Query         psy6694
Match_columns 136
No_of_seqs    130 out of 1183
Neff          5.6 
Searched_HMMs 46136
Date          Sat Aug 17 00:39:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6694.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6694hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00379 Chitin_bind_4:  Insect  99.7 2.2E-16 4.7E-21   99.9   7.0   47   34-82      1-52  (52)
  2 PF06004 DUF903:  Bacterial pro  78.9     1.8   4E-05   27.3   2.1   37   37-73      3-40  (50)
  3 KOG3317|consensus               67.5      61  0.0013   25.7   8.6   37   66-104   108-144 (188)
  4 PRK05461 apaG CO2+/MG2+ efflux  58.4      48   0.001   24.5   6.2   21   52-72     93-113 (127)
  5 COG5294 Uncharacterized protei  56.9      26 0.00056   25.8   4.4   46   29-77     26-75  (113)
  6 PF13511 DUF4124:  Domain of un  55.2      10 0.00022   23.5   2.0   17   58-77     14-30  (60)
  7 COG3422 Uncharacterized conser  51.6      24 0.00051   23.1   3.2   20   24-43      5-24  (59)
  8 PF07437 YfaZ:  YfaZ precursor;  50.2      44 0.00095   26.0   5.1   10    1-10      1-10  (180)
  9 COG4939 Major membrane immunog  43.1      69  0.0015   24.3   5.0   44   29-72     29-76  (147)
 10 TIGR01655 yxeA_fam conserved h  42.6      37 0.00079   24.4   3.4   18   60-77     55-76  (114)
 11 KOG1691|consensus               42.1 1.7E+02  0.0036   23.7   7.4   31   55-86     80-110 (210)
 12 PF13956 Ibs_toxin:  Toxin Ibs,  38.9      11 0.00023   19.2   0.1    8    1-8       1-8   (19)
 13 TIGR01965 VCBS_repeat VCBS rep  37.4      58  0.0013   23.1   3.7   48   27-76     30-77  (99)
 14 PF11131 PhrC_PhrF:  Rap-phr ex  37.0      15 0.00032   21.9   0.5   11    2-12      3-13  (37)
 15 cd07241 Glo_EDI_BRP_like_3 Thi  36.4 1.2E+02  0.0027   19.8   6.0   14   58-72    111-124 (125)
 16 PF06286 Coleoptericin:  Coleop  35.8       5 0.00011   30.2  -2.0   12    1-12      1-12  (143)
 17 PF13127 DUF3955:  Protein of u  33.4      24 0.00052   23.0   1.1   11   60-70     25-35  (63)
 18 cd07252 BphC1-RGP6_N_like N-te  31.4      65  0.0014   21.8   3.1   20   58-77    100-119 (120)
 19 cd08344 MhqB_like_N N-terminal  29.9      56  0.0012   21.8   2.6   18   59-76     93-110 (112)
 20 PF10681 Rot1:  Chaperone for p  29.7      74  0.0016   25.8   3.5   28   56-87     68-95  (212)
 21 COG2967 ApaG Uncharacterized p  29.0 2.5E+02  0.0054   21.0   5.9   22   52-73     92-113 (126)
 22 cd07240 ED_TypeI_classII_N N-t  28.9      82  0.0018   20.6   3.2   20   58-77     97-116 (117)
 23 PHA02978 hypothetical protein;  26.3      64  0.0014   23.8   2.4   19   55-73     72-90  (135)
 24 cd07244 FosA FosA, a Fosfomyci  25.6      78  0.0017   21.4   2.7   18   59-76     94-111 (121)
 25 cd07266 HPCD_N_class_II N-term  25.4      95   0.002   20.7   3.1   17   59-75    102-118 (121)
 26 cd09013 BphC-JF8_N_like N-term  24.9      96  0.0021   20.8   3.1   17   59-75    102-118 (121)
 27 PF04170 NlpE:  NlpE N-terminal  24.8 2.2E+02  0.0049   19.1   5.1   57   22-85     13-69  (87)
 28 cd08352 Glo_EDI_BRP_like_1 Thi  24.2 2.1E+02  0.0045   18.5   5.2   14   59-72    110-123 (125)
 29 TIGR03836 termin_org_HMW1 cyta  23.9      37  0.0008   23.3   0.8   20   63-84     28-47  (82)
 30 cd07242 Glo_EDI_BRP_like_6 Thi  23.0 1.1E+02  0.0024   20.5   3.1   16   59-74    112-127 (128)
 31 cd09012 Glo_EDI_BRP_like_24 Th  22.9 1.1E+02  0.0024   20.6   3.1   14   61-74    110-123 (124)
 32 cd08361 PpCmtC_N N-terminal do  22.9 1.1E+02  0.0025   20.9   3.2   17   60-76    104-120 (124)
 33 PF00659 POLO_box:  POLO box du  22.8 2.1E+02  0.0045   18.0   5.3   38   33-70      4-45  (68)
 34 PF09242 FCSD-flav_bind:  Flavo  21.2 1.3E+02  0.0028   19.8   3.0   29   57-86      8-37  (71)
 35 PRK06724 hypothetical protein;  21.0 1.1E+02  0.0024   21.7   2.8   21   57-77    103-125 (128)
 36 cd08357 Glo_EDI_BRP_like_18 Th  20.9 1.3E+02  0.0028   19.9   3.0   15   60-74    110-124 (125)
 37 PF06486 DUF1093:  Protein of u  20.8 1.2E+02  0.0025   19.9   2.7   20   58-77     26-49  (78)
 38 PTZ00459 mucin-associated surf  20.8      38 0.00083   28.2   0.4    9    3-11      8-16  (291)
 39 PF04234 CopC:  CopC domain;  I  20.7 1.4E+02   0.003   20.3   3.2    8   55-62     87-94  (97)
 40 cd08362 BphC5-RrK37_N_like N-t  20.1 1.4E+02  0.0031   19.6   3.1   17   59-75    101-117 (120)
 41 COG0450 AhpC Peroxiredoxin [Po  20.0 1.9E+02  0.0042   23.1   4.2   29   53-83    121-149 (194)

