Query         psy6706
Match_columns 119
No_of_seqs    107 out of 330
Neff          5.0 
Searched_HMMs 46136
Date          Sat Aug 17 00:57:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6706.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6706hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3399|consensus              100.0 1.1E-54 2.4E-59  315.1  -2.6  118    1-118     1-119 (122)
  2 PF03226 Yippee-Mis18:  Yippee  100.0 3.6E-33 7.8E-38  192.3   6.2   89   14-108     2-94  (96)
  3 PF11648 RIG-I_C-RD:  C-termina  95.9  0.0034 7.4E-08   45.5   1.1   88   14-103     4-93  (123)
  4 TIGR00357 methionine-R-sulfoxi  94.7   0.038 8.2E-07   41.2   3.4   67   12-86     38-105 (134)
  5 PRK00222 methionine sulfoxide   94.5   0.031 6.8E-07   42.0   2.6   85   12-107    41-125 (142)
  6 PF01641 SelR:  SelR domain;  I  94.3   0.031 6.8E-07   41.0   2.2   71   12-89     35-105 (124)
  7 PRK05508 methionine sulfoxide   94.0   0.065 1.4E-06   39.2   3.3   64   12-85     31-94  (119)
  8 PRK05550 bifunctional methioni  92.2    0.12 2.6E-06   42.7   2.7   64   12-85     34-97  (283)
  9 KOG0856|consensus               90.9    0.33 7.1E-06   36.7   3.6   66   12-85     52-118 (146)
 10 PF14976 FAM72:  FAM72 protein   90.8    0.49 1.1E-05   35.9   4.5   63   13-87     14-88  (150)
 11 PRK14018 trifunctional thiored  90.8    0.26 5.6E-06   43.7   3.5   68   12-86    416-483 (521)
 12 COG0229 Conserved domain frequ  85.6     1.4   3E-05   33.2   3.9   65   12-83     40-104 (140)
 13 PF09814 HECT_2:  HECT-like Ubi  69.4       9  0.0002   31.2   4.5   16   14-29    106-121 (354)
 14 TIGR01053 LSD1 zinc finger dom  58.9     8.9 0.00019   21.6   1.9   21    3-23      8-28  (31)
 15 PF04828 GFA:  Glutathione-depe  47.8      22 0.00048   22.6   2.7   20   64-83     42-61  (92)
 16 PRK02935 hypothetical protein;  47.7      13 0.00029   26.9   1.7   24   13-36     85-108 (110)
 17 PF06943 zf-LSD1:  LSD1 zinc fi  45.2      19 0.00041   19.5   1.7   20    3-22      5-24  (25)
 18 PF03811 Zn_Tnp_IS1:  InsA N-te  40.7      18 0.00039   21.0   1.2   27   69-95      4-31  (36)
 19 PF11023 DUF2614:  Protein of u  39.1      13 0.00029   27.1   0.6   24   13-36     84-107 (114)
 20 PF13465 zf-H2C2_2:  Zinc-finge  34.8      27 0.00058   18.3   1.3   15   10-24     10-24  (26)
 21 TIGR02820 formald_GSH S-(hydro  34.6      53  0.0011   25.5   3.4   30   54-84     74-103 (182)
 22 PF00096 zf-C2H2:  Zinc finger,  31.9     8.5 0.00018   19.0  -1.0   16   15-30      1-16  (23)
 23 COG3791 Uncharacterized conser  30.3      37  0.0008   24.5   1.8   22   66-87     65-86  (133)
 24 PF13912 zf-C2H2_6:  C2H2-type   30.2     7.7 0.00017   19.9  -1.4   18   14-31      1-18  (27)
 25 PF14803 Nudix_N_2:  Nudix N-te  29.8      28 0.00061   19.9   0.9   14   72-85      2-15  (34)
 26 KOG2462|consensus               28.6      18 0.00039   30.1  -0.1   22   10-31    211-232 (279)
 27 PF02945 Endonuclease_7:  Recom  28.0     8.9 0.00019   26.0  -1.7   16   68-83     50-65  (81)
 28 PF13842 Tnp_zf-ribbon_2:  DDE_  27.5      48   0.001   18.5   1.6   15   13-27     15-29  (32)
 29 PF10955 DUF2757:  Protein of u  27.3      26 0.00057   23.7   0.5   16   14-29      4-19  (76)
 30 PF13248 zf-ribbon_3:  zinc-rib  26.0      24 0.00052   18.6   0.1   11   70-80     16-26  (26)
 31 PRK05417 glutathione-dependent  25.8      65  0.0014   25.1   2.5   38   66-107    89-126 (191)
 32 PF10058 DUF2296:  Predicted in  25.7      21 0.00046   22.4  -0.2   35   45-84      2-36  (54)
 33 TIGR00037 eIF_5A translation i  25.1 1.1E+02  0.0024   22.2   3.5   30   36-65     35-64  (130)
 34 smart00132 LIM Zinc-binding do  24.8      29 0.00063   18.4   0.3   13   13-25     26-38  (39)
 35 PF00412 LIM:  LIM domain;  Int  24.4      33 0.00071   20.3   0.5   16   13-28     25-40  (58)
 36 PRK11586 napB nitrate reductas  24.3      48   0.001   25.2   1.5   28   12-39    118-145 (149)
 37 PF10238 Eapp_C:  E2F-associate  24.2      48   0.001   24.7   1.5   26   11-36     26-54  (136)
 38 PF13240 zinc_ribbon_2:  zinc-r  23.4      29 0.00063   18.1   0.1   10   71-80     14-23  (23)
 39 PLN03107 eukaryotic translatio  23.1 1.2E+02  0.0026   22.9   3.5   30   36-65     49-78  (159)
 40 smart00661 RPOL9 RNA polymeras  23.1      96  0.0021   18.1   2.4   17   13-29     19-35  (52)
 41 PF06397 Desulfoferrod_N:  Desu  22.7      48   0.001   19.4   1.0   12   13-24      5-16  (36)
 42 PRK00398 rpoP DNA-directed RNA  21.9      53  0.0011   19.3   1.1   14   14-27      3-16  (46)
 43 KOG2272|consensus               21.6      64  0.0014   27.1   1.8   32   11-46    134-165 (332)
 44 PF10246 MRP-S35:  Mitochondria  21.5      26 0.00057   25.2  -0.4   50   44-98     10-65  (104)
 45 KOG2324|consensus               21.0      71  0.0015   28.1   2.1   13   79-91    271-283 (457)
 46 PRK05978 hypothetical protein;  20.4      50  0.0011   24.9   0.9   24    2-27     42-65  (148)

