Diaphorina citri psyllid: psy6716

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-

MEGEGNNHARNQFPTHHLPGSLINNLTPSTPLLNIIQLNQDKPVNEMYEAILKKLKLDPEEKKLARNILSEVLKAETNVKWADIAGLDDAKDLLYEAIVLPSIIPAYFDKLRRPWKGVLLVGPPGTGKTMLAKAAATETKSNFFNITSSTLTSKWYGDSEKLIRLLFLLAKELAPSIVFFDEIDSMCSHRSTSTDVTRRMKSELLCQMDGLASVSNEDPNKSVLILAATNFPWDLDEAFRRRLEKRIYVPIPDQATRVSLLTIFLQNVKVDKDVNIEVLNVKVDKDVNIEVLAERLEGYSSADITIVCRDAAFMNLRRYLNQNPAVAMKDIPDKELDKAIVQADFDEAVRNCPKTVRPEDAEKFTDWIKWL

ccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccccccccccEEEEEccccccHHHHHHHHHHHcccCEEEEEccccccccccccHHHHHHHHHHHHHccccEEEECccccccccccccccHHHHHHHHHHHHHcccccccccccccEEEEEEEccccccccHHHHHccccccccccccHHHHHHHHHHHHcccccccccHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHc

*********************LINNLTPSTPLLNIIQLNQDKPVNEMYEAILKKLKLDPEEKKLARNILSEVLKAETNVKWADIAGLDDAKDLLYEAIVLPSIIPAYFDKLRRPWKGVLLVGPPGTGKTMLAKAAATETKSNFFNITSSTLTSKWYGDSEKLIRLLFLLAKELAPSIVFFDEIDSMCS**************ELLCQMDGLASVSNEDPNKSVLILAATNFPWDLDEAFRRRLEKRIYVPIPDQATRVSLLTIFLQNVKVDKDVNIEVLNVKVDKDVNIEVLAERLEGYSSADITIVCRDAAFMNLRRYLNQNPAVAMKDIPDKELDKAIVQADFDEAVRNCPK****EDAEKFTDWIKWL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Katanin p60 ATPase-containing subunit A-like 1	Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Microtubule release from the mitotic spindle poles may allow depolymerization of the microtubule end proximal to the spindle pole, leading to poleward microtubule flux and poleward motion of chromosome. Microtubule release within the cell body of neurons may be required for their transport into neuronal processes by microtubule-dependent motor proteins. This transport is required for axonal growth.	confident	B7NZ88
Katanin p60 ATPase-containing subunit A1	Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation.	confident	Q0IIR9
Katanin p60 ATPase-containing subunit A-like 1	Severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays.	confident	Q8K0T4

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000166 [MF]	nucleotide binding	probable	GO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0007283 [BP]	spermatogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034214 [BP]	protein hexamerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0008568 [MF]	microtubule-severing ATPase activity	probable	GO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0051246 [BP]	regulation of protein metabolic process	probable	GO:0080090, GO:0019222, GO:0060255, GO:0008150, GO:0065007, GO:0050789
GO:0000922 [CC]	spindle pole	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0051013 [BP]	microtubule severing	probable	GO:0008150, GO:0009987, GO:0007017, GO:0044763, GO:0044699
GO:0045211 [CC]	postsynaptic membrane	probable	GO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0022402 [BP]	cell cycle process	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006200 [BP]	ATP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0045502 [MF]	dynein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031122 [BP]	cytoplasmic microtubule organization	probable	GO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0071840, GO:0044763, GO:0044699
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005778 [CC]	peroxisomal membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0000785 [CC]	chromatin	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043167 [MF]	ion binding	probable	GO:0003674, GO:0005488
GO:0030496 [CC]	midbody	probable	GO:0005575, GO:0044464, GO:0005623
GO:0030426 [CC]	growth cone	probable	GO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0010604 [BP]	positive regulation of macromolecule metabolic process	probable	GO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000502 [CC]	proteasome complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0051130 [BP]	positive regulation of cellular component organization	probable	GO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005874 [CC]	microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0043170 [BP]	macromolecule metabolic process	probable	GO:0071704, GO:0008150, GO:0008152
GO:0031323 [BP]	regulation of cellular metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0051260 [BP]	protein homooligomerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0010977 [BP]	negative regulation of neuron projection development	probable	GO:0010975, GO:0030154, GO:0051129, GO:0051128, GO:0031345, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0044763, GO:0048523
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B9P, chain A
Confidence level:very confident
Coverage over the Query: 65-271,284-320,334-368
View the alignment between query and template
View the model in PyMOL

Template: 3CF2, chain A
Confidence level:very confident
Coverage over the Query: 14-186,197-268,284-286,303-315,331-349
View the alignment between query and template
View the model in PyMOL