No 1  
>PF00379 Chitin_bind_4:  Insect cuticle protein;  InterPro: IPR000618 Insect cuticle is composed of proteins and chitin. The cuticular proteins seem to be specific to the type of cuticle (flexible or stiff) that occur at stages of the insect development. The proteins found in the flexible cuticle of larva and pupa of different insects share a conserved C-terminal section [] such a region is also found in the soft endocuticle of adults insects [] as well as in other cuticular proteins including in arachnids []. In addition, cuticular proteins share hydrophobic regions dominated by tetrapeptide repeats (A-A-P-A/V), which are presumed to be functionally important [, ]. Many insect cuticle proteins also include a 35-36 amino acid motif known as the R and R consensus. An extended form of this motif has been shown [] to bind chitin. It has no sequence similiarity to the cysteine-containing chitin-binding domain of chitinases and some peritrophic membrane proteins, suggesting that arthropods have two distinct classes of chitin-binding proteins, those with the chitin-binding domains found in lectins, chitinases and peritrophic membranes (cysCBD), and those with the type of chitin-binding domains found in cuticular proteins (non-cysCBD) []. The cuticle protein signature has been found in locust cuticle proteins 7 (LM-7), 8 (LM-8), 19 (LM-19) and endocuticle structural glycoprotein ABD-4; Hyalophora cecropia (Cecropia moth) cuticle proteins 12 and 66; Drosophila melanogaster (Fruit fly) larval cuticles proteins I, II, III and IV (LCP1 to LCP4); drosophila pupal cuticle proteins PCP, EDG-78E and EDG-84E; Manduca sexta (Tobacco hawkmoth) cuticle protein LCP-14; Tenebrio molitor (Yellow mealworm) cuticle proteins ACP-20, A1A, A2B and A3A; and Araneus diadematus (Spider) cuticle proteins ACP 11.9, ACP 12.4, ACP 12.6, ACP 15.5 and ACP 15.7.; GO: 0042302 structural constituent of cuticle
Probab=99.67  E-value=2.2e-16  Score=99.91  Aligned_cols=47  Identities=40%  Similarity=0.916  Sum_probs=43.3

Q ss_pred             eeEEEecCCCCEEEEee-----CCCCeEEEEEEEECCCCcEEEEEEEeeCCCCc
Q psy6694          34 YTFGYEAADGSFKIETR-----DVGGNVKGMFGFVDENGELKRISYSARNGTGF   82 (136)
Q Consensus        34 Y~f~yet~dG~~~~E~g-----~~~~~v~GsYsy~~pdG~~~~V~Y~AD~e~Gf   82 (136)
                      |+|+|+++|| .++|++     +..++|+|+|+|++|||+.++|+|+|| ++||
T Consensus         1 Y~f~Y~~~dg-~~~e~~~~~~~~~~~~v~GsY~y~~pdG~~~~V~Y~Ad-~~Gf   52 (52)
T PF00379_consen    1 YSFGYETSDG-SRQEEGRPETEDEGGVVRGSYSYIDPDGQTRTVTYVAD-ENGF   52 (52)
T ss_pred             CeeEeEcCCC-CEEEEEEcccCCCCCEEEEEEEEECCCCCEEEEEEECC-CCCC
Confidence            7999999999 666666     488999999999999999999999999 9998


No 2  
>PF06004 DUF903:  Bacterial protein of unknown function (DUF903);  InterPro: IPR010305 This family consists of several small bacterial proteins several of which are classified as putative lipoproteins. The function of this family is unknown.; PDB: 2RB6_B 3BDU_F 2RA2_F 2RD1_C 3FIF_H 2JN0_A 2K57_A.
Probab=78.93  E-value=1.8  Score=27.27  Aligned_cols=37  Identities=19%  Similarity=0.380  Sum_probs=22.4

Q ss_pred             EEecCCCCEEEEeeCCC-CeEEEEEEEECCCCcEEEEE
Q psy6694          37 GYEAADGSFKIETRDVG-GNVKGMFGFVDENGELKRIS   73 (136)
Q Consensus        37 ~yet~dG~~~~E~g~~~-~~v~GsYsy~~pdG~~~~V~   73 (136)
                      --.+.||..-.-.|.+. ..-.|-|+|.|.+|+.+.|+
T Consensus         3 vi~t~dG~~i~t~gkP~~D~~tG~~~y~D~~G~~~qIn   40 (50)
T PF06004_consen    3 VITTNDGRTIVTDGKPKYDKDTGMYSYTDADGKEQQIN   40 (50)
T ss_dssp             EEEETTSEEEEESSEEEEETTTTEEEEEBTTS-EEEEE
T ss_pred             EEEeCCCcEEEeCCCccccCCCCcEEEECCCCCEEEEc
Confidence            34566774322222211 23469999999999998875


No 3  
>KOG3317|consensus
Probab=67.49  E-value=61  Score=25.71  Aligned_cols=37  Identities=14%  Similarity=0.202  Sum_probs=23.6

Q ss_pred             CCcEEEEEEEeeCCCCccccCCCCCCCCCcccccccccc
Q psy6694          66 NGELKRISYSARNGTGFQASGTIATPVENARLNPSYTTV  104 (136)
Q Consensus        66 dG~~~~V~Y~AD~e~Gf~~~g~~lP~p~p~~v~~~l~~~  104 (136)
                      +|...+|+|.++ |.| ..+....-+|.|..|...-++-
T Consensus       108 ~~t~atVty~~~-e~g-~~~~~~ts~~~~gyila~re~~  144 (188)
T KOG3317|consen  108 NGTPATVTYRIP-EKG-ALQEAYTSPPGPGYILAQREPD  144 (188)
T ss_pred             ccCceEEEEEcC-CCC-ceeEEeecCCCCcceeeecCcc
Confidence            355679999999 888 4433333455667776665433


No 4  
>PRK05461 apaG CO2+/MG2+ efflux protein ApaG; Reviewed
Probab=58.39  E-value=48  Score=24.48  Aligned_cols=21  Identities=33%  Similarity=0.665  Sum_probs=17.0

Q ss_pred             CCCeEEEEEEEECCCCcEEEE
Q psy6694          52 VGGNVKGMFGFVDENGELKRI   72 (136)
Q Consensus        52 ~~~~v~GsYsy~~pdG~~~~V   72 (136)
                      +.|..+|+|.+++++|..+.|
T Consensus        93 p~G~M~G~y~~~~~~G~~F~v  113 (127)
T PRK05461         93 PSGTMQGHYQMVDEDGERFEV  113 (127)
T ss_pred             CCEEEEEEEEEEeCCCCEEEE
Confidence            457899999999999986554