No 1  
>KOG3399|consensus
Probab=100.00  E-value=1.1e-54  Score=315.15  Aligned_cols=118  Identities=48%  Similarity=0.842  Sum_probs=115.3

Q ss_pred             CcceeeeccCCc-ceEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccCCCccceEeccccEEeeeeeeccCCCc
Q psy6706           1 MGRIFLDHIGGS-RLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTK   79 (119)
Q Consensus         1 MGr~f~~yl~~~-~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~   79 (119)
                      |||+|.++|++. +.|+|++|+||||.++||||++|+|++|+||||++|+||..|+.|+|.|+||+|+|+||+|+.|++.
T Consensus         1 mgR~F~~~l~~~~~~y~C~~C~thla~~~dliSksf~gr~G~AyLf~~vvNv~~ge~e~R~mlTG~h~V~di~C~~C~~~   80 (122)
T KOG3399|consen    1 MGRLFEAMLEANHRLYSCAHCKTHLARHDDLISKSFRGRTGRAYLFNRVVNVIIGETEQRVMLTGLHTVADIFCVLCGTG   80 (122)
T ss_pred             CcchHHHHhccCCceEeccCCcccccchhhccccccccCCCcchhhhhhhhheechHHHHHHHHhHHhhcchhhhhcCCC
Confidence            999999999985 7999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeEEEecccCCCeecCeEEEEeeeeeccccccccCCC
Q psy6706          80 LGWVYEFALEETQRYKEGRVILERALVTESDVKILDLGS  118 (119)
Q Consensus        80 lGWkY~~A~e~sqkYKEGkfILE~~~i~~~~~~~~~~~~  118 (119)
                      |||||+.|||+||||||||||||+++|.+++||+...++
T Consensus        81 ~GWkYe~a~e~sQkyKEGk~ilE~~~i~~~~g~~~~~~~  119 (122)
T KOG3399|consen   81 LGWKYEHAYEKSQKYKEGKFILELAEIFKPEGWDLEVGA  119 (122)
T ss_pred             cceeeeeccCchhhhcCcchHHHHHHhcCCCCchhhcCC
Confidence            999999999999999999999999999999999988765


No 2  
>PF03226 Yippee-Mis18:  Yippee zinc-binding/DNA-binding /Mis18, centromere assembly;  InterPro: IPR004910 This entry represents the Yippee-like (YPEL) family of putative zinc-binding proteins which is highly conserved among eukaryotes. The first protein in this family to be characterised, the Yippee protein from Drosophila, was identified by yeast interaction trap screen as a protein that physically interacts with moth hemolin []. It was subsequently found to be a member of a highly conserved family of proteins found in diverse eukaryotes including plants, animals and fungi []. Mammals contain five members of this family, YPEL1 to YPEL5, while other organisms tend to contain only two or three members. The mammalian proteins all appear to localise in the nucleus. YPEL1-4 are located in an unknown structure located on or close to the mitotic apparatus in the mitotic phase, whereas in the interphase they are located in the nuclei and nucleoli. In contrast, YPEL5 is localised to the centrosome and nucleus during interphase and at the mitotic spindle during mitosis, suggesting a function distinct from that of YPEL1-4. The localisation of the YPEL proteins suggests a novel, thopugh still unknown, function involved in cell division.
Probab=99.98  E-value=3.6e-33  Score=192.33  Aligned_cols=89  Identities=51%  Similarity=0.952  Sum_probs=84.8

Q ss_pred             eEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccCCCccceEecccc----EEeeeeeeccCCCcceeeEEEecc
Q psy6706          14 LFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGR----HMVRDVSCKNCNTKLGWVYEFALE   89 (119)
Q Consensus        14 ~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~----H~v~dI~C~~C~~~lGWkY~~A~e   89 (119)
                      +|.|++|++||+++++|+|  |+|+.|+||||+   ||..+++++|.|+||.    |+|+||+|++|++.|||||++|++
T Consensus         2 vf~C~~C~t~l~ds~~lvs--~~g~~~~a~l~~---~v~~~~~~~~~~~t~~~~~~~~~~~l~C~~C~~~lGwkY~~a~~   76 (96)
T PF03226_consen    2 VFQCKNCKTILADSNELVS--FHGREGKAYLFN---NVSNGVPVDRELMTGETGGDHTVRDLFCSGCNTILGWKYESAPE   76 (96)
T ss_pred             EEECCCCCCCcCCHHHhee--cCCCCccEEEEe---eeeecccccceEEEeeCCCCEEEEEeEcccCChhHCcEEEEcCH
Confidence            7999999999999999999  999999999998   7777888999999999    999999999999999999999999


Q ss_pred             cCCCeecCeEEEEeeeeec
Q psy6706          90 ETQRYKEGRVILERALVTE  108 (119)
Q Consensus        90 ~sqkYKEGkfILE~~~i~~  108 (119)
                      + |+||||+||||++.|..
T Consensus        77 ~-~~~k~g~file~~~i~~   94 (96)
T PF03226_consen   77 E-QKYKEGKFILEKASISS   94 (96)
T ss_pred             h-HhhhCCEEEEEhhHEEE
Confidence            9 99999999999998863


No 3  
>PF11648 RIG-I_C-RD:  C-terminal domain of RIG-I;  InterPro: IPR021673  This family of proteins represents the regulatory domain RD of RIG-I, a protein which initiates a signalling cascade that provides essential antiviral protection for the host. The RD domain binds viral RNA, activating the RIG-I ATPase by RNA-dependent dimerisation. The structure of RD contains a zinc-binding domain and is thought to confer ligand specificity []. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2RQB_A 3GA3_A 2W4R_D 3EQT_A 2RQA_A 2RMJ_A 3NCU_A 2QFD_C 2QFB_D 3TMI_A ....
Probab=95.89  E-value=0.0034  Score=45.49  Aligned_cols=88  Identities=13%  Similarity=0.188  Sum_probs=57.6

