Diaphorina citri psyllid: psy6707


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MDKSVILSSLKLASESQQKQQMEIHRFHQEQFKRQQEHLLQQQHKIQELQVFNYSSLSSSAGKMSMSSPGKEKTPEYNMHGMYSPHHDKNMYSPHDKNMYSPHDKNMYSPHHDKSEEQDLLMSVWGAGGESPYKMPEETPDKGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCRGEAGPSGSGGPAFPFPGDGSLSPSDMMPFSPGSPGSMDSHDED
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccc
*************************************************************************************************************************MSVWGAG****************RWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRY******TCIVDGKKMRISEY*************LWC********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKSVILSSLKLASESQQKQQMEIHRFHQEQFKRQQEHLLQQQHKIQELQVFNYSSLSSSAGKMSMSSPGKEKTPEYNMHGMYSPHHDKNMYSPHDKNMYSPHDKNMYSPHHDKSEEQDLLMSVWGAGGESPYKMPEETPDKGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCRGEAGPSGSGGPAFPFPGDGSLSPSDMMPFSPGSPGSMDSHDED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032332 [BP]positive regulation of chondrocyte differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0032330, GO:0045595, GO:0061035, GO:2000026, GO:0008150, GO:0051239, GO:0048518, GO:0065007, GO:0050789, GO:0048522
GO:2000741 [BP]positive regulation of mesenchymal stem cell differentiationprobableGO:2000736, GO:0051094, GO:0050793, GO:2000738, GO:2000739, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0071560 [BP]cellular response to transforming growth factor beta stimulusprobableGO:0071495, GO:0009719, GO:0051716, GO:0071363, GO:0050896, GO:0009987, GO:0044763, GO:0070848, GO:0010033, GO:0071310, GO:0008150, GO:0070887, GO:0042221, GO:0071559, GO:0044699
GO:0061036 [BP]positive regulation of cartilage developmentprobableGO:0051094, GO:0050793, GO:0008150, GO:0061035, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GZK, chain A
Confidence level:very confident
Coverage over the Query: 110-212
View the alignment between query and template
View the model in PyMOL
Template: 2GZK, chain A
Confidence level:very confident
Coverage over the Query: 52-176
View the alignment between query and template
View the model in PyMOL