No 5  
>COG5294 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.87  E-value=26  Score=25.76  Aligned_cols=46  Identities=22%  Similarity=0.374  Sum_probs=29.5

Q ss_pred             CCCCCeeEEEecCCCCEEEEeeCCCCeEEEEEEEE----CCCCcEEEEEEEee
Q psy6694          29 NDDGSYTFGYEAADGSFKIETRDVGGNVKGMFGFV----DENGELKRISYSAR   77 (136)
Q Consensus        29 ~~dGsY~f~yet~dG~~~~E~g~~~~~v~GsYsy~----~pdG~~~~V~Y~AD   77 (136)
                      +-|| |++=-...+.-.+.|+.+.++..  -|+|.    +.+|+.-+|.|+|+
T Consensus        26 ~~d~-fnpyvk~~~~y~k~~~~t~~~~~--~y~y~i~ayn~~Gkkk~v~f~a~   75 (113)
T COG5294          26 NYDR-FNPYVKITDSYAKVEEDTQDGSP--GYEYTITAYNKNGKKKEVKFTAT   75 (113)
T ss_pred             ccCC-CCceEEEeccceecccccccCCc--cceeeehhhccCCcEEEEEEEec
Confidence            3443 55544554443566666556555  45554    67899999999998


No 6  
>PF13511 DUF4124:  Domain of unknown function (DUF4124)
Probab=55.20  E-value=10  Score=23.51  Aligned_cols=17  Identities=41%  Similarity=0.804  Sum_probs=13.8

Q ss_pred             EEEEEECCCCcEEEEEEEee
Q psy6694          58 GMFGFVDENGELKRISYSAR   77 (136)
Q Consensus        58 GsYsy~~pdG~~~~V~Y~AD   77 (136)
                      .-|.|+|.+|+   |+|+-.
T Consensus        14 ~vYk~~D~~G~---v~ysd~   30 (60)
T PF13511_consen   14 EVYKWVDENGV---VHYSDT   30 (60)
T ss_pred             cEEEEECCCCC---EEECcc
Confidence            57999999996   677765


No 7  
>COG3422 Uncharacterized conserved protein [Function unknown]
Probab=51.58  E-value=24  Score=23.11  Aligned_cols=20  Identities=30%  Similarity=0.428  Sum_probs=16.6

Q ss_pred             EeeecCCCCCeeEEEecCCC
Q psy6694          24 QINRLNDDGSYTFGYEAADG   43 (136)
Q Consensus        24 ~~~~~~~dGsY~f~yet~dG   43 (136)
                      .+-..+.+|.|.|.+...||
T Consensus         5 fei~kdk~Ge~rfrlkA~N~   24 (59)
T COG3422           5 FEIYKDKAGEYRFRLKAANG   24 (59)
T ss_pred             EEEEEcCCCcEEEEEEccCc
Confidence            34456789999999999998


No 8  
>PF07437 YfaZ:  YfaZ precursor;  InterPro: IPR009998 This family contains the precursor of the bacterial protein YfaZ (approximately 180 residues long). Many members of this family are hypothetical proteins.
Probab=50.16  E-value=44  Score=25.99  Aligned_cols=10  Identities=30%  Similarity=0.517  Sum_probs=7.1

Q ss_pred             ChhHHHHHhc
Q psy6694           1 MLRLLLVCTQ   10 (136)
Q Consensus         1 M~klvlvc~l   10 (136)
                      |-|+++.|++
T Consensus         1 m~k~~~a~~~   10 (180)
T PF07437_consen    1 MKKFLLASAA   10 (180)
T ss_pred             CchHHHHHHH
Confidence            7788877653


No 9  
>COG4939 Major membrane immunogen, membrane-anchored lipoprotein [Function unknown]
Probab=43.10  E-value=69  Score=24.33  Aligned_cols=44  Identities=30%  Similarity=0.422  Sum_probs=30.9

Q ss_pred             CCCCCeeEEEecCCCC----EEEEeeCCCCeEEEEEEEECCCCcEEEE
Q psy6694          29 NDDGSYTFGYEAADGS----FKIETRDVGGNVKGMFGFVDENGELKRI   72 (136)
Q Consensus        29 ~~dGsY~f~yet~dG~----~~~E~g~~~~~v~GsYsy~~pdG~~~~V   72 (136)
                      -.||.|+-.|+.-|..    +-+=+-+.+..|+=.|-|.+.+|+...=
T Consensus        29 ~~dGtY~~~y~~fDd~gwk~f~~iti~dGKiv~~~ydy~~k~G~~Ks~   76 (147)
T COG4939          29 FNDGTYQGHYESFDDHGWKAFVTITIQDGKIVACTYDYRDKKGNIKSD   76 (147)
T ss_pred             ccCCceeeeeccccccCccceEEEEEeCCEEEEEEeeeecCCCCcccc
Confidence            3789999999987742    2222223456789999999999987543


No 10 
>TIGR01655 yxeA_fam conserved hypothetical protein TIGR01655. This model represents a family of small (about 115 amino acids) uncharacterized proteins with N-terminal signal sequences, found exclusively in Gram-positive organisms. Most genomes that have any members of this family have at least two members.
Probab=42.58  E-value=37  Score=24.39  Aligned_cols=18  Identities=17%  Similarity=0.571  Sum_probs=15.0

Q ss_pred             EEEE----CCCCcEEEEEEEee
Q psy6694          60 FGFV----DENGELKRISYSAR   77 (136)
Q Consensus        60 Ysy~----~pdG~~~~V~Y~AD   77 (136)
                      |.|.    |.+|+..+++++|+
T Consensus        55 y~Y~~~~yd~~G~~k~i~f~~~   76 (114)
T TIGR01655        55 YEYKLDAYDSSGKKHKVKFMAG   76 (114)
T ss_pred             EEEEEEEECCCCCEEEEEEEcC
Confidence            6554    88999999999886


No 11 
>KOG1691|consensus
Probab=42.07  E-value=1.7e+02  Score=23.74  Aligned_cols=31  Identities=23%  Similarity=0.412  Sum_probs=26.4