Q ss_pred             eEEccCCCCCcCCCCCeeeecccC--CCcceEEEeeeccccCCCccceEeccccEEeeeeeeccCCCcceeeEEEecccC
Q psy6706          14 LFSCAACDTILTNRRELISTRFTG--ATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYEFALEET   91 (119)
Q Consensus        14 ~y~C~~C~thLa~~~~liSk~f~G--~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~lGWkY~~A~e~s   91 (119)
                      .+-|++|.+.++..+||-.-.-+.  --.++  |...+.+...|.+.....-+.+....|+|.+|+..+|-.+..---+=
T Consensus         4 ~llC~kC~~~~C~~~DIr~ie~~hhv~v~p~--F~~~~~~~~~~~~~~~~~~d~~~~~~I~C~~C~~~wG~~m~yk~~~L   81 (123)
T PF11648_consen    4 KLLCRKCKKFACSGSDIRKIENSHHVVVDPE--FWERYIVRPHPKPLQKSFGDWEPNGKIHCKNCGQDWGIMMKYKGVEL   81 (123)
T ss_dssp             EEEETTTTCEEEEGGGEEEETTTEEEE-SHH--HHCTEEEEECSSCTSEEESSSEEEEEEEETSTSBEEEEEEEETTEEE
T ss_pred             EEECCCCCceeEchhheEEecCCcEEEcCcc--ceeeEEeccCCccccceecceEeCCEEEcCCCChHhhhheEECCccc
Confidence            488999999999999987652110  00112  22444455555553344557789999999999999998776544444


Q ss_pred             CCeecCeEEEEe
Q psy6706          92 QRYKEGRVILER  103 (119)
Q Consensus        92 qkYKEGkfILE~  103 (119)
                      .-.|.-.|+++.
T Consensus        82 P~L~iksfvv~~   93 (123)
T PF11648_consen   82 PCLKIKSFVVEL   93 (123)
T ss_dssp             EEE-GGGEEEEE
T ss_pred             cEEEeeeeeeee
Confidence            566677777443


No 4  
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=94.69  E-value=0.038  Score=41.16  Aligned_cols=67  Identities=19%  Similarity=0.485  Sum_probs=42.0

Q ss_pred             cceEEccCCCCCcCCCCCeeeecccCCCcceEEEeee-ccccCCCccceEeccccEEeeeeeeccCCCcceeeEEE
Q psy6706          12 SRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRV-VNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYEF   86 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v-~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~lGWkY~~   86 (119)
                      .-+|.|+.|+++|-++++    -|....|=.-.+..+ -|. +...+|..  -|+.. ..|.|.+|+.+||--...
T Consensus        38 ~G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~~-V~~~~D~s--~gm~R-tEv~C~~Cg~HLGHVF~D  105 (134)
T TIGR00357        38 EGIYVDITCGEPLFSSED----KFDSGCGWPSFYKPISEEV-VAYERDES--HGMIR-TEVRCRNCDAHLGHVFDD  105 (134)
T ss_pred             CeEEEccCCCCccccccc----hhcCCCCCcCcCcccCCCc-eEEeecCC--CCcEE-EEEEecCCCCccCcccCC
Confidence            468999999999987765    355555544444444 122 22233322  24333 579999999999965543


No 5  
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=94.50  E-value=0.031  Score=41.98  Aligned_cols=85  Identities=19%  Similarity=0.380  Sum_probs=49.2

Q ss_pred             cceEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccCCCccceEeccccEEeeeeeeccCCCcceeeEEEecccC
Q psy6706          12 SRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYEFALEET   91 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~lGWkY~~A~e~s   91 (119)
                      .-+|.|+.|+++|=++++    -|....|=.-.+..+-.-.+...+|+  .-|+. =..|.|..|+.+||-.....-  .
T Consensus        41 ~G~Y~C~~Cg~pLF~S~~----Kf~Sg~GWPSF~~~i~~~~V~~~~D~--s~gm~-RtEv~C~~Cg~HLGHVF~DGP--~  111 (142)
T PRK00222         41 KGIYVCIVCGEPLFSSDT----KFDSGCGWPSFTKPIDEEAIRELRDT--SHGMV-RTEVRCANCDSHLGHVFPDGP--K  111 (142)
T ss_pred             CeEEEecCCCchhcCCcc----cccCCCCCcCcCcccCCCceEEeecc--CCCce-EEEEEeCCCCCccCcccCCCC--C
Confidence            568999999999988754    46555665554554421122222222  11222 257999999999997665432  2


Q ss_pred             CCeecCeEEEEeeeee
Q psy6706          92 QRYKEGRVILERALVT  107 (119)
Q Consensus        92 qkYKEGkfILE~~~i~  107 (119)
                      +.  -=+|-|.-+.|.
T Consensus       112 pt--g~RyCINs~sL~  125 (142)
T PRK00222        112 PT--GLRYCINSASLK  125 (142)
T ss_pred             CC--CCEeeeceeeEE
Confidence            21  115555555444


No 6  
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=94.29  E-value=0.031  Score=41.03  Aligned_cols=71  Identities=21%  Similarity=0.475  Sum_probs=42.5

Q ss_pred             cceEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccCCCccceEeccccEEeeeeeeccCCCcceeeEEEecc
Q psy6706          12 SRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYEFALE   89 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~lGWkY~~A~e   89 (119)
                      .-+|.|+.|+++|=+++.    -|....|=.-.+..+..-.+...+|..  -|+ .-..|.|.+|+.+||=-......
T Consensus        35 ~G~Y~C~~Cg~pLF~S~~----Kf~Sg~GWPSF~~~i~~~~v~~~~D~s--~g~-~R~Ev~C~~Cg~HLGHVF~DGp~  105 (124)
T PF01641_consen   35 EGIYVCAVCGTPLFSSDT----KFDSGCGWPSFWQPIPGDAVKEREDFS--HGM-VRTEVRCARCGSHLGHVFDDGPP  105 (124)
T ss_dssp             SEEEEETTTS-EEEEGGG----EETSSSSSSEESSCSSTTSEEEEEEEC--TSS-EEEEEEETTTCCEEEEEESTSST
T ss_pred             CEEEEcCCCCCccccCcc----cccCCcCCccccCcCChHHEEEecccc--CCc-eEEEEEecCCCCccccEeCCCCC
Confidence            468999999999976653    355555554444443321222222222  133 34579999999999976654443


No 7  
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=93.99  E-value=0.065  Score=39.24  Aligned_cols=64  Identities=22%  Similarity=0.510  Sum_probs=42.4

Q ss_pred             cceEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccCCCccceEeccccEEeeeeeeccCCCcceeeEE
Q psy6706          12 SRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYE   85 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~lGWkY~   85 (119)
                      .-+|.|+.|+++|=++++    -|....|=.-.+..+-|. +...+|..   |  .=..|.|.+|+.+||--..
T Consensus        31 ~G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~-v~~~~D~~---~--~RtEv~C~~C~~HLGHVF~   94 (119)
T PRK05508         31 KGTYVCKQCGAPLYRSED----KFKSGCGWPSFDDEIKGA-VKRIPDAD---G--RRTEIVCANCGGHLGHVFE   94 (119)
T ss_pred             CeEEEecCCCCccccccc----cccCCCCCcccCcccccc-eEEEecCC---C--cEEEEEeCCCCCccCcccC
Confidence            468999999999987764    466566654445554332 23333433   2  2467999999999995543


