sum_probs=23.9

Q ss_pred             cccceeceEEeecCCCCCCeeeehhhHHhhcCC
Q psy6684          35 TSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAG   67 (77)
Q Consensus        35 ~~f~~Q~~Y~C~TC~~~d~~giC~~Ca~~CH~G   67 (77)
                      ..++.|+--+|..|+.     .|..|+.+|=.|
T Consensus       873 ~~~~~~~~~rC~~c~~-----~Cg~Cv~vCP~~  900 (1012)
T TIGR03315       873 SCFPEQESQRCLECSY-----VCEKCVDVCPNR  900 (1012)
T ss_pred             ccccccccccccCCCC-----CCCChhhhCChh
Confidence            3455788899999998     899999999887


No 31 
>PF02132 RecR:  RecR protein;  InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []. It may act with RecF and RecO.  RecR's structure consists of a N-terminal helix-hairpin-helix (HhH) motif, followed by a Cys4 zinc-finger motif, a Toprim domain and a Walker B motif []. This entry represents the C4-type zinc finger.; PDB: 1VDD_D 2V1C_B.
Probab=23.82  E-value=28  Score=19.27  Aligned_cols=23  Identities=17%  Similarity=0.502  Sum_probs=13.9

Q ss_pred             eceEEeecCCCCCCeeeehhhHH
Q psy6684          40 HDFYRCQTCHTTDRNAICVNCIK   62 (77)
Q Consensus        40 Q~~Y~C~TC~~~d~~giC~~Ca~   62 (77)
                      +..-.|..|+......+|..|..
T Consensus        15 ~~i~~C~~C~nlse~~~C~IC~d   37 (41)
T PF02132_consen   15 ENIKFCSICGNLSEEDPCEICSD   37 (41)
T ss_dssp             HH-EE-SSS--EESSSS-HHHH-
T ss_pred             HcCCccCCCCCcCCCCcCcCCCC
Confidence            45668999998888889999874


No 32 
>PF12346 HJURP_mid:  Holliday junction recognition protein-associated repeat;  InterPro: IPR021052  Vertebral Holliday junction recognition proteins carry an SCM3 domain at their N terminus as do the eukaryotic fungi, but they also carry this central, conserved region. Further downstream there is also a repeated domain, also of unknown function. Investigation of Scm3 and associated proteins is likely to be directly relevant to understanding the mechanism of HJURP-mediated CENP-A chromatin assembly at human centromeres [, ]. 
Probab=23.47  E-value=21  Score=24.98  Aligned_cols=12  Identities=42%  Similarity=0.609  Sum_probs=9.6

Q ss_pred             eecCcccceeceE
Q psy6684          31 ISSYTSFPMHDFY   43 (77)
Q Consensus        31 ~st~~~f~~Q~~Y   43 (77)
                      |||++ |++|+|-
T Consensus        13 ISTKT-fI~qnW~   24 (116)
T PF12346_consen   13 ISTKT-FIMQNWS   24 (116)
T ss_pred             EechH-HHhhhhh
Confidence            46887 9999994


No 33 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=22.88  E-value=37  Score=19.76  Aligned_cols=18  Identities=22%  Similarity=0.800  Sum_probs=11.7

Q ss_pred             eceEEeecCCCCCCeeeehhhH
Q psy6684          40 HDFYRCQTCHTTDRNAICVNCI   61 (77)
Q Consensus        40 Q~~Y~C~TC~~~d~~giC~~Ca   61 (77)
                      ..-++|+-||.    .+|..|.
T Consensus        23 ~rrhhCr~CG~----~vC~~Cs   40 (69)
T PF01363_consen   23 RRRHHCRNCGR----VVCSSCS   40 (69)
T ss_dssp             S-EEE-TTT------EEECCCS
T ss_pred             eeeEccCCCCC----EECCchh
Confidence            56689999998    7888886


No 34 
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=21.85  E-value=44  Score=27.59  Aligned_cols=24  Identities=33%  Similarity=0.645  Sum_probs=18.6