Q ss_pred             eEEEEEEEECCCCcEEEEEEEeeCCCCccccC
Q psy6694          55 NVKGMFGFVDENGELKRISYSARNGTGFQASG   86 (136)
Q Consensus        55 ~v~GsYsy~~pdG~~~~V~Y~AD~e~Gf~~~g   86 (136)
                      +..|+|+|+..+-..+.+-++|| ..|.+|..
T Consensus        80 v~~gqFaFta~e~~~y~~Cf~~~-~~~~~p~~  110 (210)
T KOG1691|consen   80 VTKGQFAFTAEESGMYEACFTAD-VPGHKPET  110 (210)
T ss_pred             cccceEEEEeccCCcEEEEEecc-cCCCCCCc
Confidence            34999999999988999999998 77887744


No 12 
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=38.93  E-value=11  Score=19.25  Aligned_cols=8  Identities=25%  Similarity=0.833  Sum_probs=6.2

Q ss_pred             ChhHHHHH
Q psy6694           1 MLRLLLVC    8 (136)
Q Consensus         1 M~klvlvc    8 (136)
                      |||++++.
T Consensus         1 MMk~vIIl    8 (19)
T PF13956_consen    1 MMKLVIIL    8 (19)
T ss_pred             CceehHHH
Confidence            89988763


No 13 
>TIGR01965 VCBS_repeat VCBS repeat. This domain of about 100 residues is found multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion.
Probab=37.37  E-value=58  Score=23.14  Aligned_cols=48  Identities=13%  Similarity=0.349  Sum_probs=30.7

Q ss_pred             ecCCCCCeeEEEecCCCCEEEEeeCCCCeEEEEEEEECCCCcEEEEEEEe
Q psy6694          27 RLNDDGSYTFGYEAADGSFKIETRDVGGNVKGMFGFVDENGELKRISYSA   76 (136)
Q Consensus        27 ~~~~dGsY~f~yet~dG~~~~E~g~~~~~v~GsYsy~~pdG~~~~V~Y~A   76 (136)
                      .++.+|+|.|....++. ..+.-+ .+..+.=+|.|...||....|.-+=
T Consensus        30 ti~~~G~wtYtl~n~~~-avq~L~-~Ge~~tdsFtvtv~DGtt~~vtItI   77 (99)
T TIGR01965        30 SIDADGQWTYQADNSQT-AVQALK-AGETLTDTFTVTSADGTSQTVTITI   77 (99)
T ss_pred             EECCCCcEEEEeCCCcH-HHHhhc-CCCEEEEEEEEEEeCCCeEEEEEEE
Confidence            35778877666654442 222222 3456777899999999877776553


No 14 
>PF11131 PhrC_PhrF:  Rap-phr extracellular signalling
Probab=36.99  E-value=15  Score=21.87  Aligned_cols=11  Identities=27%  Similarity=0.721  Sum_probs=8.5

Q ss_pred             hhHHHHHhccc
Q psy6694           2 LRLLLVCTQEV   12 (136)
Q Consensus         2 ~klvlvc~la~   12 (136)
                      .||+++|++++
T Consensus         3 sKl~l~CLA~a   13 (37)
T PF11131_consen    3 SKLFLICLAAA   13 (37)
T ss_pred             hhHHHHHHHHH
Confidence            58999998654


No 15 
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=36.36  E-value=1.2e+02  Score=19.81  Aligned_cols=14  Identities=21%  Similarity=0.321  Sum_probs=10.5

Q ss_pred             EEEEEECCCCcEEEE
Q psy6694          58 GMFGFVDENGELKRI   72 (136)
Q Consensus        58 GsYsy~~pdG~~~~V   72 (136)
                      ..| +.||||...++
T Consensus       111 ~~~-~~DPdG~~iE~  124 (125)
T cd07241         111 ESV-ILDPEGNRIEI  124 (125)
T ss_pred             EEE-EECCCCCEEEe
Confidence            344 88999998775


No 16 
>PF06286 Coleoptericin:  Coleoptericin;  InterPro: IPR009382 This family consists of several insect coleoptericin, acaloleptin, holotricin and rhinocerosin proteins which are all known to be antibacterial proteins []. These all appear to be short, glycine-rich molecules, inducible by infection.; GO: 0042742 defense response to bacterium, 0005576 extracellular region
Probab=35.77  E-value=5  Score=30.19  Aligned_cols=12  Identities=17%  Similarity=0.379  Sum_probs=9.3

Q ss_pred             ChhHHHHHhccc
Q psy6694           1 MLRLLLVCTQEV   12 (136)
Q Consensus         1 M~klvlvc~la~   12 (136)
                      ||||.+++||.+
T Consensus         1 mmkl~i~~~lia   12 (143)
T PF06286_consen    1 MMKLYIIFGLIA   12 (143)
T ss_pred             CceEeeehhHHH
Confidence            999998876644


No 17 
>PF13127 DUF3955:  Protein of unknown function (DUF3955)
Probab=33.43  E-value=24  Score=23.02  Aligned_cols=11  Identities=45%  Similarity=0.712  Sum_probs=7.9

Q ss_pred             EEEECCCCcEE
Q psy6694          60 FGFVDENGELK   70 (136)
Q Consensus        60 Ysy~~pdG~~~   70 (136)
                      +||+|+||..+
T Consensus        25 ~syVd~~G~L~   35 (63)
T PF13127_consen   25 GSYVDEDGVLH   35 (63)
T ss_pred             cceECCCCeEe
Confidence            46788888764


No 18 
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of 2,3-dihydroxybiphenyl 1,2-dioxygenases. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its N-
Probab=31.37  E-value=65  Score=21.84  Aligned_cols=20  Identities=20%  Similarity=0.612  Sum_probs=16.4

Q ss_pred             EEEEEECCCCcEEEEEEEee
Q psy6694          58 GMFGFVDENGELKRISYSAR   77 (136)
Q Consensus        58 GsYsy~~pdG~~~~V~Y~AD   77 (136)
                      ..+.+.||||...++.|.-+
T Consensus       100 ~~~~~~DPdG~~iE~~~~~~  119 (120)
T cd07252         100 GLIRFADPDGNRHELFWGPK  119 (120)
T ss_pred             EEEEEECCCCCEEEEEeccc
Confidence            46789999999999887654


No 19 
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=29.91  E-value=56  Score=21.81  Aligned_cols=18  Identities=22%  Similarity=0.337  Sum_probs=14.7