No 8  
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional
Probab=92.23  E-value=0.12  Score=42.67  Aligned_cols=64  Identities=23%  Similarity=0.551  Sum_probs=42.7

Q ss_pred             cceEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccCCCccceEeccccEEeeeeeeccCCCcceeeEE
Q psy6706          12 SRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYE   85 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~lGWkY~   85 (119)
                      .-+|.|+.|+++|=++++    -|....|=.-.++.+-|-.. ..++.   .|+  =..|.|.+|+.+||--..
T Consensus        34 ~G~y~c~~c~~~LF~s~~----Kf~sg~GWPsF~~~~~~~~~-~~~d~---~~~--R~Ev~c~~c~~HLGHvF~   97 (283)
T PRK05550         34 KGVYLCRRCGAPLFRSED----KFNSGCGWPSFDDEIPGAVK-RLPDA---DGR--RTEIVCANCGAHLGHVFE   97 (283)
T ss_pred             CcEEEcCCCCchhcCChh----hccCCCCCcCcCcccCCccE-EEEcC---CCc--eEEEEecCCCCccCcccC
Confidence            468999999999988654    46556665444665544322 22222   233  478999999999996654


No 9  
>KOG0856|consensus
Probab=90.90  E-value=0.33  Score=36.71  Aligned_cols=66  Identities=24%  Similarity=0.518  Sum_probs=37.7

Q ss_pred             cceEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccCCCccceEe-ccccEEeeeeeeccCCCcceeeEE
Q psy6706          12 SRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVM-LTGRHMVRDVSCKNCNTKLGWVYE   85 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m-~TG~H~v~dI~C~~C~~~lGWkY~   85 (119)
                      +-+|.|+.|.++|-.+.-    -|....|=--.|+.+-   .|....+.. .-|.| =.+|.|..|+.+||--.+
T Consensus        52 ~GvY~C~~C~~pLykS~t----KfdsgcGWPAF~e~i~---~gaI~r~~d~s~~~~-R~Ev~Ca~C~~HLGHVF~  118 (146)
T KOG0856|consen   52 EGVYVCAGCGTPLYKSTT----KFDSGCGWPAFFEAIG---PGAITRTPDNSRGGR-RTEVSCATCGGHLGHVFK  118 (146)
T ss_pred             CceEEEeecCCccccccc----cccCCCCCchhhhccC---CCceeeccccCCCCc-ceEEEEeecCCceeeeec
Confidence            469999999999977643    4554445433333321   111111111 01112 357999999999995543


No 10 
>PF14976 FAM72:  FAM72 protein
Probab=90.83  E-value=0.49  Score=35.93  Aligned_cols=63  Identities=24%  Similarity=0.536  Sum_probs=40.7

Q ss_pred             ceEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccC----CCccceEecccc--------EEeeeeeeccCCCcc
Q psy6706          13 RLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNY----SDVQDRVMLTGR--------HMVRDVSCKNCNTKL   80 (119)
Q Consensus        13 ~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~----g~~e~r~m~TG~--------H~v~dI~C~~C~~~l   80 (119)
                      .+..|+.|.+-|+...-           ||.|..+ .|+.+    -||....-.+|.        =.++|+-|.+|+..|
T Consensus        14 ~~L~C~~C~~~l~~RgM-----------kAvLLad-t~ieLySTD~~P~~~v~~vg~~y~t~~C~C~~~d~aC~~CGn~v   81 (150)
T PF14976_consen   14 YILCCKFCDQVLCNRGM-----------KAVLLAD-TNIELYSTDIPPTNCVDFVGSCYFTRTCKCKIQDIACLGCGNIV   81 (150)
T ss_pred             EEEECCCCCchhccchh-----------hheeecC-CccEEEecCCCCcccccccccceecccCceEeeeeeeecCCCee
Confidence            46889999998876432           4555554 33332    122222223333        389999999999999


Q ss_pred             eeeEEEe
Q psy6706          81 GWVYEFA   87 (119)
Q Consensus        81 GWkY~~A   87 (119)
                      |+.+...
T Consensus        82 GYhV~~P   88 (150)
T PF14976_consen   82 GYHVVVP   88 (150)
T ss_pred             eeEEEEE
Confidence            9888764


No 11 
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=90.75  E-value=0.26  Score=43.69  Aligned_cols=68  Identities=10%  Similarity=0.172  Sum_probs=42.6

Q ss_pred             cceEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccCCCccceEeccccEEeeeeeeccCCCcceeeEEE
Q psy6706          12 SRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYEF   86 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~lGWkY~~   86 (119)
                      +-+|.|+.|+++|=++++    -|....|=.-.+..+-+-.+...+|.  .-|++. ..|.|.+|+.+||-....
T Consensus       416 ~G~y~c~~c~~pLf~s~~----Kf~sg~GWPsF~~~i~~~~v~~~~d~--s~g~~R-~Ev~c~~c~~HLGHvf~d  483 (521)
T PRK14018        416 PGIYVDVVSGEPLFSSAD----KYDSGCGWPSFTRPIDAKVVTEHDDF--SYNMRR-TEVRSRAADSHLGHVFPD  483 (521)
T ss_pred             CEEEEecCCCCccccCcc----cccCCCCCcccCcccCcCceEEeecc--CCCceE-EEEEECCCCCcCCcccCC
Confidence            568999999999988753    45555555444444322222222232  123433 479999999999966644


No 12 
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=85.56  E-value=1.4  Score=33.21  Aligned_cols=65  Identities=23%  Similarity=0.469  Sum_probs=38.9

Q ss_pred             cceEEccCCCCCcCCCCCeeeecccCCCcceEEEeeeccccCCCccceEeccccEEeeeeeeccCCCcceee
Q psy6706          12 SRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWV   83 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~lGWk   83 (119)
                      .-+|.|+.|+.+|=.+++=    |....|=--.+.-+..-.+...+|+  .-|++. ..|.|.+|+++||--
T Consensus        40 ~GiY~c~~cg~pLF~S~~K----fdSgcGWPSF~~pi~~~~I~~~~D~--S~gM~R-tEVrc~~c~sHLGHV  104 (140)
T COG0229          40 KGIYVCIVCGEPLFSSEDK----FDSGCGWPSFTKPISPDAITYKEDR--SHGMVR-TEVRCANCDSHLGHV  104 (140)
T ss_pred             CceEEeecCCCcccccccc----ccCCCCCccccccCCcccceEeecc--CCCcEE-EEEEecCCCCccccc
Confidence            4689999999999877653    4434443323333322222233332  223333 469999999999943