Q ss_pred             ceeceEEeecCCCCCCe--eeehhhH
Q psy6684          38 PMHDFYRCQTCHTTDRN--AICVNCI   61 (77)
Q Consensus        38 ~~Q~~Y~C~TC~~~d~~--giC~~Ca   61 (77)
                      ..-.-|+|.-|+.+-..  |.|.+|-
T Consensus       350 ~~~~~YRC~~CGF~a~~l~W~CPsC~  375 (389)
T COG2956         350 RRKPRYRCQNCGFTAHTLYWHCPSCR  375 (389)
T ss_pred             hhcCCceecccCCcceeeeeeCCCcc
Confidence            34456999999988765  9999885


No 35 
>cd06008 NF-X1-zinc-finger Presumably a zinc binding domain, which has been shown to bind to DNA in the human nuclear transcriptional repressor NF-X1. The zinc finger can be characterized by the pattern C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C. The NF-X1 zinc finger co-occurs with atypical RING-finger and R3H domains. Human NF-X1 is involved in the transcriptional repression of major histocompatibility complex class II genes. The drosophila homolog encoded by stc (shuttle craft) plays a role in embryonic development, and the Arabidopsis homologue AtNFXL1 has been shown to function in the response to trichothecene and other defense mechanisms.
Probab=21.57  E-value=28  Score=20.00  Aligned_cols=10  Identities=40%  Similarity=1.036  Sum_probs=8.4

Q ss_pred             hhhHHhhcCC
Q psy6684          58 VNCIKSCHAG   67 (77)
Q Consensus        58 ~~Ca~~CH~G   67 (77)
                      -.|.+.||.|
T Consensus        14 H~C~~~CH~G   23 (49)
T cd06008          14 HKCEQLCHEG   23 (49)
T ss_pred             CcCCCcCcCC
Confidence            4688999998


No 36 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=20.75  E-value=83  Score=17.22  Aligned_cols=16  Identities=38%  Similarity=0.771  Sum_probs=13.3

Q ss_pred             cccceeceEEeecCCC
Q psy6684          35 TSFPMHDFYRCQTCHT   50 (77)
Q Consensus        35 ~~f~~Q~~Y~C~TC~~   50 (77)
                      .+-+|--||.|..|+-
T Consensus        21 aDE~~T~fy~C~~C~~   36 (39)
T PF01096_consen   21 ADEPMTLFYVCCNCGH   36 (39)
T ss_dssp             SSSSSEEEEEESSSTE
T ss_pred             CCCCCeEEEEeCCCCC
Confidence            4567899999999985


No 37 
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=20.65  E-value=58  Score=17.10  Aligned_cols=13  Identities=23%  Similarity=0.797  Sum_probs=10.2

Q ss_pred             eceEEeecCCCCC
Q psy6684          40 HDFYRCQTCHTTD   52 (77)
Q Consensus        40 Q~~Y~C~TC~~~d   52 (77)
                      ..+|+|..|+..-
T Consensus         2 ~~~ykC~~CGniv   14 (34)
T cd00974           2 LEVYKCEICGNIV   14 (34)
T ss_pred             CcEEEcCCCCcEE
Confidence            4589999998753


No 38 
>PF12838 Fer4_7:  4Fe-4S dicluster domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 3CF4_A 1K0T_A 2VKR_C 1JB0_C 3PCQ_C.
Probab=20.24  E-value=55  Score=17.96  Aligned_cols=11  Identities=36%  Similarity=1.220  Sum_probs=7.9

Q ss_pred             ehhhHHhhcCC
Q psy6684          57 CVNCIKSCHAG   67 (77)
Q Consensus        57 C~~Ca~~CH~G   67 (77)
                      |..|+.+|..|
T Consensus        41 C~~C~~~CP~~   51 (52)
T PF12838_consen   41 CGACVEVCPTG   51 (52)
T ss_dssp             -SHHHHHTTTS
T ss_pred             cChhhhhCcCc
Confidence            46799998765


Done!