Q ss_pred             EEEEECCCCcEEEEEEEe
Q psy6694          59 MFGFVDENGELKRISYSA   76 (136)
Q Consensus        59 sYsy~~pdG~~~~V~Y~A   76 (136)
                      ++-+.||||...++.+-+
T Consensus        93 ~~~~~DP~Gn~iel~~~~  110 (112)
T cd08344          93 GVWFRDPDGNLLQVKVAE  110 (112)
T ss_pred             EEEEECCCCCEEEEecCC
Confidence            477999999999998643


No 20 
>PF10681 Rot1:  Chaperone for protein-folding within the ER, fungal;  InterPro: IPR019623  This conserved fungal family is an essential molecular chaperone in the endoplasmic reticulum. Molecular chaperones transiently interact with unfolded proteins to inhibit their self-aggregation and to support their folding and/or assembly. Rot1 is a general chaperone with some substrate specificity, its substrates being the structurally unrelated Kre5 Kre6 Big1 Atg22, which are type I, type II, and polytopic membrane proteins. The dependencies of each for Rot1 do not share similarities. However, their folding does require BiP, and one of these proteins was simultaneously associated with both Rot1 and BiP. In addition, Rot1 may cooperate with BiP/Kar2 in the folding of Kre6 []. 
Probab=29.68  E-value=74  Score=25.78  Aligned_cols=28  Identities=21%  Similarity=0.382  Sum_probs=22.1

Q ss_pred             EEEEEEEECCCCcEEEEEEEeeCCCCccccCC
Q psy6694          56 VKGMFGFVDENGELKRISYSARNGTGFQASGT   87 (136)
Q Consensus        56 v~GsYsy~~pdG~~~~V~Y~AD~e~Gf~~~g~   87 (136)
                      .+|+|..- ++|...-.-+..|   |.|-..+
T Consensus        68 QHGtY~l~-~nGsl~L~P~~~D---GrQl~sd   95 (212)
T PF10681_consen   68 QHGTYELN-SNGSLTLTPFAVD---GRQLVSD   95 (212)
T ss_pred             ecceEEEC-CCCcEEEeecCCC---CceeccC
Confidence            58999877 7898888878776   8887664


No 21 
>COG2967 ApaG Uncharacterized protein affecting Mg2+/Co2+ transport [Inorganic ion transport and metabolism]
Probab=29.00  E-value=2.5e+02  Score=21.00  Aligned_cols=22  Identities=27%  Similarity=0.653  Sum_probs=17.9

Q ss_pred             CCCeEEEEEEEECCCCcEEEEE
Q psy6694          52 VGGNVKGMFGFVDENGELKRIS   73 (136)
Q Consensus        52 ~~~~v~GsYsy~~pdG~~~~V~   73 (136)
                      +.|..+|.|.-++.||..++|.
T Consensus        92 p~G~M~GhY~M~~e~G~~F~v~  113 (126)
T COG2967          92 PSGTMQGHYEMIDEDGETFDVA  113 (126)
T ss_pred             CcceEEEEEEEecCCCcEEEee
Confidence            4578899999999999977653


No 22 
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain. This family contains the N-terminal, non-catalytic, domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this fa
Probab=28.91  E-value=82  Score=20.58  Aligned_cols=20  Identities=25%  Similarity=0.316  Sum_probs=15.8

Q ss_pred             EEEEEECCCCcEEEEEEEee
Q psy6694          58 GMFGFVDENGELKRISYSAR   77 (136)
Q Consensus        58 GsYsy~~pdG~~~~V~Y~AD   77 (136)
                      -++.+.||||...++.+..|
T Consensus        97 ~~~~~~DP~G~~ie~~~~~~  116 (117)
T cd07240          97 RGLRFQDPDGHLLELFVEAD  116 (117)
T ss_pred             eEEEEECCCCCEEEEEEccC
Confidence            35568999999999987654


No 23 
>PHA02978 hypothetical protein; Provisional
Probab=26.27  E-value=64  Score=23.84  Aligned_cols=19  Identities=21%  Similarity=0.399  Sum_probs=14.8

Q ss_pred             eEEEEEEEECCCCcEEEEE
Q psy6694          55 NVKGMFGFVDENGELKRIS   73 (136)
Q Consensus        55 ~v~GsYsy~~pdG~~~~V~   73 (136)
                      ...=.+||.||||...+|+
T Consensus        72 ~iiiy~sy~~~~gisiqvs   90 (135)
T PHA02978         72 EIIIYFSYADPDGISIQVS   90 (135)
T ss_pred             EEEEEEEecCCCceEEEEe
Confidence            3445677899999988886


No 24 
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. This subfamily family contains FosA, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosA, catalyzes the addition of glutathione to the antibiotic fosfomycin, (1R,2S)-epoxypropylphosphonic acid, making it inactive. FosA is a Mn(II) dependent enzyme. It is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=25.56  E-value=78  Score=21.39  Aligned_cols=18  Identities=22%  Similarity=0.427  Sum_probs=14.5

Q ss_pred             EEEEECCCCcEEEEEEEe
Q psy6694          59 MFGFVDENGELKRISYSA   76 (136)
Q Consensus        59 sYsy~~pdG~~~~V~Y~A   76 (136)
                      ++-+.||||..+++.+.|
T Consensus        94 ~~~f~DPdG~~ie~~~~~  111 (121)
T cd07244          94 SFYFLDPDGHKLELHVGS  111 (121)
T ss_pred             EEEEECCCCCEEEEEeCC
Confidence            556899999999988654


No 25 
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the N-terminal, non-catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of extradiol dioxygenases. The class III 3,4-dihydroxyphenylacetate 2,3-dioxygenases belong to a differ
Probab=25.43  E-value=95  Score=20.66  Aligned_cols=17  Identities=12%  Similarity=-0.085  Sum_probs=13.8

Q ss_pred             EEEEECCCCcEEEEEEE
Q psy6694          59 MFGFVDENGELKRISYS   75 (136)
Q Consensus        59 sYsy~~pdG~~~~V~Y~   75 (136)
                      ++.+.||||..+++.|-
T Consensus       102 ~~~~~DPdG~~ve~~~~  118 (121)
T cd07266         102 ALRVEDPLGFPIEFYAE  118 (121)
T ss_pred             EEEEECCCCCEEEEEec
Confidence            56788999999888753