No 13 
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=69.35  E-value=9  Score=31.16  Aligned_cols=16  Identities=25%  Similarity=0.592  Sum_probs=13.2

Q ss_pred             eEEccCCCCCcCCCCC
Q psy6706          14 LFSCAACDTILTNRRE   29 (119)
Q Consensus        14 ~y~C~~C~thLa~~~~   29 (119)
                      .+.|++|++.|.....
T Consensus       106 ~~~C~~C~~~li~~~~  121 (354)
T PF09814_consen  106 SLCCRNCKNPLIPSRN  121 (354)
T ss_pred             EEECCCCCCcccCccc
Confidence            7999999999976543


No 14 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=58.85  E-value=8.9  Score=21.64  Aligned_cols=21  Identities=33%  Similarity=0.593  Sum_probs=16.0

Q ss_pred             ceeeeccCCcceEEccCCCCC
Q psy6706           3 RIFLDHIGGSRLFSCAACDTI   23 (119)
Q Consensus         3 r~f~~yl~~~~~y~C~~C~th   23 (119)
                      |+-+.|+.|-+.++|+.|++.
T Consensus         8 ~t~L~yP~gA~~vrCs~C~~v   28 (31)
T TIGR01053         8 RTLLMYPRGASSVRCALCQTV   28 (31)
T ss_pred             CcEeecCCCCCeEECCCCCeE
Confidence            345678888888999998764


No 15 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=47.84  E-value=22  Score=22.58  Aligned_cols=20  Identities=20%  Similarity=0.233  Sum_probs=14.0

Q ss_pred             ccEEeeeeeeccCCCcceee
Q psy6706          64 GRHMVRDVSCKNCNTKLGWV   83 (119)
Q Consensus        64 G~H~v~dI~C~~C~~~lGWk   83 (119)
                      ....+.-.+|.+|++.|.+.
T Consensus        42 s~~~~~r~FC~~CGs~l~~~   61 (92)
T PF04828_consen   42 SGKGVERYFCPTCGSPLFSE   61 (92)
T ss_dssp             TTSSCEEEEETTT--EEEEE
T ss_pred             CCCcCcCcccCCCCCeeecc
Confidence            44556669999999999976


No 16 
>PRK02935 hypothetical protein; Provisional
Probab=47.68  E-value=13  Score=26.90  Aligned_cols=24  Identities=33%  Similarity=0.577  Sum_probs=20.4

Q ss_pred             ceEEccCCCCCcCCCCCeeeeccc
Q psy6706          13 RLFSCAACDTILTNRRELISTRFT   36 (119)
Q Consensus        13 ~~y~C~~C~thLa~~~~liSk~f~   36 (119)
                      ++..|-+|++||+...++--|.|+
T Consensus        85 rvD~CM~C~~PLTLd~~legkefd  108 (110)
T PRK02935         85 RVDACMHCNQPLTLDRSLEGKEFD  108 (110)
T ss_pred             ceeecCcCCCcCCcCccccccCcC
Confidence            788999999999998888766664


No 17 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=45.18  E-value=19  Score=19.53  Aligned_cols=20  Identities=35%  Similarity=0.579  Sum_probs=15.8

Q ss_pred             ceeeeccCCcceEEccCCCC
Q psy6706           3 RIFLDHIGGSRLFSCAACDT   22 (119)
Q Consensus         3 r~f~~yl~~~~~y~C~~C~t   22 (119)
                      |..+.|..|-+.-.|+.|++
T Consensus         5 r~~L~yp~GA~sVrCa~C~~   24 (25)
T PF06943_consen    5 RTLLMYPRGAPSVRCACCHT   24 (25)
T ss_pred             CceEEcCCCCCCeECCccCc
Confidence            45677888878889999876


No 18 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=40.70  E-value=18  Score=21.01  Aligned_cols=27  Identities=26%  Similarity=0.366  Sum_probs=22.0

Q ss_pred             eeeeeccCCCcc-eeeEEEecccCCCee
Q psy6706          69 RDVSCKNCNTKL-GWVYEFALEETQRYK   95 (119)
Q Consensus        69 ~dI~C~~C~~~l-GWkY~~A~e~sqkYK   95 (119)
                      -||.|..|.+.- --|.-+.-.-.|+|.
T Consensus         4 i~v~CP~C~s~~~v~k~G~~~~G~qryr   31 (36)
T PF03811_consen    4 IDVHCPRCQSTEGVKKNGKSPSGHQRYR   31 (36)
T ss_pred             EeeeCCCCCCCCcceeCCCCCCCCEeEe
Confidence            378999999998 777777777778774


No 19 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=39.07  E-value=13  Score=27.08  Aligned_cols=24  Identities=29%  Similarity=0.475  Sum_probs=20.6

Q ss_pred             ceEEccCCCCCcCCCCCeeeeccc
Q psy6706          13 RLFSCAACDTILTNRRELISTRFT   36 (119)
Q Consensus        13 ~~y~C~~C~thLa~~~~liSk~f~   36 (119)
                      +...|-+|++||+...++--|.|+
T Consensus        84 r~D~CM~C~~pLTLd~~legkef~  107 (114)
T PF11023_consen   84 RVDACMHCKEPLTLDPSLEGKEFD  107 (114)
T ss_pred             hhhccCcCCCcCccCchhhcchhh
Confidence            567999999999999988877775


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=34.83  E-value=27  Score=18.26  Aligned_cols=15  Identities=20%  Similarity=0.729  Sum_probs=11.5

Q ss_pred             CCcceEEccCCCCCc
Q psy6706          10 GGSRLFSCAACDTIL   24 (119)
Q Consensus        10 ~~~~~y~C~~C~thL   24 (119)
                      .+++.|.|..|..-+
T Consensus        10 ~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen   10 TGEKPYKCPYCGKSF   24 (26)
T ss_dssp             SSSSSEEESSSSEEE
T ss_pred             CCCCCCCCCCCcCee
Confidence            457889999998543


No 21 
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=34.59  E-value=53  Score=25.51  Aligned_cols=30  Identities=17%  Similarity=0.239  Sum_probs=17.9

