Diaphorina citri psyllid: psy6685

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MRRTMLSSTFRVNYQQGFRLVRNLHQKRVTRQLDEIIRVDHAGELGADRIYAGQMAVLGNSSVAPKIQEMWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFILGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKV
ccccccccccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcc
*R*****************L*RNLHQKRVTRQLDEIIRVDHAGELGADRIYAGQMAVLGNSSVAPKIQEMWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFILGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGL**GAEQAPFYKLMTDVIKVGCKVAIGVAKV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRTMLSSTFRVNYQQGFRLVRNLHQKRVTRQLDEIIRVDHAGELGADRIYAGQMAVLGNSSVAPKIQEMWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFILGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquinone biosynthesis protein COQ7 homolog (Fragment) Involved in lifespan determination in ubiquinone-independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator.very confidentQ63619
Ubiquinone biosynthesis protein COQ7 homolog Plays a role in biological timing and in longevity.very confidentP48376
Ubiquinone biosynthesis protein COQ7 homolog Potential central metabolic regulator.very confidentQ54VB3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000975 [MF]regulatory region DNA bindingconfidentGO:0097159, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0070584 [BP]mitochondrion morphogenesisprobableGO:0006996, GO:0032502, GO:0009987, GO:0032990, GO:0048869, GO:0071840, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0044699, GO:0008150, GO:0009653, GO:0007005
GO:0001306 [BP]age-dependent response to oxidative stressprobableGO:0032502, GO:0007571, GO:0007568, GO:0050896, GO:0044767, GO:0006950, GO:0008150, GO:0006979, GO:0044699
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0046914 [MF]transition metal ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0001841 [BP]neural tube formationprobableGO:0048598, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009792, GO:0035239, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0043009, GO:0048646, GO:0032502, GO:0032501, GO:0021915, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0001838, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0034599 [BP]cellular response to oxidative stressprobableGO:0051716, GO:0033554, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0070887, GO:0042221, GO:0006979, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0016491 [MF]oxidoreductase activityprobableGO:0003824, GO:0003674
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006744 [BP]ubiquinone biosynthetic processprobableGO:0006732, GO:0006733, GO:0044249, GO:0009108, GO:0044281, GO:0044283, GO:0045426, GO:1901576, GO:0044710, GO:0051186, GO:1901663, GO:0051188, GO:1901661, GO:0042375, GO:0071704, GO:0006743, GO:0009987, GO:0009058, GO:0044711, GO:0008150, GO:0008152, GO:0042181, GO:0042180, GO:0044237
GO:0030534 [BP]adult behaviorprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0042775 [BP]mitochondrial ATP synthesis coupled electron transportprobableGO:0044710, GO:0009987, GO:0015980, GO:0016310, GO:0006793, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042773, GO:0055114, GO:0006119
GO:0048520 [BP]positive regulation of behaviorprobableGO:0048584, GO:0048583, GO:0050795, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0044351 [BP]macropinocytosisprobableGO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0071276 [BP]cellular response to cadmium ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0046686, GO:0042221, GO:0010035, GO:0044699
GO:0071585 [BP]detoxification of cadmium ionprobableGO:0050896, GO:0009636, GO:0008150, GO:0010038, GO:0046686, GO:0042221, GO:0010035
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FZF, chain A
Confidence level:confident
Coverage over the Query: 32-168
View the alignment between query and template
View the model in PyMOL
Template: 2WLU, chain A
Confidence level:probable
Coverage over the Query: 28-167
View the alignment between query and template
View the model in PyMOL