No 26 
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp. JF8 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, a key step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). BphC belongs to the type I extradiol dioxygenase family, which requires a metal ion in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. This subfamily of BphC is represented by the enzyme purified from the thermophilic biphenyl and naphthalene degrader, Bacillus sp. JF8. The members in this family of BphC enzymes may use either Mn(II) or Fe(II) as cofactors. The enzyme purified from Bacillus sp. JF8 is Mn(II)-dependent, however, the enzyme from Rhodococcus jostii RHAI has Fe(II) bound to it. BphC_JF8 is thermostable and its optimum activity is at 85 degrees C
Probab=24.88  E-value=96  Score=20.81  Aligned_cols=17  Identities=12%  Similarity=0.383  Sum_probs=14.1

Q ss_pred             EEEEECCCCcEEEEEEE
Q psy6694          59 MFGFVDENGELKRISYS   75 (136)
Q Consensus        59 sYsy~~pdG~~~~V~Y~   75 (136)
                      ++.+.||||...++.|-
T Consensus       102 ~~~~~DPdG~~iEl~~~  118 (121)
T cd09013         102 AYRFRSPDGHPMELYWE  118 (121)
T ss_pred             eEEEECCCCCEEEEEEe
Confidence            56789999999988863


No 27 
>PF04170 NlpE:  NlpE N-terminal domain;  InterPro: IPR007298 This family represents a bacterial outer membrane lipoprotein that is necessary for signalling by the Cpx pathway []. This pathway responds to cell envelope disturbances and increases the expression of periplasmic protein folding and degradation factors. While the molecular function of the NlpE protein is unknown, it may be involved in detecting bacterial adhesion to abiotic surfaces. NlpE from Escherichia coli and Salmonella typhi is also known to confer copper tolerance in copper-sensitive strains of E. coli, and may be involved in copper efflux and delivery of copper to copper-dependent enzymes [].; PDB: 3LHN_A 2Z4I_B 2Z4H_A.
Probab=24.78  E-value=2.2e+02  Score=19.09  Aligned_cols=57  Identities=19%  Similarity=0.223  Sum_probs=28.8

Q ss_pred             EEEeeecCCCCCeeEEEecCCCCEEEEeeCCCCeEEEEEEEECCCCcEEEEEEEeeCCCCcccc
Q psy6694          22 LRQINRLNDDGSYTFGYEAADGSFKIETRDVGGNVKGMFGFVDENGELKRISYSARNGTGFQAS   85 (136)
Q Consensus        22 ~~~~~~~~~dGsY~f~yet~dG~~~~E~g~~~~~v~GsYsy~~pdG~~~~V~Y~AD~e~Gf~~~   85 (136)
                      ++..-..+.||+|...-.--+.      .+..-...|+|.|... |..+++.-.+++..=|++.
T Consensus        13 I~t~L~L~~D~ty~l~~~Yl~~------~~~~~~~~g~g~w~~~-~~~i~L~~~~~~~~~f~v~   69 (87)
T PF04170_consen   13 IKTTLTLNADGTYTLTETYLGK------EDGPFTEKGSGTWNVD-GNIITLTDNNGDKRYFKVG   69 (87)
T ss_dssp             EEEEEEE-TTSEEEEEEEEETT------TSCCCEEEEEEEEECT-SSEEEEEETTTTCEEEEEE
T ss_pred             eEEEEEECCCCcEEEEEEECCC------CCCCceEEEEEEEEcc-CCEEEEecCCCCEEEEEEC
Confidence            4444556788876643221111      1123468899999854 5555664443322234443


No 28 
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=24.25  E-value=2.1e+02  Score=18.55  Aligned_cols=14  Identities=21%  Similarity=0.218  Sum_probs=10.0

Q ss_pred             EEEEECCCCcEEEE
Q psy6694          59 MFGFVDENGELKRI   72 (136)
Q Consensus        59 sYsy~~pdG~~~~V   72 (136)
                      ...+.||+|..+++
T Consensus       110 ~~~~~DP~G~~iEl  123 (125)
T cd08352         110 FTFFYDPDGLPLEL  123 (125)
T ss_pred             EEEEECCCCCEEEe
Confidence            45567888887765


No 29 
>TIGR03836 termin_org_HMW1 cytadherence high molecular weight protein 1 N-terminal region. This model describes the N-terminal region of the Mycoplasma cytadherence protein HMW1, up to but not including the first EAGR box domain. The apparent orthologs in different Mycoplasma species differ profoundly in archictecture C-terminally to the region described here.
Probab=23.91  E-value=37  Score=23.26  Aligned_cols=20  Identities=35%  Similarity=0.780  Sum_probs=13.8

Q ss_pred             ECCCCcEEEEEEEeeCCCCccc
Q psy6694          63 VDENGELKRISYSARNGTGFQA   84 (136)
Q Consensus        63 ~~pdG~~~~V~Y~AD~e~Gf~~   84 (136)
                      +-.||. +.|-|-|| .|||-.
T Consensus        28 v~eDg~-ikvAyDaD-gNgYYI   47 (82)
T TIGR03836        28 VPEDGS-IKVAYDAD-GNGYYI   47 (82)
T ss_pred             cCCCCc-EEEEEecC-CCEEEE
Confidence            334664 57888888 788765


No 30 
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=22.98  E-value=1.1e+02  Score=20.46  Aligned_cols=16  Identities=19%  Similarity=0.152  Sum_probs=12.4

Q ss_pred             EEEEECCCCcEEEEEE
Q psy6694          59 MFGFVDENGELKRISY   74 (136)
Q Consensus        59 sYsy~~pdG~~~~V~Y   74 (136)
                      ++.+.||||..+++.+
T Consensus       112 ~~~~~DpdG~~ie~~~  127 (128)
T cd07242         112 ALFFEDPDGIRLELVA  127 (128)
T ss_pred             EEEEECCCCcEEEEEe
Confidence            4566899999888865


No 31 
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II).  The protein superfamily contains members with or without domain swapping.
Probab=22.93  E-value=1.1e+02  Score=20.56  Aligned_cols=14  Identities=29%  Similarity=0.586  Sum_probs=12.2

Q ss_pred             EEECCCCcEEEEEE
Q psy6694          61 GFVDENGELKRISY   74 (136)
Q Consensus        61 sy~~pdG~~~~V~Y   74 (136)
                      -+.||||...++.|
T Consensus       110 ~~~DPdG~~ie~~~  123 (124)
T cd09012         110 SFADLDGHLWEVLW  123 (124)
T ss_pred             EEECCCCCEEEEEE
Confidence            48899999999887