Q ss_pred             CCccceEeccccEEeeeeeeccCCCcceeeE
Q psy6706          54 SDVQDRVMLTGRHMVRDVSCKNCNTKLGWVY   84 (119)
Q Consensus        54 g~~e~r~m~TG~H~v~dI~C~~C~~~lGWkY   84 (119)
                      |.........|.+.. --||..|++.|-+..
T Consensus        74 G~~~l~~Y~ss~~~~-R~FC~~CGS~L~~~~  103 (182)
T TIGR02820        74 NGDKLKVVDASATIQ-RHACKGCGTHMYGRI  103 (182)
T ss_pred             CCcceEEEeCCCCEE-eecCCCCCCcccccc
Confidence            443333233344444 449999999996554


No 22 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=31.92  E-value=8.5  Score=19.00  Aligned_cols=16  Identities=19%  Similarity=0.789  Sum_probs=12.3

Q ss_pred             EEccCCCCCcCCCCCe
Q psy6706          15 FSCAACDTILTNRREL   30 (119)
Q Consensus        15 y~C~~C~thLa~~~~l   30 (119)
                      |.|..|+..+...++|
T Consensus         1 y~C~~C~~~f~~~~~l   16 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNL   16 (23)
T ss_dssp             EEETTTTEEESSHHHH
T ss_pred             CCCCCCCCccCCHHHH
Confidence            7899999887776554


No 23 
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=30.30  E-value=37  Score=24.46  Aligned_cols=22  Identities=18%  Similarity=0.246  Sum_probs=16.7

Q ss_pred             EEeeeeeeccCCCcceeeEEEe
Q psy6706          66 HMVRDVSCKNCNTKLGWVYEFA   87 (119)
Q Consensus        66 H~v~dI~C~~C~~~lGWkY~~A   87 (119)
                      +.+.-.+|..|+++|-|+....
T Consensus        65 ~~~~r~FC~~CGs~l~~~~~~~   86 (133)
T COG3791          65 GSAGRGFCPTCGSPLFWRGPDE   86 (133)
T ss_pred             CCCCCeecccCCCceEEecCCC
Confidence            3444449999999999997654


No 24 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=30.19  E-value=7.7  Score=19.94  Aligned_cols=18  Identities=22%  Similarity=0.571  Sum_probs=13.5

Q ss_pred             eEEccCCCCCcCCCCCee
Q psy6706          14 LFSCAACDTILTNRRELI   31 (119)
Q Consensus        14 ~y~C~~C~thLa~~~~li   31 (119)
                      +|.|..|+.-+.+.+.++
T Consensus         1 ~~~C~~C~~~F~~~~~l~   18 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALR   18 (27)
T ss_dssp             SEEETTTTEEESSHHHHH
T ss_pred             CCCCCccCCccCChhHHH
Confidence            588999998877665554


No 25 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=29.84  E-value=28  Score=19.93  Aligned_cols=14  Identities=21%  Similarity=0.415  Sum_probs=7.2

Q ss_pred             eeccCCCcceeeEE
Q psy6706          72 SCKNCNTKLGWVYE   85 (119)
Q Consensus        72 ~C~~C~~~lGWkY~   85 (119)
                      ||..|++.|-++..
T Consensus         2 fC~~CG~~l~~~ip   15 (34)
T PF14803_consen    2 FCPQCGGPLERRIP   15 (34)
T ss_dssp             B-TTT--B-EEE--
T ss_pred             ccccccChhhhhcC
Confidence            79999999988875


No 26 
>KOG2462|consensus
Probab=28.56  E-value=18  Score=30.10  Aligned_cols=22  Identities=32%  Similarity=0.742  Sum_probs=19.1

Q ss_pred             CCcceEEccCCCCCcCCCCCee
Q psy6706          10 GGSRLFSCAACDTILTNRRELI   31 (119)
Q Consensus        10 ~~~~~y~C~~C~thLa~~~~li   31 (119)
                      .|++.|.|.+|+.-+|..+.|-
T Consensus       211 TGEKPF~C~hC~kAFADRSNLR  232 (279)
T KOG2462|consen  211 TGEKPFSCPHCGKAFADRSNLR  232 (279)
T ss_pred             cCCCCccCCcccchhcchHHHH
Confidence            5789999999999999887764


No 27 
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=28.02  E-value=8.9  Score=26.01  Aligned_cols=16  Identities=56%  Similarity=1.059  Sum_probs=14.9

Q ss_pred             eeeeeeccCCCcceee
Q psy6706          68 VRDVSCKNCNTKLGWV   83 (119)
Q Consensus        68 v~dI~C~~C~~~lGWk   83 (119)
                      ||-+-|..|++.||+-
T Consensus        50 vRGlLC~~CN~~lG~~   65 (81)
T PF02945_consen   50 VRGLLCRSCNTALGKV   65 (81)
T ss_dssp             EEEEEEHHHHHHHHHC
T ss_pred             chhhhhhHHhhhhccc
Confidence            9999999999999975


No 28 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=27.50  E-value=48  Score=18.53  Aligned_cols=15  Identities=27%  Similarity=0.640  Sum_probs=12.6

Q ss_pred             ceEEccCCCCCcCCC
Q psy6706          13 RLFSCAACDTILTNR   27 (119)
Q Consensus        13 ~~y~C~~C~thLa~~   27 (119)
                      ..|.|..|..+|...
T Consensus        15 T~~~C~~C~v~lC~~   29 (32)
T PF13842_consen   15 TRYMCSKCDVPLCVE   29 (32)
T ss_pred             eEEEccCCCCcccCC
Confidence            579999999988764


No 29 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=27.26  E-value=26  Score=23.73  Aligned_cols=16  Identities=19%  Similarity=0.478  Sum_probs=13.5

Q ss_pred             eEEccCCCCCcCCCCC
Q psy6706          14 LFSCAACDTILTNRRE   29 (119)
Q Consensus        14 ~y~C~~C~thLa~~~~   29 (119)
                      .|.|++|++.+..-+.
T Consensus         4 ~Y~CRHCg~~IG~i~~   19 (76)
T PF10955_consen    4 HYYCRHCGTKIGTIDA   19 (76)
T ss_pred             EEEecCCCCEEEEeec
Confidence            4999999999987655


No 30 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=26.04  E-value=24  Score=18.64  Aligned_cols=11  Identities=45%  Similarity=0.896  Sum_probs=6.7

Q ss_pred             eeeeccCCCcc
Q psy6706          70 DVSCKNCNTKL   80 (119)
Q Consensus        70 dI~C~~C~~~l   80 (119)
                      +-+|..|++.|
T Consensus        16 ~~fC~~CG~~L   26 (26)
T PF13248_consen   16 AKFCPNCGAKL   26 (26)
T ss_pred             cccChhhCCCC
Confidence            45667666654


No 31 
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=25.77  E-value=65  Score=25.15  Aligned_cols=38  Identities=16%  Similarity=0.175  Sum_probs=23.6