No 32 
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the N-terminal, non-catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=22.89  E-value=1.1e+02  Score=20.88  Aligned_cols=17  Identities=18%  Similarity=0.317  Sum_probs=13.6

Q ss_pred             EEEECCCCcEEEEEEEe
Q psy6694          60 FGFVDENGELKRISYSA   76 (136)
Q Consensus        60 Ysy~~pdG~~~~V~Y~A   76 (136)
                      ..+.||||...++.|.-
T Consensus       104 ~~f~DPdG~~iE~~~~~  120 (124)
T cd08361         104 IAFRDPSGNSIELVVRP  120 (124)
T ss_pred             EEEECcCCCEEEEEEee
Confidence            35899999999987653


No 33 
>PF00659 POLO_box:  POLO box duplicated region;  InterPro: IPR000959 A subgroup of serine/threonine protein kinases, Polo or Polo-like kinases play multiple roles during the cell cycle. Polo kinases are required at several key points through mitosis, starting from control of the G2/M transition through phosphorylation of Cdc25C and mitotic cyclins. Polo kinases are characterised by an amino terminal catalytic domain, and a carboxy terminal non-catalytic domain consisting of three blocks of conserved sequences known as polo boxes which form one single functional domain []. The domain is named after its founding member encoded by the polo gene of Drosophila melanogaster []. This domain of around 70 amino acids has been found in species ranging from yeast to mammals. Polo boxes appear to mediate interaction with multiple proteins through protein:protein interactions; some but not all of these proteins are substrates for the kinase domain of the molecule [].  The crystal structure of the polo domain of the murine protein, Sak, is dimeric, consisting of two alpha-helices and two six-stranded beta-sheets []. The topology of one polypeptide subunit of the dimer consists of, from its N- to C terminus, an extended strand segment, five beta-strands, one alpha-helix (A) and a C-terminal beta-strand. Beta-strands from one subunit form a contiguous antiparallel beta-sheet with beta-strands from the second subunit. The two beta-sheets pack with a crossing angle of 110 degrees, orienting the hydrophobic surfaces inward and the hydrophilic surfaces outward. Helix A, which is colinear with beta-strand 6 of the same polypeptide, buries a large portion of the non-overlapping hydrophobic beta-sheet surfaces. Interactions involving helices A comprise a majority of the hydrophobic core structure and also the dimer interface. Point mutations in the Polo box of the budding yeast Cdc5 protein abolish the ability of overexpressed Cdc5 to interact with the spindle poles and to organise cytokinetic structures [].; GO: 0005515 protein binding; PDB: 1MBY_B 3P37_A 3MHN_A 1Q4K_A 3HIK_A 3Q1I_A 3P35_A 3MHQ_A 1UMW_B 3MQ8_B ....
Probab=22.79  E-value=2.1e+02  Score=18.01  Aligned_cols=38  Identities=24%  Similarity=0.559  Sum_probs=19.6

Q ss_pred             CeeEEEecCCCCEEEEeeCCCCeE----EEEEEEECCCCcEE
Q psy6694          33 SYTFGYEAADGSFKIETRDVGGNV----KGMFGFVDENGELK   70 (136)
Q Consensus        33 sY~f~yet~dG~~~~E~g~~~~~v----~GsYsy~~pdG~~~   70 (136)
                      .|.+.|..+||..+--=.|..-.|    .....|++++|+..
T Consensus         4 k~gi~~~LSng~vqv~FnD~tkivl~~~~~~v~yi~~~~~~~   45 (68)
T PF00659_consen    4 KYGIGYQLSNGTVQVNFNDHTKIVLSPDGRLVTYIDRDGERQ   45 (68)
T ss_dssp             CSEEEEEETTSEEEEEETTS-EEEEETTCCEEEEE-TTS-EE
T ss_pred             ceEEEEEEeCCCEEEEEeCCCEEEECCCCCEEEEECCCCcEE
Confidence            367888888885433322221111    13777888777643


No 34 
>PF09242 FCSD-flav_bind:  Flavocytochrome c sulphide dehydrogenase, flavin-binding;  InterPro: IPR015323 This entry represents the flavin-binding domain of flavocytochrome c sulphide dehydrogenase (FCSD), enzymes found in sulphur-oxidising bacteria such as the purple phototrophic bacteria Chromatium vinosum [, ]. These enzymes are complexes of flavoprotein and a dihaem cytochrome that carry out hydrogen sulphide-dependent cytochrome C reduction. The dihaem cytochrome folds into two domains, each of which resembles mitochondrial cytochrome c, with the two haem groups bound to the interior of the subunit. The flavoprotein subunit has a glutathione reductase-like fold consisting of a beta(3,4)-alpha(3) core, and an alpha+beta sandwich. The active site of the flavoprotein subunit contains a catalytically important disulphide bridge located above the pyrimidine portion of the flavin ring []. Electrons are transferred from the flavin to one of the haem groups in the cytochrome. This entry represents a flavoprotein domain required for binding to flavin, and subsequent electron transfer. ; PDB: 1FCD_A.
Probab=21.17  E-value=1.3e+02  Score=19.80  Aligned_cols=29  Identities=7%  Similarity=-0.010  Sum_probs=20.5

Q ss_pred             EEEEEEECCC-CcEEEEEEEeeCCCCccccC
Q psy6694          57 KGMFGFVDEN-GELKRISYSARNGTGFQASG   86 (136)
Q Consensus        57 ~GsYsy~~pd-G~~~~V~Y~AD~e~Gf~~~g   86 (136)
                      -=.||+++|| |..+.-.|.-+ ++++....
T Consensus         8 NtCYSlv~p~~aIsVa~vy~~~-~~~i~~v~   37 (71)
T PF09242_consen    8 NTCYSLVAPDYAISVAGVYRYD-DGKIVEVP   37 (71)
T ss_dssp             EEEEEEEETTEEEEEEEEEEE--TTTEEE-T
T ss_pred             eeEEEEeCCCceEEEEEEEEEC-CCeEEEeC
Confidence            3479999987 88888889998 66765433


No 35 
>PRK06724 hypothetical protein; Provisional
Probab=20.98  E-value=1.1e+02  Score=21.68  Aligned_cols=21  Identities=29%  Similarity=0.689  Sum_probs=15.3