Q ss_pred             EEeeeeeeccCCCcceeeEEEecccCCCeecCeEEEEeeeee
Q psy6706          66 HMVRDVSCKNCNTKLGWVYEFALEETQRYKEGRVILERALVT  107 (119)
Q Consensus        66 H~v~dI~C~~C~~~lGWkY~~A~e~sqkYKEGkfILE~~~i~  107 (119)
                      ..+.--+|..|++.|-+.++..-..    -.|..+|-...+-
T Consensus        89 ~~i~R~FC~~CGS~L~~~~e~~~~~----~pgl~fV~~gllD  126 (191)
T PRK05417         89 ATIQRHACKECGVHMYGRIENKDHP----FYGLDFVHTELSQ  126 (191)
T ss_pred             CCeEeeeCCCCCCccccccccccCC----CCCeEEEehhhcC
Confidence            3355559999999998887622101    1366666555543


No 32 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=25.68  E-value=21  Score=22.39  Aligned_cols=35  Identities=17%  Similarity=0.347  Sum_probs=24.7

Q ss_pred             EeeeccccCCCccceEeccccEEeeeeeeccCCCcceeeE
Q psy6706          45 FHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVY   84 (119)
Q Consensus        45 f~~v~Nv~~g~~e~r~m~TG~H~v~dI~C~~C~~~lGWkY   84 (119)
                      |++++.+..|..+     |+...---+-|.+|..+=|---
T Consensus         2 ~Dki~d~L~G~d~-----~~~~~r~aLIC~~C~~hNGla~   36 (54)
T PF10058_consen    2 FDKILDVLLGDDP-----TSPSNRYALICSKCFSHNGLAP   36 (54)
T ss_pred             hHHHHHHHhCCCC-----ccccCceeEECcccchhhcccc
Confidence            4567777777766     4554445566999999998654


No 33 
>TIGR00037 eIF_5A translation initiation factor eIF-5A. Observed in eukaryotes and archaea.
Probab=25.07  E-value=1.1e+02  Score=22.16  Aligned_cols=30  Identities=13%  Similarity=0.028  Sum_probs=25.4

Q ss_pred             cCCCcceEEEeeeccccCCCccceEecccc
Q psy6706          36 TGATGRAFLFHRVVNLNYSDVQDRVMLTGR   65 (119)
Q Consensus        36 ~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~   65 (119)
                      .|+||.|+.--.+.|+..|..-+..+.++-
T Consensus        35 pGkhG~A~vr~k~knl~tG~~~e~~f~s~~   64 (130)
T TIGR00037        35 PGKHGHAKARVVAIGIFTGKKLEFVSPSTS   64 (130)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEECCCC
Confidence            689999999999999999998877666554


No 34 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=24.79  E-value=29  Score=18.41  Aligned_cols=13  Identities=31%  Similarity=0.774  Sum_probs=10.8

Q ss_pred             ceEEccCCCCCcC
Q psy6706          13 RLFSCAACDTILT   25 (119)
Q Consensus        13 ~~y~C~~C~thLa   25 (119)
                      .-|.|..|+..|+
T Consensus        26 ~Cf~C~~C~~~L~   38 (39)
T smart00132       26 ECFKCSKCGKPLG   38 (39)
T ss_pred             cCCCCcccCCcCc
Confidence            4489999999886


No 35 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=24.36  E-value=33  Score=20.25  Aligned_cols=16  Identities=25%  Similarity=0.681  Sum_probs=13.6

Q ss_pred             ceEEccCCCCCcCCCC
Q psy6706          13 RLFSCAACDTILTNRR   28 (119)
Q Consensus        13 ~~y~C~~C~thLa~~~   28 (119)
                      .-|.|..|+.+|...+
T Consensus        25 ~Cf~C~~C~~~l~~~~   40 (58)
T PF00412_consen   25 ECFKCSKCGKPLNDGD   40 (58)
T ss_dssp             TTSBETTTTCBTTTSS
T ss_pred             cccccCCCCCccCCCe
Confidence            4589999999998776


No 36 
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=24.28  E-value=48  Score=25.25  Aligned_cols=28  Identities=18%  Similarity=0.479  Sum_probs=24.2

Q ss_pred             cceEEccCCCCCcCCCCCeeeecccCCC
Q psy6706          12 SRLFSCAACDTILTNRRELISTRFTGAT   39 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~liSk~f~G~~   39 (119)
                      .+.|-|..|+++=+...-|+.-.|....
T Consensus       118 prRYfCtQCHVPQada~PLV~N~F~~~~  145 (149)
T PRK11586        118 PRRYFCLQCHVPQADTAPIVGNTFTPSK  145 (149)
T ss_pred             ccceeeccccCccccCccCCCCCccchh
Confidence            4779999999999999999999887543


No 37 
>PF10238 Eapp_C:  E2F-associated phosphoprotein;  InterPro: IPR019370 This entry represents E2F binding proteins. E2F transcription factors play an essential role in cell proliferation and apoptosis and their activity is frequently deregulated in human cancers. E2F activity is regulated by a variety of mechanisms, frequently mediated by proteins binding to individual members or a subgroup of the family. E2F-associated phosphoprotein (EAPP)interacts with a subset of E2F factors and influences E2F-dependent promoter activity. EAPP is present throughout the cell cycle but disappears during mitosis []. 
Probab=24.23  E-value=48  Score=24.66  Aligned_cols=26  Identities=23%  Similarity=0.428  Sum_probs=19.8

Q ss_pred             CcceEEccCCCCCcCCCCC---eeeeccc
Q psy6706          11 GSRLFSCAACDTILTNRRE---LISTRFT   36 (119)
Q Consensus        11 ~~~~y~C~~C~thLa~~~~---liSk~f~   36 (119)
                      +..+.+|..|-|.|+...+   ....+|+
T Consensus        26 sDavLsCp~Cft~lc~dcQrHe~y~~QYR   54 (136)
T PF10238_consen   26 SDAVLSCPACFTTLCLDCQRHEKYKNQYR   54 (136)
T ss_pred             CCceEeCccccceeeecccccchhcceee
Confidence            3578999999999997666   5555664


No 38 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=23.40  E-value=29  Score=18.07  Aligned_cols=10  Identities=50%  Similarity=0.933  Sum_probs=5.9

Q ss_pred             eeeccCCCcc
Q psy6706          71 VSCKNCNTKL   80 (119)
Q Consensus        71 I~C~~C~~~l   80 (119)
                      .+|..|++.|
T Consensus        14 ~fC~~CG~~l   23 (23)
T PF13240_consen   14 KFCPNCGTPL   23 (23)
T ss_pred             cchhhhCCcC
Confidence            4566666654