Q ss_pred             EEEEE--EECCCCcEEEEEEEee
Q psy6694          57 KGMFG--FVDENGELKRISYSAR   77 (136)
Q Consensus        57 ~GsYs--y~~pdG~~~~V~Y~AD   77 (136)
                      .|.|+  +.||||...++.|.++
T Consensus       103 ~g~~~~~f~DPdG~~iEl~~~~~  125 (128)
T PRK06724        103 EGYYTIDFYDPNGFIIEVAYTPN  125 (128)
T ss_pred             CCEEEEEEECCCCCEEEEEeCCC
Confidence            34444  6799999999987653


No 36 
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=20.85  E-value=1.3e+02  Score=19.87  Aligned_cols=15  Identities=20%  Similarity=0.239  Sum_probs=11.8

Q ss_pred             EEEECCCCcEEEEEE
Q psy6694          60 FGFVDENGELKRISY   74 (136)
Q Consensus        60 Ysy~~pdG~~~~V~Y   74 (136)
                      +-+.||||...++..
T Consensus       110 ~~~~DPdG~~iE~~~  124 (125)
T cd08357         110 FFLKDPSGNALEFKA  124 (125)
T ss_pred             EEEECCCCCEEEEee
Confidence            458899999888763


No 37 
>PF06486 DUF1093:  Protein of unknown function (DUF1093);  InterPro: IPR006542 These are a family of small (about 115 amino acids) uncharacterised proteins with N-terminal signal sequences, found exclusively in Gram-positive organisms. Most genomes that have any members of this family have at least two members.; PDB: 3NPP_B 2K5Q_A 2K5W_A.
Probab=20.85  E-value=1.2e+02  Score=19.85  Aligned_cols=20  Identities=25%  Similarity=0.607  Sum_probs=14.8

Q ss_pred             EEEEEE----CCCCcEEEEEEEee
Q psy6694          58 GMFGFV----DENGELKRISYSAR   77 (136)
Q Consensus        58 GsYsy~----~pdG~~~~V~Y~AD   77 (136)
                      +.|.|.    |.+|+.+.|++.|+
T Consensus        26 ~~Y~Y~l~~yd~~G~~k~l~f~~~   49 (78)
T PF06486_consen   26 KGYEYTLKGYDEDGKEKTLTFTAS   49 (78)
T ss_dssp             CEEEEEEEEEETT--EEEEEEEES
T ss_pred             ceEEEEEEEECCCCCEEEEEEEec
Confidence            666664    78999999999997


No 38 
>PTZ00459 mucin-associated surface protein (MASP); Provisional
Probab=20.82  E-value=38  Score=28.23  Aligned_cols=9  Identities=56%  Similarity=0.940  Sum_probs=6.4

Q ss_pred             hHHHHHhcc
Q psy6694           3 RLLLVCTQE   11 (136)
Q Consensus         3 klvlvc~la   11 (136)
                      +.||||+|-
T Consensus         8 RVLLVCALC   16 (291)
T PTZ00459          8 RVLLVCALC   16 (291)
T ss_pred             hHHHHHHHH
Confidence            578888753


No 39 
>PF04234 CopC:  CopC domain;  InterPro: IPR007348 CopC is a bacterial blue copper protein that binds 1 atom of copper per protein molecule. Along with CopA, CopC mediates copper resistance by sequestration of copper in the periplasm [].; GO: 0005507 copper ion binding, 0046688 response to copper ion, 0042597 periplasmic space; PDB: 1IX2_B 1LYQ_A 2C9P_C 2C9R_A 2C9Q_A 1M42_A 1OT4_A 1NM4_A.
Probab=20.70  E-value=1.4e+02  Score=20.33  Aligned_cols=8  Identities=50%  Similarity=0.924  Sum_probs=4.6

Q ss_pred             eEEEEEEE
Q psy6694          55 NVKGMFGF   62 (136)
Q Consensus        55 ~v~GsYsy   62 (136)
                      .+.|+|+|
T Consensus        87 ~~~G~~~F   94 (97)
T PF04234_consen   87 PVSGSFSF   94 (97)
T ss_dssp             EEEEEEEE
T ss_pred             CcCCEEEE
Confidence            45566655


No 40 
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). The enzyme contains a N-terminal and a C-terminal domain of similar structure fold, resulting from an ancient gene duplication. BphC belongs to the type I extradiol dioxygenase family, which requires a metal in the active site for its catalytic activity. Polychlorinated biphenyl degrading bacteria demonstrate multiplicity of BphCs. Bacterium Rhodococcus rhodochrous K37 has eight genes encoding BphC enzymes. This family includes the N-terminal domain of BphC5-RrK37. The crystal structure of the protein from Novosphingobium aromaticivorans has a Mn(II)in the active site, although most proteins of type I extradiol dioxyge
Probab=20.09  E-value=1.4e+02  Score=19.60  Aligned_cols=17  Identities=35%  Similarity=0.526  Sum_probs=13.8

Q ss_pred             EEEEECCCCcEEEEEEE
Q psy6694          59 MFGFVDENGELKRISYS   75 (136)
Q Consensus        59 sYsy~~pdG~~~~V~Y~   75 (136)
                      .+.+.||||....+.+.
T Consensus       101 ~~~~~DP~G~~iel~~~  117 (120)
T cd08362         101 GFRFFDPDGRLIEFSAD  117 (120)
T ss_pred             EEEEECCCCCEEEEEec
Confidence            45689999999888764


No 41 
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]
Probab=20.02  E-value=1.9e+02  Score=23.06  Aligned_cols=29  Identities=24%  Similarity=0.494  Sum_probs=23.5

Q ss_pred             CCeEEEEEEEECCCCcEEEEEEEeeCCCCcc
Q psy6694          53 GGNVKGMFGFVDENGELKRISYSARNGTGFQ   83 (136)
Q Consensus        53 ~~~v~GsYsy~~pdG~~~~V~Y~AD~e~Gf~   83 (136)
                      +..+||.| -+||||+.+.+.|... ..|=.
T Consensus       121 g~a~R~~F-IIDp~g~ir~~~v~~~-~iGRn  149 (194)
T COG0450         121 GLALRGTF-IIDPDGVIRHILVNPL-TIGRN  149 (194)
T ss_pred             CcceeEEE-EECCCCeEEEEEEecC-CCCcC
Confidence            33789998 7899999999999987 55643


Done!