No 39 
>PLN03107 eukaryotic translation initiation factor 5A; Provisional
Probab=23.12  E-value=1.2e+02  Score=22.90  Aligned_cols=30  Identities=13%  Similarity=0.214  Sum_probs=26.0

Q ss_pred             cCCCcceEEEeeeccccCCCccceEecccc
Q psy6706          36 TGATGRAFLFHRVVNLNYSDVQDRVMLTGR   65 (119)
Q Consensus        36 ~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~   65 (119)
                      .|+||.|+.--.+.|+..|...+....++-
T Consensus        49 pGKHG~A~vr~k~knl~TG~k~e~~f~s~~   78 (159)
T PLN03107         49 TGKHGHAKCHFVAIDIFTGKKLEDIVPSSH   78 (159)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEecCCC
Confidence            799999999999999999999887776654


No 40 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=23.12  E-value=96  Score=18.08  Aligned_cols=17  Identities=24%  Similarity=0.464  Sum_probs=12.7

Q ss_pred             ceEEccCCCCCcCCCCC
Q psy6706          13 RLFSCAACDTILTNRRE   29 (119)
Q Consensus        13 ~~y~C~~C~thLa~~~~   29 (119)
                      ..|.|..|+-+......
T Consensus        19 ~~~vC~~Cg~~~~~~~~   35 (52)
T smart00661       19 RRFVCRKCGYEEPIEQK   35 (52)
T ss_pred             CEEECCcCCCeEECCCc
Confidence            47999999987665554


No 41 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=22.68  E-value=48  Score=19.36  Aligned_cols=12  Identities=25%  Similarity=1.005  Sum_probs=7.4

Q ss_pred             ceEEccCCCCCc
Q psy6706          13 RLFSCAACDTIL   24 (119)
Q Consensus        13 ~~y~C~~C~thL   24 (119)
                      .+|.|.+|++-+
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            689999999765


No 42 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=21.86  E-value=53  Score=19.27  Aligned_cols=14  Identities=21%  Similarity=0.544  Sum_probs=9.9

Q ss_pred             eEEccCCCCCcCCC
Q psy6706          14 LFSCAACDTILTNR   27 (119)
Q Consensus        14 ~y~C~~C~thLa~~   27 (119)
                      .|.|.+|++.+...
T Consensus         3 ~y~C~~CG~~~~~~   16 (46)
T PRK00398          3 EYKCARCGREVELD   16 (46)
T ss_pred             EEECCCCCCEEEEC
Confidence            58888888766543


No 43 
>KOG2272|consensus
Probab=21.60  E-value=64  Score=27.09  Aligned_cols=32  Identities=22%  Similarity=0.599  Sum_probs=20.7

Q ss_pred             CcceEEccCCCCCcCCCCCeeeecccCCCcceEEEe
Q psy6706          11 GSRLFSCAACDTILTNRRELISTRFTGATGRAFLFH   46 (119)
Q Consensus        11 ~~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~   46 (119)
                      +..+|.|..|+.|+-. +.|+   |+|..=-+|.|+
T Consensus       134 ~~g~YvC~KCh~~iD~-~~l~---fr~d~yH~yHFk  165 (332)
T KOG2272|consen  134 GRGRYVCQKCHAHIDE-QPLT---FRGDPYHPYHFK  165 (332)
T ss_pred             ccceeehhhhhhhccc-cccc---ccCCCCCcccee
Confidence            3447888888888876 3332   555555566676


No 44 
>PF10246 MRP-S35:  Mitochondrial ribosomal protein MRP-S35;  InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This is a family of short mitochondrial ribosomal proteins, less than 200 amino acids long. MRP-S35 was proposed as a more appropriate name to this group of proteins [].
Probab=21.48  E-value=26  Score=25.17  Aligned_cols=50  Identities=18%  Similarity=0.363  Sum_probs=31.2

Q ss_pred             EEeeeccccCCCccceEecccc--EEeeeeeeccCCCcceeeEE----EecccCCCeecCe
Q psy6706          44 LFHRVVNLNYSDVQDRVMLTGR--HMVRDVSCKNCNTKLGWVYE----FALEETQRYKEGR   98 (119)
Q Consensus        44 Lf~~v~Nv~~g~~e~r~m~TG~--H~v~dI~C~~C~~~lGWkY~----~A~e~sqkYKEGk   98 (119)
                      |+++--=+..|+++++. ++|.  |+|.|--    ---.|||..    +.-.++++|..|-
T Consensus        10 lLR~S~fi~lG~~~gk~-V~G~I~hvv~ddL----YIDfG~KFhcVc~rp~~~~~~y~~G~   65 (104)
T PF10246_consen   10 LLRNSPFIQLGDPEGKI-VIGKIFHVVDDDL----YIDFGGKFHCVCKRPAVNGEKYVRGS   65 (104)
T ss_pred             HhcCChhhhcCCccCCE-EEEEEEEEecCce----EEEeCCceeEEEecccccccccccCC
Confidence            33433345578888876 5675  8887621    124688864    3345778899984


No 45 
>KOG2324|consensus
Probab=21.02  E-value=71  Score=28.12  Aligned_cols=13  Identities=31%  Similarity=0.343  Sum_probs=10.5

Q ss_pred             cceeeEEEecccC
Q psy6706          79 KLGWVYEFALEET   91 (119)
Q Consensus        79 ~lGWkY~~A~e~s   91 (119)
                      .||=||-+++...
T Consensus       271 ~LG~kYS~~lna~  283 (457)
T KOG2324|consen  271 LLGTKYSKPLNAK  283 (457)
T ss_pred             EeccccccccCce
Confidence            6899998888655


No 46 
>PRK05978 hypothetical protein; Provisional
Probab=20.39  E-value=50  Score=24.89  Aligned_cols=24  Identities=29%  Similarity=0.611  Sum_probs=19.4

Q ss_pred             cceeeeccCCcceEEccCCCCCcCCC
Q psy6706           2 GRIFLDHIGGSRLFSCAACDTILTNR   27 (119)
Q Consensus         2 Gr~f~~yl~~~~~y~C~~C~thLa~~   27 (119)
                      |++|..||.=  .=.|.+|+.++...
T Consensus        42 G~LF~g~Lkv--~~~C~~CG~~~~~~   65 (148)
T PRK05978         42 GKLFRAFLKP--VDHCAACGEDFTHH   65 (148)
T ss_pred             Cccccccccc--CCCccccCCccccC
Confidence            7889999873  35799999998765


Done!